
SimulationCraft 504-2

for World of Warcraft 5.0.4 Live (build level 15913)

Beta Release

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 movement,players_only=1,first=10,cooldown=10,duration=4

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.49 2.46 2.81 - - - 2.46 - 1.46 1.13 2.27 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.65 2.25 2.92 - - - 2.25 - 1.52 1.44 1.47 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.31 2.24 2.64 - - - 2.24 - 1.37 0.83 2.17 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.31 2.34 2.67 - - - 2.34 - 1.42 1.56 2.28 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.51 1.64 2.81 - - - 1.64 - 1.47 2.70 1.36 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.11 2.18 2.51 - - - 2.18 - 1.32 1.09 2.03 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.23 2.44 2.62 - - - 2.44 - 1.34 0.91 2.24 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.48 1.66 2.80 - - - 1.66 - 1.44 1.98 1.36 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.13 2.14 2.49 - - - 2.14 - 1.29 0.56 2.10 - - - - - - wowhead lootrank

priest_90_di_fdcl : 90584 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
90583.9 90583.9 29.07 / 0.03% 7719 / 8.5% 15.2 5763.7 5202.2 Mana 3.18% 42.1 100.0%
  • mind_spike
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.49 2.46 2.81 2.46 1.46 1.13 2.27
Normalized 1.00 0.71 0.81 0.71 0.42 0.32 0.65
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.04 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:308702|149012|122275|103386|102971|87324|85386|77239|71385|69353|52804|39889&chds=0,617404&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9&chm=t++308702++devouring_plague,9482C9,0,0,15|t++149012++vampiric_touch,9482C9,1,0,15|t++122275++halo_damage,9482C9,2,0,15|t++103386++shadow_word_death,9482C9,3,0,15|t++102971++mind_flay_mastery,9482C9,4,0,15|t++87324++mind_blast,9482C9,5,0,15|t++85386++devouring_plague_mastery,9482C9,6,0,15|t++77239++mind_spike,000066,7,0,15|t++71385++vampiric_touch_mastery,9482C9,8,0,15|t++69353++shadow_word_pain_mastery,9482C9,9,0,15|t++52804++shadow_word_pain,9482C9,10,0,15|t++39889++mind_flay,9482C9,11,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:15,14,12,10,9,7,7,5,4,4,3,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|mind_blast|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadow_word_death|mind_flay_mastery|halo_damage|shadowfiend: melee|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.49,2.81,2.46,2.46,2.27,1.46,1.13|3.45,2.77,2.42,2.42,2.23,1.42,1.09|3.53,2.86,2.50,2.50,2.31,1.50,1.17&chds=0,6.98&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.49++Int,8A8A8A,0,0,15,0.1|t++++2.81++SP,8A8A8A,0,1,15,0.1|t++++2.46++Spi,8A8A8A,0,2,15,0.1|t++++2.46++Hit,8A8A8A,0,3,15,0.1|t++++2.27++Mastery,8A8A8A,0,4,15,0.1|t++++1.46++Crit,8A8A8A,0,5,15,0.1|t++++1.13++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:866556777764533430yxvutsrqonmlkjiiiihiiihhhgghhghgggggfffffeddddcdddddddddcdddddddeedeeedddccccccccdccbbabbbccbcbcbcccddeefffghhhhhhhhhiiiiihggfeeeeddccccbcbbbbbbbbbccccccbcccdddeeffggghiijjjjjjjjjjjihhgffffeeeddccccccddccccbcccccbbbbbccccccccddeeeefeeffefffffffffeeeeedddcccccccbbbaaabaaaaaaaaaaaabbbbbbbbbbbbbbbbbcbbbbbbbbbbbbbbbbbbbbbbbbbbbaabbbbbaaaaabbccddefghijklmmnoppqqqrrrrqpppoonmllkkjjjjjiihhhhhhhhhggggghhhhhhhhhhiiiiiiiiiiiiiiiiiiihiihhhhhhhhhhhhhggggggggggggggfgggggghhhhhiiiiiiiiijjjkkkkkjjkkkkkjjjiiiiihhggggfffffeeeeddeeeeeefhhijjkklmnoopqqqrrrrrpponnnnnmmllllk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=578|1:|0|avg=90584|max=167569&chxp=1,1,54,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,1,0,3,4,8,10,14,38,44,44,77,101,144,211,297,401,432,589,739,958,1147,1309,1617,1963,2187,2807,3234,3785,4566,5540,6424,7396,8264,8691,8324,7616,6451,5052,3694,2486,1513,886,487,252,121,44,21,6&chds=0,8691&chbh=5&chxt=x&chxl=0:|min=62535|avg=90584|max=104268&chxp=0,1,67,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:29.9,25.5,12.4,8.5,5.4,4.8,3.2,2.4,1.3,0.7,3.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=mind_flay 134.9s|shadow_word_pain 115.2s|mind_blast 55.8s|mind_spike 38.3s|vampiric_touch 24.6s|devouring_plague 21.6s|shadow_word_death 14.3s|halo_damage 10.8s|dispersion 5.7s|shadowfiend 3.1s|waiting 14.4s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_fdcl 90584
berserking 0 0.0% 3.0 180.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 14817 16.3% 18.2 25.89sec 366437 308702 127118 262433 154311 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 0.00 0.00 1.1870 0.0000 2810686.24 2810686.24 0.00 308702.06 308702.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 14.55 79.86% 127117.84 120670 157491 127153.49 120670 136912 1849038 1849038 0.00
crit 3.66 20.12% 262432.71 248580 324432 257529.33 0 324432 961648 961648 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2481 2.7% 43.7 10.26sec 25573 85386 21098 43585 25573 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 43.69 43.69 0.00 0.00 0.2995 0.0000 1117356.64 1117356.64 0.00 85385.65 85385.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.98 80.05% 21097.70 20014 26121 21103.84 20014 22731 737920 737920 0.00
crit 8.71 19.92% 43584.96 41228 53810 43588.31 0 53810 379436 379436 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 8578 9.5% 18.2 25.89sec 212126 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150.8 21092 43539 25630 20.2% 0.0% 25.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 150.75 150.75 0.0000 0.7534 3863761.04 3863761.04 0.00 34018.87 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 120.3 79.79% 21092.06 20021 55801 21096.20 20204 24120 2536971 2536971 0.00
crit 30.5 20.21% 43539.45 41243 114951 43549.17 41243 51370 1326790 1326790 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.3 178.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 7.0 0 0 0 0.0% 0.0% 1.2%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.30 1.30 6.95 6.95 4.3477 0.7629 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 1.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:47585
  • name:Dispersion
  • school:physical
  • tooltip:Reduces all damage by $s1%, and you regenerate $49766s1% mana every $60069t1 sec for $d. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by $47585s1%. You are unable to attack or cast spells, but you regenerate $49766s1% mana every $60069t1 sec for $d. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 2949 3.2% 9.3 49.19sec 142527 122275 118428 244916 143015 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.30 9.27 0.00 0.00 1.1656 0.0000 1325951.93 1325951.93 0.00 122275.17 122275.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.46 80.51% 118427.66 112598 140757 118483.88 112598 140757 883996 883996 0.00
crit 1.80 19.46% 244915.95 231952 289959 210684.69 0 289959 441956 441956 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 10819 11.9% 46.3 9.70sec 105245 87324 86776 179141 105245 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 46.34 46.34 0.00 0.00 1.2052 0.0000 4876695.04 4876695.04 0.00 87323.98 87323.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 37.05 79.96% 86776.34 82915 108661 86796.08 84261 91987 3215013 3215013 0.00
crit 9.28 20.02% 179141.24 170805 223841 179167.34 0 214396 1661682 1661682 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 11908 13.2% 88.2 5.03sec 60965 39889 0 0 0 0.0% 0.0% 0.0% 0.0% 151.3 29270 60487 35557 20.1% 0.0% 24.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 88.24 88.24 151.29 151.29 1.5284 0.7367 5379386.22 5379386.22 0.00 39888.97 39888.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 88.22 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 120.8 79.86% 29269.68 27880 36400 29276.59 28506 30309 3536234 3536234 0.00
crit 30.5 20.14% 60486.81 57433 74983 60503.98 57602 66237 1843152 1843152 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2994 3.3% 43.9 9.96sec 30841 102971 25426 52548 30841 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 43.85 43.85 0.00 0.00 0.2995 0.0000 1352524.02 1352524.02 0.00 102971.00 102971.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 35.08 79.99% 25426.33 24241 31649 25432.03 24391 27435 891894 891894 0.00
crit 8.77 19.99% 52547.54 49937 65196 52549.20 0 65196 460630 460630 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6568 7.2% 32.5 13.13sec 91049 77239 75132 155135 91049 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 32.50 32.50 0.00 0.00 1.1788 0.0000 2958867.13 2958867.13 0.00 77238.88 77238.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 26.02 80.06% 75132.45 71937 94532 75149.15 71937 81640 1954794 1954794 0.00
crit 6.47 19.92% 155135.37 148190 194736 154813.77 0 194736 1004073 1004073 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3294 3.6% 12.0 6.01sec 123470 103386 101572 210026 123470 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 12.01 12.01 0.00 0.00 1.1943 0.0000 1483069.58 1483069.58 0.00 103385.82 103385.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.58 79.76% 101572.46 94128 123585 101645.26 94128 123585 973167 973167 0.00
crit 2.43 20.21% 210025.83 193905 254586 193547.48 0 254586 509903 509903 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 13500 14.9% 98.0 4.52sec 62077 52804 0 0 0 0.0% 0.0% 0.0% 0.0% 292.5 15781 32565 20804 29.9% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 98.03 98.03 292.51 292.51 1.1756 1.4859 6085499.32 6085499.32 0.00 11066.76 52803.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 98.01 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 205.0 70.07% 15781.14 15106 19713 15784.55 15443 16188 3234650 3234650 0.00
crit 87.5 29.93% 32565.18 31119 40608 32572.06 31707 33959 2850850 2850850 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3904 4.3% 84.8 5.22sec 20755 69353 15754 32508 20755 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 84.79 84.79 0.00 0.00 0.2993 0.0000 1759758.04 1759758.04 0.00 69352.80 69352.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 59.44 70.10% 15753.63 15106 19713 15756.60 15283 16488 936388 936388 0.00
crit 25.33 29.87% 32508.49 31119 40608 32515.92 31119 34968 823370 823370 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowfiend 0 0.0% 3.0 181.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 1.0403 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 4340 4.8% 91.8 4.84sec 21314 0 18029 36140 21632 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 91.84 90.49 0.00 0.00 0.0000 0.0000 1957412.17 1957412.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 72.44 80.06% 18029.08 17249 22664 18032.30 17487 18659 1306038 1306038 0.00
crit 18.02 19.92% 36139.62 34498 45328 36147.77 34498 40150 651374 651374 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8120 9.0% 20.4 21.98sec 178944 149012 0 0 0 0.0% 0.0% 0.0% 0.0% 169.0 17861 36854 21646 19.9% 0.0% 83.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.44 20.44 169.00 169.00 1.2009 2.2358 3658239.38 3658239.38 0.00 9091.07 149011.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 20.44 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 135.3 80.07% 17860.88 16883 22312 17866.14 17123 18608 2416910 2416910 0.00
crit 33.7 19.93% 36853.74 34779 45963 36864.69 34779 40406 1241329 1241329 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2324 2.6% 49.0 8.83sec 21378 71385 17644 36444 21378 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 48.97 48.97 0.00 0.00 0.2995 0.0000 1046929.46 1046929.46 0.00 71384.80 71384.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 39.22 80.09% 17644.23 16883 22312 17648.47 16944 18789 692078 692078 0.00
crit 9.74 19.88% 36444.07 34779 45963 36448.34 0 45963 354852 354852 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - shadowfiend 32929 / 2568
melee 32929 2.8% 39.4 9.55sec 29088 33936 25049 50152 29088 22.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.44 39.44 0.00 0.00 0.8572 0.0000 1147364.83 1147364.83 0.00 33935.66 33935.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 21.26 53.91% 25048.95 19717 29593 25061.51 22604 27933 532618 532618 0.00
crit 8.71 22.09% 50152.34 39434 59187 50170.46 0 59187 437040 437040 0.00
glance 9.46 23.98% 18790.54 14788 22195 18799.28 0 22195 177707 177707 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.88 5.88 0.00 0.00 1.0824 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.2 54.6 3.0 3.0 122164.6
halo_damage Mana 9.3 418642.7 45000.0 45000.0 3.2
mind_blast Mana 46.3 250598.1 5408.2 5408.2 19.5
mind_flay Mana 88.2 264710.5 3000.0 3000.0 20.3
mind_spike Mana 32.5 97493.0 3000.0 3000.0 30.3
shadow_word_death Mana 12.0 93690.2 7800.0 7800.0 15.8
shadow_word_pain Mana 98.0 1294021.5 13200.0 13200.0 4.7
vampiric_touch Mana 20.4 183991.5 9000.0 9000.0 19.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1806.09 530531.26 293.75 11296.92 2.08%
dispersion Mana 6.95 125118.00 18000.00 0.00 0.00%
shadowfiend Mana 39.43 285964.32 7251.61 68947.08 19.43%
Shadow Orbs from Mind Blast Shadow Orb 46.33 46.33 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.42 6.42 1.00 0.00 0.00%
Devouring Plague Health Health 194.45 0.00 0.00 2674152.14 100.00%
Vampiric Touch Mana Mana 217.97 1407949.11 6459.26 46811.88 3.22%
Resource RPS-Gain RPS-Loss
Mana 5202.19 5763.66
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 11%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 17.9 0.9 23.6sec 22.4sec 6% 37%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.5%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.3sec 123.3sec 18% 18%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:18.0%
glyph_mind_spike 24.7 7.7 17.4sec 13.1sec 27% 30%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:21.9%
  • glyph_mind_spike_2:5.2%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_magistrate_figurine 7.7 0.0 60.8sec 60.8sec 25% 25%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.3%
jade_serpent_potion 2.0 0.0 422.6sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.0%
jade_spirit 8.7 0.0 54.6sec 54.6sec 23% 23%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
raid_movement 44.6 0.0 10.0sec 10.0sec 39% 39%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 6.4 0.0 11.9sec 11.9sec 8% 47%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.2%
surge_of_darkness 30.1 2.6 14.3sec 13.1sec 12% 100%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:11.3%
  • surge_of_darkness_2:0.6%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 8.0 0.0 60.7sec 60.7sec 17% 17%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
shadowfiend-shadowcrawl 5.9 0.0 74.6sec 74.6sec 83% 79%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 2.2%
shadowfiend-Mana Cap 2.2%
lightwell-Mana Cap 2.2%


Count Interval
Shadowy Recall Extra Tick 221.3 2.0sec
Shadowy Apparition Procced 91.8 4.8sec
Divine Insight Mind Blast CD Reset 18.8 22.4sec
FDCL Mind Spike proc 32.7 13.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.65
Minimum 334.81
Maximum 578.76
Spread ( max - min ) 243.95
Range [ ( max - min ) / 2 * 100% ] 27.01%


Sample Data
Count 100000
Mean 90583.90
Minimum 62534.60
Maximum 104267.50
Spread ( max - min ) 41732.90
Range [ ( max - min ) / 2 * 100% ] 23.04%
Standard Deviation 4690.6311
5th Percentile 81552.52
95th Percentile 96990.31
( 95th Percentile - 5th Percentile ) 15437.79
Mean Distribution
Standard Deviation 14.8331
95.00% Confidence Intervall ( 90554.83 - 90612.97 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10300
0.1 Scale Factor Error with Delta=300 187821
0.05 Scale Factor Error with Delta=300 751287
0.01 Scale Factor Error with Delta=300 18782189
Distribution Chart


Sample Data
Count 100000
Mean 90583.90


Sample Data
Count 100000
Mean 39676136.19


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 316.70
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
F shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
G shadow_word_death,if=num_targets<=4
H vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
I halo_damage
J shadowfiend,if=cooldown_react
K mind_sear,chain=1,interrupt=1,if=num_targets>=2
L mind_flay,chain=1,interrupt=1
M shadow_word_death,moving=1
N mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
O shadow_word_pain,moving=1
P dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.49, Spirit=2.46, SpellDamage=2.81, HitRating=2.46, CritRating=1.46, HasteRating=1.13, MasteryRating=2.27 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.49, Spirit=2.46, SpellDamage=2.81, HitRating=0.00, CritRating=1.46, HasteRating=1.13, MasteryRating=2.27 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=3.49, Spirit=2.46, SpellDamage=2.81, HitRating=2.46, CritRating=1.46, HasteRating=1.13, MasteryRating=2.27 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=3.49, Spirit=2.46, SpellDamage=2.81, HitRating=0.00, CritRating=1.46, HasteRating=1.13, MasteryRating=2.27 )

priest_90_di_mb : 94721 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
94721.1 94721.1 13.29 / 0.01% 3518 / 3.7% 13.3 6613.9 6492.1 Mana 0.00% 42.8 100.0%
  • dark_binding
  • fade
  • inner_sanctum
  • shadow_ravens
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.65 2.25 2.92 2.25 1.52 1.44 1.47
Normalized 1.00 0.62 0.80 0.62 0.42 0.39 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery > Haste

Charts,s,333333&chd=t:308359|150723|120795|103302|102767|86857|85459|71434|69315|46268|40246&chds=0,616718&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308359++devouring_plague,9482C9,0,0,15|t++150723++vampiric_touch,9482C9,1,0,15|t++120795++halo_damage,9482C9,2,0,15|t++103302++shadow_word_death,9482C9,3,0,15|t++102767++mind_flay_mastery,9482C9,4,0,15|t++86857++mind_blast,9482C9,5,0,15|t++85459++devouring_plague_mastery,9482C9,6,0,15|t++71434++vampiric_touch_mastery,9482C9,7,0,15|t++69315++shadow_word_pain_mastery,9482C9,8,0,15|t++46268++shadow_word_pain,9482C9,9,0,15|t++40246++mind_flay,9482C9,10,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:17,15,13,10,10,7,7,5,5,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|mind_blast|vampiric_touch|devouring_plague_tick|mindbender: melee|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadow_word_death|halo_damage|mind_flay_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.65,2.92,2.25,2.25,1.52,1.47,1.44|3.63,2.90,2.23,2.23,1.50,1.45,1.42|3.67,2.94,2.27,2.27,1.54,1.49,1.46&chds=0,7.30&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.65++Int,8A8A8A,0,0,15,0.1|t++++2.92++SP,8A8A8A,0,1,15,0.1|t++++2.25++Spi,8A8A8A,0,2,15,0.1|t++++2.25++Hit,8A8A8A,0,3,15,0.1|t++++1.52++Crit,8A8A8A,0,4,15,0.1|t++++1.47++Mastery,8A8A8A,0,5,15,0.1|t++++1.44++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:75543566776453243zyxvuusrrpnmkiihhhhgghhggfffggfffeeeeeeedddcccddeefffggggfggghhhhhgfgffeeccbbabbbbbaaZZZaaaabaaababbbccdefffhijkkkllmlmmmnnmlkjiihggfedccbbbbbbabbcbccccccccccdeefffggffhhiijijjjjjjjiihhhhggggffeddccccccccccbaaababaaaaaabbbbbbcdegghiiijjkkllmmmmmmlkjiihhgffedddcccbbbbbcccccccccbcccdddddddddeeffffgghhhiiiihhhijiiihhggffffffeeeeeeeeeedddddeefggghhiiklmnoopqqrsssttssssrrqqpponmlkkjjjihhhgghhhhhhhhhhhiiiiijjjjkkkllllmmmnooooppppopppppoooonnnnmmmmllllllllkkkkjkkkkklllllmnnoopqrrstuvwwxxxxxyyyyxxwwvttssrqppoonnnnnmmmmmmnnoopppqqprrrrrrrrrrsrrrrrrqqqqppooooonnnnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=578|1:|0|avg=94721|max=166362&chxp=1,1,57,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,2,4,5,13,18,47,89,128,218,373,568,855,1293,1832,2517,3226,4274,4994,5933,6741,7187,7456,7480,7151,6673,6113,5379,4553,3794,2879,2273,1769,1288,918,699,440,296,203,118,93,46,28,16,12,1,3,1&chds=0,7480&chbh=5&chxt=x&chxl=0:|min=84606|avg=94721|max=104500&chxp=0,1,51,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:32.3,32.2,12.8,6.0,5.0,3.8,2.9,1.9,0.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 145.7s|shadow_word_pain 145.6s|mind_blast 57.7s|vampiric_touch 26.9s|devouring_plague 22.4s|shadow_word_death 17.0s|halo_damage 13.3s|mindbender 8.8s|waiting 0.0s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_mb 94721
berserking 0 0.0% 3.0 180.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 15337 16.2% 18.9 24.97sec 366197 308359 127150 262452 154426 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 1.1876 0.0000 2917219.19 2917219.19 0.00 308358.86 308358.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.07 79.79% 127149.53 120670 157491 127185.93 120670 135745 1916401 1916401 0.00
crit 3.81 20.19% 262451.74 248580 324432 258245.85 0 324432 1000818 1000818 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2563 2.7% 45.2 9.98sec 25593 85459 21117 43627 25593 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 45.17 45.17 0.00 0.00 0.2995 0.0000 1156009.87 1156009.87 0.00 85459.44 85459.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 36.16 80.06% 21116.67 20014 26121 21123.69 20097 22893 763628 763628 0.00
crit 8.99 19.91% 43626.64 41228 53810 43632.51 0 53810 392382 392382 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 8870 9.4% 18.9 24.97sec 211771 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.0 21097 43551 25644 20.2% 0.0% 26.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 156.00 156.00 0.0000 0.7544 4000503.52 4000503.52 0.00 33991.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 124.4 79.75% 21097.44 20021 55801 21101.59 20319 24254 2624818 2624818 0.00
crit 31.6 20.25% 43550.82 41243 114951 43561.75 41243 52110 1375685 1375685 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3557 3.8% 11.3 41.35sec 141860 120795 118250 244547 142495 19.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.31 11.26 0.00 0.00 1.1744 0.0000 1604883.24 1604883.24 0.00 120795.07 120795.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.09 80.75% 118250.40 112598 140757 118292.69 112598 129088 1075445 1075445 0.00
crit 2.16 19.22% 244546.58 231952 289959 221387.19 0 289959 529438 529438 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11096 11.7% 47.6 9.52sec 105200 86857 86770 179130 105200 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 47.60 47.60 0.00 0.00 1.2112 0.0000 5007467.29 5007467.29 0.00 86856.78 86856.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 38.08 79.99% 86770.46 82915 108661 86791.54 83740 90313 3303792 3303792 0.00
crit 9.51 19.98% 179129.83 170805 223841 179163.95 0 223841 1703675 1703675 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 13006 13.7% 96.2 4.62sec 60966 40246 0 0 0 0.0% 0.0% 0.0% 0.0% 165.2 29222 60396 35493 20.1% 0.0% 26.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 96.20 96.20 165.25 165.25 1.5148 0.7349 5865080.78 5865080.78 0.00 40245.94 40245.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 96.18 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 132.0 79.88% 29221.76 27880 36400 29228.38 28558 29987 3857353 3857353 0.00
crit 33.2 20.12% 60396.47 57433 74983 60413.22 57632 65036 2007728 2007728 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3268 3.4% 47.9 9.12sec 30774 102767 25386 52476 30774 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 47.89 47.89 0.00 0.00 0.2995 0.0000 1473685.39 1473685.39 0.00 102767.46 102767.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 38.34 80.06% 25386.07 24241 31649 25392.24 24361 26958 973226 973226 0.00
crit 9.54 19.92% 52476.15 49937 65196 52486.71 0 65196 500459 500459 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.7 61.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 7.74 7.74 0.00 0.00 1.1324 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 7.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3885 4.1% 14.2 5.17sec 123535 103302 101589 210069 123535 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 14.21 14.21 0.00 0.00 1.1959 0.0000 1755410.97 1755410.97 0.00 103302.01 103302.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.33 79.72% 101588.55 94128 123585 101708.29 94128 110806 1150761 1150761 0.00
crit 2.88 20.26% 210069.13 193905 254586 200803.66 0 254586 604650 604650 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 14926 15.8% 123.6 3.62sec 54501 46268 0 0 0 0.0% 0.0% 0.0% 0.0% 324.0 15777 32557 20797 29.9% 0.0% 99.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 123.63 123.63 323.98 323.98 1.1780 1.3836 6737846.00 6737846.00 0.00 11345.49 46267.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 123.60 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 227.0 70.08% 15776.78 15106 19713 15779.67 15524 16064 3581944 3581944 0.00
crit 96.9 29.92% 32556.51 31119 40608 32562.78 31724 33606 3155902 3155902 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4314 4.6% 93.9 4.74sec 20741 69315 15748 32496 20741 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 93.89 93.89 0.00 0.00 0.2992 0.0000 1947332.06 1947332.06 0.00 69314.87 69314.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 65.85 70.14% 15747.52 15106 19713 15750.49 15332 16397 1036969 1036969 0.00
crit 28.01 29.84% 32496.10 31119 40608 32503.22 31119 35291 910363 910363 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowy_apparition 4671 4.9% 99.1 4.51sec 21281 0 18022 36127 21622 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 99.11 97.54 0.00 0.00 0.0000 0.0000 2109144.42 2109144.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 78.10 80.06% 18022.32 17249 22664 18025.52 17568 18551 1407478 1407478 0.00
crit 19.42 19.91% 36127.10 34498 45328 36134.23 34498 40253 701666 701666 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8983 9.5% 22.6 20.25sec 179659 150723 0 0 0 0.0% 0.0% 0.0% 0.0% 185.9 17972 37066 21809 20.1% 0.0% 92.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.57 22.57 185.95 185.95 1.1920 2.2338 4055361.26 4055361.26 0.00 9169.44 150723.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.57 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 148.6 79.90% 17971.96 16883 22312 17977.39 17263 18447 2670220 2670220 0.00
crit 37.4 20.10% 37065.53 34779 45963 37077.23 35048 39928 1385141 1385141 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2553 2.7% 53.9 8.19sec 21392 71434 17659 36473 21392 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 53.88 53.88 0.00 0.00 0.2995 0.0000 1152592.55 1152592.55 0.00 71434.31 71434.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 43.16 80.11% 17659.43 16883 22312 17663.57 17020 18598 762215 762215 0.00
crit 10.70 19.86% 36473.38 34779 45963 36480.30 0 45963 390378 390378 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - mindbender 25920 / 6560
melee 25920 6.9% 111.9 3.84sec 26421 26559 22692 45391 26421 22.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 111.93 111.93 0.00 0.00 0.9948 0.0000 2957232.43 2957232.43 0.00 26558.71 26558.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 59.92 53.53% 22692.40 18891 28643 22698.83 21431 24164 1359756 1359756 0.00
crit 25.13 22.45% 45390.70 37781 57286 45405.76 41404 49975 1140461 1140461 0.00
glance 26.85 23.99% 17018.91 14168 21482 17023.80 15585 18749 457015 457015 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:262.33
  • base_dd_max:262.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 22.9 19.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.91 22.91 0.00 0.00 1.1426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 22.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.9 56.7 3.0 3.0 122088.7
halo_damage Mana 11.3 509091.3 45000.0 45000.0 3.2
mind_blast Mana 47.6 243560.2 5116.9 5116.9 20.6
mind_flay Mana 96.2 288607.9 3000.0 3000.0 20.3
shadow_word_death Mana 14.2 110836.5 7800.0 7800.0 15.8
shadow_word_pain Mana 123.6 1631891.8 13200.0 13200.0 4.1
vampiric_touch Mana 22.6 203153.2 9000.0 9000.0 20.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1806.09 496880.32 275.11 44947.85 8.30%
dispersion Mana 0.00 0.90 18000.00 0.00 0.00%
mindbender Mana 111.90 1005752.22 8987.95 337048.02 25.10%
Shadow Orbs from Mind Blast Shadow Orb 47.59 47.59 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.18 7.18 1.00 0.00 0.00%
Devouring Plague Health Health 201.17 0.00 0.00 2766621.80 100.00%
Vampiric Touch Mana Mana 239.83 1429516.52 5960.63 171080.35 10.69%
Resource RPS-Gain RPS-Loss
Mana 6492.11 6613.86
Shadow Orb 0.12 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 7% 8%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 19.7 1.2 21.7sec 20.4sec 7% 39%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:7.5%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.1sec 123.1sec 18% 18%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:18.1%
jade_magistrate_figurine 7.8 0.0 60.8sec 60.8sec 25% 25%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.3%
jade_serpent_potion 2.0 0.0 422.6sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.0%
jade_spirit 8.8 0.0 54.2sec 54.2sec 23% 23%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.0%
raid_movement 44.6 0.0 10.0sec 10.0sec 39% 39%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 7.2 0.0 10.8sec 10.8sec 9% 49%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.2%
synapse_springs_2 8.0 0.0 60.7sec 60.7sec 17% 17%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
mindbender-shadowcrawl 22.9 0.0 19.4sec 19.4sec 85% 84%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.6%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%


Count Interval
Shadowy Recall Extra Tick 240.8 1.9sec
Shadowy Apparition Procced 99.1 4.5sec
Divine Insight Mind Blast CD Reset 20.9 20.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.65
Minimum 334.81
Maximum 578.76
Spread ( max - min ) 243.95
Range [ ( max - min ) / 2 * 100% ] 27.01%


Sample Data
Count 100000
Mean 94721.06
Minimum 84605.53
Maximum 104499.55
Spread ( max - min ) 19894.02
Range [ ( max - min ) / 2 * 100% ] 10.50%
Standard Deviation 2143.6305
5th Percentile 91288.57
95th Percentile 98323.66
( 95th Percentile - 5th Percentile ) 7035.09
Mean Distribution
Standard Deviation 6.7788
95.00% Confidence Intervall ( 94707.77 - 94734.35 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1967
0.1 Scale Factor Error with Delta=300 39226
0.05 Scale Factor Error with Delta=300 156907
0.01 Scale Factor Error with Delta=300 3922685
Distribution Chart


Sample Data
Count 100000
Mean 94721.06


Sample Data
Count 100000
Mean 39782536.54


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 321.92
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I mindbender,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=3.65, Spirit=2.25, SpellDamage=2.92, HitRating=2.25, CritRating=1.52, HasteRating=1.44, MasteryRating=1.47 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=3.65, Spirit=2.25, SpellDamage=2.92, HitRating=0.00, CritRating=1.52, HasteRating=1.44, MasteryRating=1.47 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=3.65, Spirit=2.25, SpellDamage=2.92, HitRating=2.25, CritRating=1.52, HasteRating=1.44, MasteryRating=1.47 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=3.65, Spirit=2.25, SpellDamage=2.92, HitRating=0.00, CritRating=1.52, HasteRating=1.44, MasteryRating=1.47 )

priest_90_di_swi : 85905 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
85905.0 85905.0 26.86 / 0.03% 7114 / 8.3% 14.2 5851.7 5282.9 Mana 4.25% 39.4 100.0%
  • dark_binding
  • fade
  • inner_sanctum
  • shadow_ravens
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.31 2.24 2.64 2.24 1.37 0.83 2.17
Normalized 1.00 0.68 0.80 0.68 0.41 0.25 0.65
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.04 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:308792|149091|122995|103510|102944|96204|86724|85455|71442|69329|48966|40381&chds=0,617583&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308792++devouring_plague,9482C9,0,0,15|t++149091++vampiric_touch,9482C9,1,0,15|t++122995++halo_damage,9482C9,2,0,15|t++103510++shadow_word_death,9482C9,3,0,15|t++102944++mind_flay_mastery,9482C9,4,0,15|t++96204++shadow_word_insanity,9482C9,5,0,15|t++86724++mind_blast,9482C9,6,0,15|t++85455++devouring_plague_mastery,9482C9,7,0,15|t++71442++vampiric_touch_mastery,9482C9,8,0,15|t++69329++shadow_word_pain_mastery,9482C9,9,0,15|t++48966++shadow_word_pain,9482C9,10,0,15|t++40381++mind_flay,9482C9,11,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:17,17,12,10,10,7,5,5,4,4,3,3,3,3,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|mind_blast|devouring_plague_tick|vampiric_touch|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|mind_flay_mastery|shadow_word_death|halo_damage|shadowfiend: melee|devouring_plague_mastery|vampiric_touch_mastery|shadow_word_insanity&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.31,2.64,2.24,2.24,2.17,1.37,0.83|3.27,2.60,2.20,2.20,2.13,1.33,0.79|3.35,2.67,2.28,2.28,2.20,1.40,0.87&chds=0,6.62&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.31++Int,8A8A8A,0,0,15,0.1|t++++2.64++SP,8A8A8A,0,1,15,0.1|t++++2.24++Spi,8A8A8A,0,2,15,0.1|t++++2.24++Hit,8A8A8A,0,3,15,0.1|t++++2.17++Mastery,8A8A8A,0,4,15,0.1|t++++1.37++Crit,8A8A8A,0,5,15,0.1|t++++0.83++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:86654566665342122yxwttsqppnmlkiihhhhgghhggfffggfffeeeeeeeeedccbcbccccccbbbbbcbccccdccdddccbbbbbbbbbbaaZZZaaaabaaaaabbbcccddedffffgfffffgggggfeddcdcccbaaaaZaZZaZZZZZZaaaaaZZZZZaabbccdeeegghhiiiiihihhhhgffeddddccbbbbabbbbbbbbaaabbbbaaaaaaabbbbbbbbccccdcccccddddddcccccccccbbbaaaaaaaZZZZYZZZZZYYYYYYYZZZYZZZZZZaaaZZaaZaaaaaZaZZZaaaaaZZZZZaaaaaZZZZZaZaaaZZZZZaabbccdefghijkllmnoopppqqqqponnnmmlkkjjiiiihhggggggggggfffffggggggggggghhhhhhhhghhhhhhhhhghhhggggggggggggfggfffggffffffffggggggggghhhiiiiiiijjjjkjjjjjjjjjjjjiiiiihhhgggffffeeeddddddddeeefghhjjkkllmoooppqqqqqqpoonmmmllkjjkji&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=578|1:|0|avg=85905|max=166249&chxp=1,1,52,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,3,5,6,9,12,25,37,65,85,103,139,161,269,343,457,609,818,1079,1336,1610,1829,2228,2714,3025,3690,4328,5178,6085,6710,7463,8124,7986,7561,7030,5749,4598,3203,2187,1459,817,461,232,99,42,15,8,5,0,1&chds=0,8124&chbh=5&chxt=x&chxl=0:|min=62702|avg=85905|max=101143&chxp=0,1,60,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:34.2,28.4,11.9,5.4,4.6,3.3,2.3,1.6,0.7,0.2,4.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,9482C9,ffffff&chl=mind_flay 154.4s|shadow_word_pain 128.1s|mind_blast 53.5s|vampiric_touch 24.5s|devouring_plague 20.8s|shadow_word_death 14.8s|halo_damage 10.2s|dispersion 7.2s|shadowfiend 3.1s|shadow_word_insanity 0.7s|waiting 19.2s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_swi 85905
berserking 0 0.0% 3.0 180.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 14256 16.6% 17.5 27.00sec 366522 308792 127156 262484 154393 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 17.52 17.52 0.00 0.00 1.1870 0.0000 2704909.71 2704909.71 0.00 308791.62 308791.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 13.99 79.83% 127155.57 120670 157491 127192.75 120670 139532 1778304 1778304 0.00
crit 3.53 20.15% 262484.20 248580 324432 256891.85 0 324432 926606 926606 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2387 2.8% 42.0 10.67sec 25595 85455 21114 43627 25595 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 42.01 42.01 0.00 0.00 0.2995 0.0000 1075110.24 1075110.24 0.00 85455.07 85455.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.63 80.05% 21113.82 20014 26121 21120.47 20014 22915 709972 709972 0.00
crit 8.37 19.93% 43626.68 41228 53810 43627.94 0 53810 365138 365138 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 8251 9.6% 17.5 27.00sec 212128 0 0 0 0 0.0% 0.0% 0.0% 0.0% 145.0 21098 43545 25636 20.2% 0.0% 24.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 17.52 17.52 144.97 144.97 0.0000 0.7534 3716412.08 3716412.08 0.00 34027.78 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 115.7 79.78% 21097.58 20021 56975 21101.97 20240 24851 2440229 2440229 0.00
crit 29.3 20.22% 43545.23 41243 117368 43555.32 41243 54026 1276183 1276183 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.6 172.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 8.9 0 0 0 0.0% 0.0% 1.5%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.63 1.63 8.92 8.92 4.4455 0.7616 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 1.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.9 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:47585
  • name:Dispersion
  • school:physical
  • tooltip:Reduces all damage by $s1%, and you regenerate $49766s1% mana every $60069t1 sec for $d. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by $47585s1%. You are unable to attack or cast spells, but you regenerate $49766s1% mana every $60069t1 sec for $d. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 2789 3.2% 8.8 52.41sec 143009 122995 118762 245625 143558 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.77 8.74 0.00 0.00 1.1627 0.0000 1254059.95 1254059.95 0.00 122995.29 122995.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.02 80.40% 118762.20 112598 140757 118812.91 112598 140757 834142 834142 0.00
crit 1.71 19.57% 245625.08 231952 289959 207550.37 0 289959 419918 419918 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 10300 12.0% 44.1 10.19sec 105264 86724 86776 179191 105264 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 44.10 44.10 0.00 0.00 1.2138 0.0000 4642510.94 4642510.94 0.00 86724.03 86724.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 35.26 79.95% 86775.69 82915 108661 86795.98 83974 90747 3059719 3059719 0.00
crit 8.83 20.03% 179191.00 170805 223841 179211.89 0 223841 1582792 1582792 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 13809 16.1% 99.9 4.45sec 62437 40381 0 0 0 0.0% 0.0% 0.0% 0.0% 175.4 29266 60473 35551 20.1% 0.0% 28.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 99.86 99.86 175.39 175.39 1.5462 0.7382 6235162.92 6235162.92 0.00 40380.83 40380.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 99.84 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 140.1 79.86% 29265.66 27880 36400 29273.20 28568 30030 4099018 4099018 0.00
crit 35.3 20.14% 60473.12 57433 74983 60491.57 57788 64756 2136145 2136145 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3471 4.0% 50.8 8.64sec 30834 102944 25425 52540 30834 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 50.83 50.83 0.00 0.00 0.2995 0.0000 1567420.91 1567420.91 0.00 102943.71 102943.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.67 80.01% 25425.18 24241 31649 25431.65 24367 27015 1034061 1034061 0.00
crit 10.15 19.97% 52539.69 49937 65196 52552.63 0 65196 533360 533360 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3398 4.0% 12.4 5.81sec 123620 103510 101625 210163 123620 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 12.38 12.38 0.00 0.00 1.1943 0.0000 1530398.07 1530398.07 0.00 103510.18 103510.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.87 79.69% 101624.56 94128 123585 101715.05 0 123585 1002538 1002538 0.00
crit 2.51 20.29% 210162.80 193905 254586 194376.30 0 254586 527860 527860 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_insanity 155 0.2% 0.6 115.94sec 115258 96204 95300 197008 115258 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 0.61 0.61 0.00 0.00 1.1981 0.0000 70421.35 70421.35 0.00 96204.03 96204.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 0.49 80.31% 95299.83 89698 117855 38624.57 0 117855 46765 46765 0.00
crit 0.12 19.65% 197008.39 184778 242782 22579.54 0 242782 23657 23657 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:1990.94
  • base_dd_max:2101.44
shadow_word_pain 13919 16.2% 109.0 4.07sec 57550 48966 0 0 0 0.0% 0.0% 0.0% 0.0% 301.7 15774 32550 20794 29.9% 0.0% 95.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 109.02 109.02 301.74 301.74 1.1753 1.4280 6274204.53 6274204.53 0.00 11223.68 48965.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 109.00 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 211.4 70.08% 15773.73 15106 19713 15776.88 15457 16181 3335343 3335343 0.00
crit 90.3 29.92% 32550.01 31119 40608 32557.13 31667 33906 2938862 2938862 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 4023 4.7% 87.4 5.06sec 20749 69329 15749 32496 20749 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 87.41 87.41 0.00 0.00 0.2993 0.0000 1813581.99 1813581.99 0.00 69329.18 69329.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 61.27 70.10% 15748.76 15106 19713 15751.62 15214 16466 964955 964955 0.00
crit 26.11 29.88% 32496.24 31119 40608 32503.20 31119 35608 848627 848627 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowfiend 0 0.0% 3.0 181.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 1.0408 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 4414 5.1% 93.4 4.75sec 21316 0 18026 36135 21630 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 93.39 92.03 0.00 0.00 0.0000 0.0000 1990649.66 1990649.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 73.67 80.05% 18026.20 17249 22664 18029.47 17543 18590 1327991 1327991 0.00
crit 18.34 19.93% 36135.14 34498 45328 36143.59 34498 39913 662658 662658 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8097 9.4% 20.4 22.05sec 178807 149091 0 0 0 0.0% 0.0% 0.0% 0.0% 168.4 17869 36870 21661 20.0% 0.0% 83.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.41 20.41 168.44 168.44 1.1993 2.2369 3648699.47 3648699.47 0.00 9093.06 149090.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 20.40 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 134.8 80.04% 17868.87 16883 22312 17875.00 17129 18642 2409101 2409101 0.00
crit 33.6 19.96% 36870.07 34779 45963 36882.77 34862 39929 1239599 1239599 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2317 2.7% 48.8 8.85sec 21391 71442 17649 36454 21391 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 48.82 48.82 0.00 0.00 0.2994 0.0000 1044267.80 1044267.80 0.00 71442.01 71442.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 39.08 80.05% 17649.32 16883 22312 17653.80 16938 18766 689744 689744 0.00
crit 9.73 19.92% 36453.81 34779 45963 36460.35 0 45963 354524 354524 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - shadowfiend 32926 / 2570
melee 32926 3.0% 39.5 9.56sec 29088 33939 25051 50149 29088 22.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.48 39.48 0.00 0.00 0.8571 0.0000 1148431.87 1148431.87 0.00 33939.12 33939.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 21.28 53.90% 25050.73 19717 29593 25062.86 22705 27932 533091 533091 0.00
crit 8.72 22.09% 50149.22 39434 59187 50164.53 0 59187 437336 437336 0.00
glance 9.47 23.99% 18795.80 14788 22195 18803.99 0 22195 178005 178005 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.88 5.88 0.00 0.00 1.0830 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 17.5 52.6 3.0 3.0 122193.5
halo_damage Mana 8.8 394610.0 45000.0 45000.0 3.2
mind_blast Mana 44.1 224803.1 5097.2 5097.2 20.7
mind_flay Mana 99.9 299588.8 3000.0 3000.0 20.8
shadow_word_death Mana 12.4 96562.8 7800.0 7800.0 15.8
shadow_word_insanity Mana 0.6 4582.4 7500.0 7500.0 15.4
shadow_word_pain Mana 109.0 1439098.8 13200.0 13200.0 4.4
vampiric_touch Mana 20.4 183652.5 9000.0 9000.0 19.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1806.09 530846.54 293.92 10981.64 2.03%
dispersion Mana 8.92 160641.36 18000.00 0.00 0.00%
shadowfiend Mana 39.47 290021.69 7347.60 65222.71 18.36%
Shadow Orbs from Mind Blast Shadow Orb 44.09 44.09 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.56 6.56 1.00 0.00 0.00%
Devouring Plague Health Health 186.98 0.00 0.00 2571413.67 100.00%
Vampiric Touch Mana Mana 217.26 1404520.30 6464.73 45485.71 3.14%
Resource RPS-Gain RPS-Loss
Mana 5282.94 5851.67
Shadow Orb 0.11 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 11%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 13%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 18.4 1.0 22.9sec 21.6sec 7% 39%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:7.0%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.3sec 123.3sec 18% 18%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:18.0%
jade_magistrate_figurine 7.7 0.0 60.8sec 60.8sec 25% 25%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.3%
jade_serpent_potion 2.0 0.0 422.6sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.0%
jade_spirit 8.7 0.0 54.6sec 54.6sec 23% 23%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
raid_movement 44.6 0.0 10.0sec 10.0sec 39% 39%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:39.4%
shadow_word_death_reset_cooldown 6.6 0.0 11.6sec 11.6sec 8% 47%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.4%
synapse_springs_2 8.0 0.0 60.6sec 60.7sec 17% 17%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
shadowfiend-shadowcrawl 5.9 0.0 74.6sec 74.6sec 83% 79%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 2.1%
shadowfiend-Mana Cap 2.1%
lightwell-Mana Cap 2.1%


Count Interval
Shadowy Recall Extra Tick 229.1 2.0sec
Shadowy Apparition Procced 93.4 4.8sec
Divine Insight Mind Blast CD Reset 19.5 21.6sec
Shadow Word: Insanity removed DoTs 0.6 106.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 451.65
Minimum 334.81
Maximum 578.76
Spread ( max - min ) 243.95
Range [ ( max - min ) / 2 * 100% ] 27.01%


Sample Data
Count 100000
Mean 85905.01
Minimum 62701.94
Maximum 101142.97
Spread ( max - min ) 38441.03
Range [ ( max - min ) / 2 * 100% ] 22.37%
Standard Deviation 4333.1437
5th Percentile 77784.71
95th Percentile 92011.75
( 95th Percentile - 5th Percentile ) 14227.04
Mean Distribution
Standard Deviation 13.7026
95.00% Confidence Intervall ( 85878.16 - 85931.87 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 97
0.1% Error 9773
0.1 Scale Factor Error with Delta=300 160283
0.05 Scale Factor Error with Delta=300 641135
0.01 Scale Factor Error with Delta=300 16028387
Distribution Chart


Sample Data
Count 100000
Mean 85905.01


Sample Data
Count 100000
Mean 37567809.62


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 296.48
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D shadow_word_insanity,if=num_targets<=4
E mind_blast,if=num_targets<=4&cooldown_react
F shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|ticks_remain<1)&miss_react
G shadow_word_death,if=num_targets<=4
H vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
I halo_damage
J shadowfiend,if=cooldown_react
K mind_sear,chain=1,interrupt=1,if=num_targets>=2
L mind_flay,chain=1,interrupt=1
M shadow_word_death,moving=1
N mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
O shadow_word_pain,moving=1
P dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=3.31, Spirit=2.24, SpellDamage=2.64, HitRating=2.24, CritRating=1.37, HasteRating=0.83, MasteryRating=2.17 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=3.31, Spirit=2.24, SpellDamage=2.64, HitRating=0.00, CritRating=1.37, HasteRating=0.83, MasteryRating=2.17 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=3.31, Spirit=2.24, SpellDamage=2.64, HitRating=2.24, CritRating=1.37, HasteRating=0.83, MasteryRating=2.17 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=3.31, Spirit=2.24, SpellDamage=2.64, HitRating=0.00, CritRating=1.37, HasteRating=0.83, MasteryRating=2.17 )

priest_90_pi_fdcl : 85912 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
85912.5 85912.5 32.42 / 0.04% 8465 / 9.9% 14.7 5657.1 5094.8 Mana 6.20% 41.1 100.0%
  • mind_spike
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.31 2.34 2.67 2.34 1.42 1.56 2.28
Normalized 1.00 0.71 0.81 0.71 0.43 0.47 0.69
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.05 0.05 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Haste > Crit

Charts,s,333333&chd=t:309244|155310|124440|104652|103270|89045|85602|78344|71646|69433|52700|40923&chds=0,618487&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9&chm=t++309244++devouring_plague,9482C9,0,0,15|t++155310++vampiric_touch,9482C9,1,0,15|t++124440++halo_damage,9482C9,2,0,15|t++104652++shadow_word_death,9482C9,3,0,15|t++103270++mind_flay_mastery,9482C9,4,0,15|t++89045++mind_blast,9482C9,5,0,15|t++85602++devouring_plague_mastery,9482C9,6,0,15|t++78344++mind_spike,000066,7,0,15|t++71646++vampiric_touch_mastery,9482C9,8,0,15|t++69433++shadow_word_pain_mastery,9482C9,9,0,15|t++52700++shadow_word_pain,9482C9,10,0,15|t++40923++mind_flay,9482C9,11,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:16,15,11,9,9,7,6,5,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|mind_blast|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|shadowy_apparition|shadow_word_pain_mastery|shadow_word_death|mind_flay_mastery|halo_damage|shadowfiend: melee|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.31,2.67,2.34,2.34,2.28,1.56,1.42|3.26,2.62,2.29,2.29,2.23,1.51,1.38|3.36,2.71,2.39,2.39,2.33,1.60,1.47&chds=0,6.62&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.31++Int,8A8A8A,0,0,15,0.1|t++++2.67++SP,8A8A8A,0,1,15,0.1|t++++2.34++Spi,8A8A8A,0,2,15,0.1|t++++2.34++Hit,8A8A8A,0,3,15,0.1|t++++2.28++Mastery,8A8A8A,0,4,15,0.1|t++++1.56++Haste,8A8A8A,0,5,15,0.1|t++++1.42++Crit,8A8A8A,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:7665465554311zz10wvussrpoomlkjiihhhhffffdcbbbddcdddeeeeeeeedddcccdbbbaZYYXXYZZaabcddddddddcccccccaaaZYWWVWXXYZZaabacccdeeffgghhhhhgfffegfgffffedddcccbaaaaZZZYYXWWWVVWWWWXWWWXXYYZZabcdddfffggggggfgffffeeddcccccbbbaaabbaaaZZZZYZZYZZYYYYYZZaabbbcccdeeefeeeeeffeeeddccbcbbbaaZZZYZZYYYXXWWWXWWWWVVVVVWVWWWWWWWWXXXXXXXXXXXXXXXWWWWWWWWWXWWWWWXWWXWWWWWWWWWWWWVVWWXXXYYZabddfghjklmnopqqqrrrrqpoonnmlkjiihhhgggfffeefffffeeeeefffffffffefffffffffffffffeeeeeeeeeeeeeedeeeeeddddddddddddddcddeeeeefffghhiiijjjjkkkkkkkkkjkjjjihhhhgggfffeeeddddcccbbbbbcbbbccdeeegghhiijlllmnnnonnnmmmlkkkjjihhihg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=578|1:|0|avg=85912|max=173483&chxp=1,1,50,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,3,4,10,8,16,23,34,68,99,117,173,242,327,458,596,766,996,1197,1515,1816,2097,2579,3065,3370,3787,4120,4558,4897,5228,5420,5949,6240,6410,6273,6054,5600,4813,3809,2846,1893,1202,696,325,171,75,35,13,4&chds=0,6410&chbh=5&chxt=x&chxl=0:|min=60282|avg=85912|max=100844&chxp=0,1,63,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:30.4,25.4,10.2,8.0,5.0,4.2,3.1,2.1,1.8,0.7,6.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=mind_flay 137.2s|shadow_word_pain 114.8s|mind_blast 46.3s|mind_spike 35.9s|vampiric_touch 22.4s|devouring_plague 18.8s|shadow_word_death 13.9s|halo_damage 9.5s|dispersion 8.1s|shadowfiend 3.1s|waiting 28.0s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_pi_fdcl 85912
berserking 0 0.0% 3.0 180.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.03 3.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 12888 15.0% 15.8 30.00sec 366536 309244 126993 261945 154093 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 0.00 0.00 1.1853 0.0000 2441270.05 2441270.05 0.00 309243.56 309243.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 12.65 79.87% 126993.25 120670 157491 127034.20 120670 137629 1606970 1606970 0.00
crit 3.19 20.10% 261944.97 248580 324432 253663.87 0 324432 834300 834300 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2167 2.5% 38.1 11.78sec 25635 85602 21217 43867 25635 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 38.08 38.08 0.00 0.00 0.2995 0.0000 976290.18 976290.18 0.00 85601.94 85601.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 30.64 80.45% 21216.86 20014 26121 21225.54 20014 23316 650072 650072 0.00
crit 7.44 19.53% 43867.49 41228 53810 43853.23 0 53810 326218 326218 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 7469 8.7% 15.8 30.00sec 212443 0 0 0 0 0.0% 0.0% 0.0% 0.0% 131.6 21066 43439 25574 20.1% 0.0% 21.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.84 15.84 131.61 131.61 0.0000 0.7478 3365705.43 3365705.43 0.00 34198.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 105.1 79.85% 21065.71 20021 54170 21070.94 20224 24321 2213840 2213840 0.00
crit 26.5 20.15% 43439.33 41243 111591 43453.10 41243 59001 1151865 1151865 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.8 171.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 10.3 0 0 0 0.0% 0.0% 1.7%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 1.82 1.82 10.31 10.31 4.4196 0.7331 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 1.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.3 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:47585
  • name:Dispersion
  • school:physical
  • tooltip:Reduces all damage by $s1%, and you regenerate $49766s1% mana every $60069t1 sec for $d. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by $47585s1%. You are unable to attack or cast spells, but you regenerate $49766s1% mana every $60069t1 sec for $d. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 2621 3.0% 8.2 56.22sec 143125 124440 118819 245806 143693 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 8.23 8.20 0.00 0.00 1.1501 0.0000 1178449.54 1178449.54 0.00 124440.29 124440.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 6.59 80.37% 118818.95 112598 140757 118854.13 0 140757 783134 783134 0.00
crit 1.61 19.61% 245806.01 231952 289959 202956.42 0 289959 395315 395315 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9145 10.6% 39.2 11.45sec 105201 89045 86708 178949 105201 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.18 39.18 0.00 0.00 1.1814 0.0000 4122144.41 4122144.41 0.00 89044.66 89044.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 31.31 79.91% 86708.31 82915 108661 86730.92 83379 90632 2714963 2714963 0.00
crit 7.86 20.07% 178948.77 170805 223841 178931.19 0 223841 1407182 1407182 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 12424 14.5% 91.2 4.88sec 61565 40923 0 0 0 0.0% 0.0% 0.0% 0.0% 157.5 29326 60590 35633 20.2% 0.0% 25.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 91.18 91.18 157.54 157.54 1.5044 0.7170 5613719.23 5613719.23 0.00 40922.88 40922.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 91.16 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 125.8 79.82% 29325.75 27880 36400 29337.40 28599 30693 3687882 3687882 0.00
crit 31.8 20.18% 60589.60 57433 74983 60617.94 57674 66098 1925838 1925838 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3125 3.6% 45.7 9.59sec 30928 103270 25475 52648 30928 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 45.65 45.65 0.00 0.00 0.2995 0.0000 1411912.69 1411912.69 0.00 103270.38 103270.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 36.47 79.89% 25475.11 24241 31649 25484.80 24316 27860 929099 929099 0.00
crit 9.17 20.09% 52647.96 49937 65196 52653.83 0 65196 482814 482814 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6255 7.3% 30.8 13.83sec 91404 78344 75297 155549 91404 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.81 30.81 0.00 0.00 1.1667 0.0000 2816319.91 2816319.91 0.00 78344.27 78344.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 24.61 79.88% 75296.99 71937 94532 75321.43 71937 85712 1853314 1853314 0.00
crit 6.19 20.09% 155548.66 148190 194736 155086.69 0 194736 963006 963006 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3220 3.8% 11.7 6.12sec 123697 104652 101710 210355 123697 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.74 11.74 0.00 0.00 1.1820 0.0000 1452680.08 1452680.08 0.00 104652.41 104652.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.36 79.72% 101709.57 94128 123585 101837.93 0 118545 952210 952210 0.00
crit 2.38 20.26% 210354.88 193905 254586 192481.17 0 254586 500470 500470 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 13423 15.6% 98.5 4.49sec 61416 52700 0 0 0 0.0% 0.0% 0.0% 0.0% 290.3 15793 32589 20830 30.0% 0.0% 92.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 98.47 98.47 290.35 290.35 1.1654 1.4335 6047933.66 6047933.66 0.00 11390.11 52699.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount