
SimulationCraft 504-2

for World of Warcraft 5.0.4 Live (build level 15913)

Beta Release

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.69 2.31 2.97 - - - 2.31 - 1.54 1.50 1.49 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.73 2.27 2.99 - - - 2.27 - 1.55 1.45 1.51 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.58 2.22 2.87 - - - 2.22 - 1.51 1.43 1.44 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.67 2.24 2.95 - - - 2.24 - 1.55 1.44 1.45 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.72 2.20 2.99 - - - 2.20 - 1.56 1.31 1.49 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.55 2.25 2.86 - - - 2.25 - 1.48 1.79 1.42 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.69 2.28 2.97 - - - 2.28 - 1.55 1.48 1.47 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.74 2.25 3.01 - - - 2.25 - 1.57 1.83 1.49 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.59 2.23 2.89 - - - 2.23 - 1.51 1.74 1.47 - - - - - - wowhead lootrank

priest_90_di_fdcl : 96320 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
96320.0 96320.0 13.41 / 0.01% 3552 / 3.7% 19.3 4854.5 4612.9 Mana 0.59% 38.3 100.0%
  • mind_spike
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.69 2.31 2.97 2.31 1.54 1.50 1.49
Normalized 1.00 0.63 0.80 0.63 0.42 0.41 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Haste = Mastery

Charts,s,333333&chd=t:290977|141609|120536|103721|102983|86396|85826|84312|76997|71213|69269|43178&chds=0,581955&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9&chm=t++290977++devouring_plague,9482C9,0,0,15|t++141609++vampiric_touch,9482C9,1,0,15|t++120536++halo_damage,9482C9,2,0,15|t++103721++shadow_word_death,9482C9,3,0,15|t++102983++mind_flay_mastery,9482C9,4,0,15|t++86396++mind_blast,9482C9,5,0,15|t++85826++shadow_word_pain,9482C9,6,0,15|t++84312++devouring_plague_mastery,9482C9,7,0,15|t++76997++mind_spike,000066,8,0,15|t++71213++vampiric_touch_mastery,9482C9,9,0,15|t++69269++shadow_word_pain_mastery,9482C9,10,0,15|t++43178++mind_flay,9482C9,11,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:19,12,12,9,9,7,7,5,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowfiend: melee|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.69,2.97,2.31,2.31,1.54,1.50,1.49|3.67,2.95,2.29,2.29,1.52,1.48,1.47|3.71,2.99,2.33,2.33,1.56,1.52,1.51&chds=0,7.38&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.69++Int,8A8A8A,0,0,15,0.1|t++++2.97++SP,8A8A8A,0,1,15,0.1|t++++2.31++Spi,8A8A8A,0,2,15,0.1|t++++2.31++Hit,8A8A8A,0,3,15,0.1|t++++1.54++Crit,8A8A8A,0,4,15,0.1|t++++1.50++Haste,8A8A8A,0,5,15,0.1|t++++1.49++Mastery,8A8A8A,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:xz022111111034578442zyvurqqqppoonmlkjkkkkkklllllkkjhhhgfffeeeeeeeddddddfgggghhhhhhggfeffffffeeedddddddddeeffffdcaZZYZZYZZaabbbbcccdegijkkkklkkjihghggggfffeedddddeeffghgggfeeeeegghijkmmmlllmmmnooooonnmkjiggfgggggffffeeeeeeffffggfffecaaZYZZYYZZZZZZabbbcdfhijkjklkkjjihhhhhhhggffeeefefffggggggfeeeeddeeeeeeffeeeeeefghhhhihihhggfffffgggggggggggghhiiijjjihfdccbddeefghijjkklmmoqstuuuuuttsrpopoooonnnmlllllkkkkkllllljiiiiijjjjjjkkkkkkkllmnnnnooooooonmmmmmmmmmmmmmmmmmmmnnnoooomkihhghihhgggggfghhiikmopqrqrsttuuutuutttuuuutttsssrrrrrsrrrpnnmmmnnnnnnmmmmmmmmmoqppq&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=96320|max=166316&chxp=1,1,58,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:6,6,12,25,53,94,143,292,399,689,946,1397,1909,2581,3213,3926,4587,5379,5998,6267,6671,6721,6683,6383,5841,5443,4800,4145,3361,2866,2362,1855,1351,1129,749,538,397,279,204,105,74,54,29,15,10,7,3,2,0,1&chds=0,6721&chbh=5&chxt=x&chxl=0:|min=88293|avg=96320|max=106566&chxp=0,1,44,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:42.3,12.9,12.9,8.9,6.1,5.0,3.4,2.9,0.7,0.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 191.1s|mind_blast 58.5s|shadow_word_pain 58.3s|mind_spike 40.0s|vampiric_touch 27.4s|devouring_plague 22.5s|shadow_word_death 15.5s|halo_damage 13.0s|shadowfiend 3.1s|dispersion 0.0s|waiting 2.7s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_fdcl 96320
berserking 0 0.0% 3.0 180.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 14485 15.0% 18.9 24.79sec 346662 290977 127263 262683 154405 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 0.00 0.00 1.1914 0.0000 2916444.14 2916444.14 0.00 290977.45 290977.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.09 79.91% 127262.53 120670 157491 127304.93 120670 135554 1920800 1920800 0.00
crit 3.79 20.07% 262682.81 248580 324432 258382.34 0 324432 995644 995644 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2313 2.4% 41.4 10.29sec 25248 84312 20852 43032 25248 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 41.44 41.44 0.00 0.00 0.2995 0.0000 1046221.83 1046221.83 0.00 84311.53 84311.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.20 80.13% 20852.19 20014 26121 20854.32 20014 22490 692366 692366 0.00
crit 8.22 19.84% 43031.56 41228 53810 43022.21 0 51394 353856 353856 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 8030 8.3% 18.9 24.79sec 192258 0 0 0 0 0.0% 0.0% 0.0% 0.0% 143.1 20907 43127 25383 20.1% 0.0% 23.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 143.06 143.06 0.0000 0.7527 3631421.50 3631421.50 0.00 33723.26 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 114.2 79.85% 20907.05 20021 53517 20908.46 20021 23888 2388467 2388467 0.00
crit 28.8 20.15% 43126.73 41243 110244 43131.48 41243 51707 1242954 1242954 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3480 3.6% 11.1 42.18sec 141878 120536 117907 243766 142415 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.08 11.04 0.00 0.00 1.1771 0.0000 1572518.04 1572518.04 0.00 120536.41 120536.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.89 80.48% 117906.93 112598 140757 117931.72 0 133174 1047756 1047756 0.00
crit 2.15 19.50% 243765.69 231952 289959 220395.61 0 289959 524762 524762 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11186 11.6% 48.1 9.37sec 105157 86396 86787 179148 105157 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 48.09 48.09 0.00 0.00 1.2172 0.0000 5056855.18 5056855.18 0.00 86396.19 86396.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 38.50 80.06% 86787.33 82915 108661 86808.79 84291 89730 3341276 3341276 0.00
crit 9.58 19.91% 179147.89 170805 223841 179186.45 0 223841 1715579 1715579 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 18264 19.0% 114.5 3.87sec 72046 43178 0 0 0 0.0% 0.0% 0.0% 0.0% 231.3 29342 60646 35670 20.2% 0.0% 37.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 114.52 114.52 231.30 231.30 1.6686 0.7327 8250628.75 8250628.75 0.00 43178.02 43178.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 114.49 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 184.5 79.78% 29341.80 27880 36400 29347.60 28669 30039 5414739 5414739 0.00
crit 46.8 20.22% 60646.13 57433 74983 60659.48 58216 64413 2835890 2835890 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4578 4.8% 67.1 6.54sec 30843 102983 25395 52475 30843 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 67.06 67.06 0.00 0.00 0.2995 0.0000 2068211.38 2068211.38 0.00 102983.19 102983.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 53.53 79.83% 25394.80 24241 31649 25398.90 24546 26667 1359428 1359428 0.00
crit 13.51 20.14% 52474.77 49937 65196 52484.76 49937 59346 708783 708783 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6823 7.1% 34.0 12.77sec 90706 76997 74763 154476 90706 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 33.98 33.98 0.00 0.00 1.1780 0.0000 3082258.57 3082258.57 0.00 76996.79 76996.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 27.17 79.95% 74763.22 71937 94532 74774.44 71937 79784 2031196 2031196 0.00
crit 6.80 20.02% 154475.75 148190 194736 154288.17 0 194736 1051062 1051062 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3553 3.7% 13.0 5.64sec 123797 103721 101646 210177 123797 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.1936 0.0000 1607257.56 1607257.56 0.00 103720.80 103720.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.33 79.53% 101646.31 94128 123585 101741.86 94128 113029 1049554 1049554 0.00
crit 2.65 20.44% 210176.57 193905 254586 198736.82 0 254586 557704 557704 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 11079 11.5% 49.6 9.06sec 101008 85826 0 0 0 0.0% 0.0% 0.0% 0.0% 240.3 15873 32769 20841 29.4% 0.0% 94.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 49.57 49.57 240.26 240.26 1.1769 1.7844 5007372.77 5007372.77 0.00 10280.67 85826.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 49.56 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 169.6 70.59% 15872.61 15106 19713 15880.14 15449 16354 2692072 2692072 0.00
crit 70.7 29.41% 32768.75 31119 40608 32784.64 31495 34531 2315301 2315301 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3194 3.3% 69.6 6.38sec 20740 69269 15752 32510 20740 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 69.62 69.62 0.00 0.00 0.2994 0.0000 1443905.78 1443905.78 0.00 69268.69 69268.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 48.86 70.18% 15751.80 15106 19713 15755.24 15246 16493 769621 769621 0.00
crit 20.74 29.79% 32510.33 31119 40608 32517.71 31119 36111 674285 674285 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowfiend 0 0.0% 3.0 181.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0383 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3745 3.9% 79.7 5.61sec 21258 0 18025 36136 21631 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 79.65 78.28 0.00 0.00 0.0000 0.0000 1693269.49 1693269.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 62.65 80.04% 18025.26 17249 22664 18028.79 17500 18625 1129339 1129339 0.00
crit 15.61 19.94% 36135.99 34498 45328 36143.28 34498 40331 563930 563930 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8576 8.9% 22.5 20.23sec 172351 141609 0 0 0 0.0% 0.0% 0.0% 0.0% 177.0 18038 37207 21894 20.1% 0.0% 85.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.48 22.48 176.98 176.98 1.2171 2.1789 3874702.72 3874702.72 0.00 9382.46 141608.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.48 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 141.4 79.89% 18038.28 16883 22312 18043.09 17537 18629 2550245 2550245 0.00
crit 35.6 20.11% 37207.06 34779 45963 37219.06 35073 40031 1324457 1324457 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2420 2.5% 51.3 8.57sec 21326 71213 17582 36333 21326 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.27 51.27 0.00 0.00 0.2995 0.0000 1093400.19 1093400.19 0.00 71212.73 71212.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.01 79.99% 17582.30 16883 22312 17585.24 16925 18410 721069 721069 0.00
crit 10.25 19.99% 36332.89 34779 45963 36338.46 0 45963 372331 372331 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - shadowfiend 33208 / 2623
melee 33208 2.7% 39.9 9.54sec 29393 34251 25584 51390 29393 20.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.88 39.88 0.00 0.00 0.8582 0.0000 1172170.64 1172170.64 0.00 34250.96 34250.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.02 55.21% 25584.40 19717 29593 25591.80 23495 27944 563260 563260 0.00
crit 8.27 20.73% 51390.03 39434 59187 51395.81 0 59187 424758 424758 0.00
glance 9.59 24.04% 19207.53 14788 22195 19212.47 0 22195 184152 184152 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.93 5.93 0.00 0.00 1.0426 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.9 56.7 3.0 3.0 115573.7
halo_damage Mana 11.1 498760.2 45000.0 45000.0 3.2
mind_blast Mana 48.1 293059.6 6094.2 6094.2 17.3
mind_flay Mana 114.5 343558.3 3000.0 3000.0 24.0
mind_spike Mana 34.0 101942.3 3000.0 3000.0 30.2
shadow_word_death Mana 13.0 101267.1 7800.0 7800.0 15.9
shadow_word_pain Mana 49.6 654378.3 13200.0 13200.0 7.7
vampiric_touch Mana 22.5 202333.2 9000.0 9000.0 19.2
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1808.39 502899.30 278.09 39618.09 7.30%
dispersion Mana 0.00 78.12 18000.00 0.00 0.00%
shadowfiend Mana 39.87 232883.56 5841.27 125934.29 35.10%
Shadow Orbs from Mind Blast Shadow Orb 48.08 48.08 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.71 6.71 1.00 0.00 0.00%
Devouring Plague Health Health 184.50 0.00 0.00 2537369.31 100.00%
Vampiric Touch Mana Mana 228.25 1350207.97 5915.52 173098.88 11.36%
Resource RPS-Gain RPS-Loss
Mana 4612.93 4854.47
Shadow Orb 0.12 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.5sec 180.5sec 7% 15%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.8 0.6 28.5sec 27.2sec 6% 29%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.0%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.2sec 123.2sec 18% 18%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:17.9%
glyph_mind_spike 25.6 8.4 17.1sec 12.8sec 29% 33%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:22.6%
  • glyph_mind_spike_2:6.0%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_magistrate_figurine 7.7 0.0 61.0sec 61.0sec 25% 25%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.2%
jade_serpent_potion 2.0 0.0 423.3sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.4sec 54.4sec 23% 23%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
raid_movement 15.5 0.0 30.0sec 30.0sec 17% 17%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
shadow_word_death_reset_cooldown 6.7 0.0 11.5sec 11.5sec 9% 48%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.5%
stunned 8.0 0.0 60.0sec 0.0sec 4% 4%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
surge_of_darkness 31.1 3.2 14.1sec 12.7sec 13% 100%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:12.6%
  • surge_of_darkness_2:0.7%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 8.0 0.0 60.9sec 60.6sec 17% 17%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-raid_movement 0.0 0.0 0.0sec 0.0sec 0% 0%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:0.0%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83% 81%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.6%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 6.6%
shadowfiend-Mana Cap 6.6%
lightwell-Mana Cap 6.6%


Count Interval
Shadowy Recall Extra Tick 229.4 1.9sec
Shadowy Apparition Procced 79.7 5.6sec
Divine Insight Mind Blast CD Reset 15.5 27.2sec
FDCL Mind Spike proc 34.3 12.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 452.22
Minimum 349.36
Maximum 556.80
Spread ( max - min ) 207.44
Range [ ( max - min ) / 2 * 100% ] 22.94%


Sample Data
Count 100000
Mean 96320.02
Minimum 88293.36
Maximum 106565.60
Spread ( max - min ) 18272.24
Range [ ( max - min ) / 2 * 100% ] 9.49%
Standard Deviation 2163.0157
5th Percentile 92873.39
95th Percentile 99976.71
( 95th Percentile - 5th Percentile ) 7103.32
Mean Distribution
Standard Deviation 6.8401
95.00% Confidence Intervall ( 96306.61 - 96333.43 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1937
0.1 Scale Factor Error with Delta=300 39939
0.05 Scale Factor Error with Delta=300 159758
0.01 Scale Factor Error with Delta=300 3993953
Distribution Chart


Sample Data
Count 100000
Mean 96320.02


Sample Data
Count 100000
Mean 42344467.90


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 288.39
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
F shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
G shadow_word_death,if=num_targets<=4
H vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
I halo_damage
J shadowfiend,if=cooldown_react
K mind_sear,chain=1,interrupt=1,if=num_targets>=2
L mind_flay,chain=1,interrupt=1
M shadow_word_death,moving=1
N mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
O shadow_word_pain,moving=1
P dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.69, Spirit=2.31, SpellDamage=2.97, HitRating=2.31, CritRating=1.54, HasteRating=1.50, MasteryRating=1.49 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.69, Spirit=2.31, SpellDamage=2.97, HitRating=0.00, CritRating=1.54, HasteRating=1.50, MasteryRating=1.49 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=3.69, Spirit=2.31, SpellDamage=2.97, HitRating=2.31, CritRating=1.54, HasteRating=1.50, MasteryRating=1.49 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=3.69, Spirit=2.31, SpellDamage=2.97, HitRating=0.00, CritRating=1.54, HasteRating=1.50, MasteryRating=1.49 )

priest_90_di_mb : 97250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
97250.0 97250.0 12.75 / 0.01% 3385 / 3.5% 18.6 4856.4 4761.9 Mana 0.57% 35.3 100.0%
  • dark_binding
  • fade
  • inner_sanctum
  • shadow_ravens
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.73 2.27 2.99 2.27 1.55 1.45 1.51
Normalized 1.00 0.61 0.80 0.61 0.42 0.39 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery > Haste

Charts,s,333333&chd=t:290848|143342|120469|103610|102773|86178|84320|80915|71207|69237|43406&chds=0,581697&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++290848++devouring_plague,9482C9,0,0,15|t++143342++vampiric_touch,9482C9,1,0,15|t++120469++halo_damage,9482C9,2,0,15|t++103610++shadow_word_death,9482C9,3,0,15|t++102773++mind_flay_mastery,9482C9,4,0,15|t++86178++mind_blast,9482C9,5,0,15|t++84320++devouring_plague_mastery,9482C9,6,0,15|t++80915++shadow_word_pain,9482C9,7,0,15|t++71207++vampiric_touch_mastery,9482C9,8,0,15|t++69237++shadow_word_pain_mastery,9482C9,9,0,15|t++43406++mind_flay,9482C9,10,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:23,13,12,10,9,7,7,6,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mindbender: melee|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.73,2.99,2.27,2.27,1.55,1.51,1.45|3.71,2.97,2.25,2.25,1.53,1.49,1.43|3.75,3.01,2.29,2.29,1.57,1.53,1.47&chds=0,7.46&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.73++Int,8A8A8A,0,0,15,0.1|t++++2.99++SP,8A8A8A,0,1,15,0.1|t++++2.27++Spi,8A8A8A,0,2,15,0.1|t++++2.27++Hit,8A8A8A,0,3,15,0.1|t++++1.55++Crit,8A8A8A,0,4,15,0.1|t++++1.51++Mastery,8A8A8A,0,5,15,0.1|t++++1.45++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wyz121221221355784430ywusqqpoonmmlkjijjjiiijjkkjjihgfefeffeeeffgggghhhhijjkjkkjjjihgfeeeeddddddcccccccccddeeeecbZZYXYZZZabcdeeefgghikmmnoooonmljhgggfffeeddcccccccdeefffffeddcccdeefghijjijjkklmnnooonnnlkjihghgfffeeddddddddeeeeefeeecbaZYYZYYYYYZabbcdeffhjlmnnnnoonmlkjiihgggfeedddddddeeefgfffeddccccccccddeeeeffgghijjkklllkkjihghhhhggggfffffffgghhhihhhfdcaaZbbbccdeeffghijkmpqstuuuvuutsrqqppponmmlkjjjjjjjjjkkkkkihhiihiiiiiiiijjkklllnopppqrrrrrrqpopoooonnnmlmlllllmmnnnnnnljhgffggfffeeeeeghiijloqstuuvxxxyyxxxwvwvvvuussrrrqqqqqqqqqpommmmlmmmmllkkjiiiiihikjii&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=97250|max=168282&chxp=1,1,58,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,6,5,12,32,66,108,217,305,556,764,1267,1687,2257,2919,3680,4419,5273,5939,6331,6732,7074,6816,6726,6220,5575,5108,4318,3644,2969,2274,1866,1402,1042,755,545,379,252,165,112,63,48,30,19,6,6,3,5,0,1&chds=0,7074&chbh=5&chxt=x&chxl=0:|min=89303|avg=97250|max=107201&chxp=0,1,44,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:48.4,14.0,12.6,6.1,4.9,3.6,2.9,2.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 219.1s|shadow_word_pain 63.4s|mind_blast 57.2s|vampiric_touch 27.5s|devouring_plague 22.1s|shadow_word_death 16.2s|halo_damage 13.2s|mindbender 9.1s|waiting 2.6s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_mb 97250
berserking 0 0.0% 3.0 180.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 14220 14.6% 18.6 25.25sec 346527 290848 127337 262773 154570 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.55 18.55 0.00 0.00 1.1914 0.0000 2867511.61 2867511.61 0.00 290848.36 290848.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 14.81 79.84% 127336.72 120670 157491 127380.96 120670 136224 1886000 1886000 0.00
crit 3.74 20.13% 262772.94 248580 324432 258198.98 0 324432 981512 981512 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2268 2.3% 40.6 10.49sec 25256 84320 20857 43039 25256 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.61 40.61 0.00 0.00 0.2995 0.0000 1025585.94 1025585.94 0.00 84320.15 84320.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 32.53 80.12% 20856.93 20014 26121 20858.67 20014 22544 678553 678553 0.00
crit 8.06 19.86% 43039.39 41228 53810 43018.06 0 52375 347033 347033 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 7874 8.1% 18.6 25.25sec 191957 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.3 20913 43138 25389 20.1% 0.0% 23.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.55 18.55 140.26 140.26 0.0000 0.7530 3561109.73 3561109.73 0.00 33717.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 112.0 79.86% 20912.84 20021 51124 20914.19 20099 23619 2342517 2342517 0.00
crit 28.2 20.14% 43138.07 41243 105315 43142.82 41243 52740 1218592 1218592 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3519 3.6% 11.2 41.76sec 141973 120469 118113 244139 142567 19.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.20 11.15 0.00 0.00 1.1785 0.0000 1589714.51 1589714.51 0.00 120469.42 120469.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.98 80.55% 118112.99 112598 140757 118149.82 112598 127735 1060922 1060922 0.00
crit 2.17 19.42% 244139.04 231952 289959 221322.80 0 289959 528793 528793 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 10896 11.2% 46.9 9.62sec 105106 86178 86729 179049 105106 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 46.86 46.86 0.00 0.00 1.2196 0.0000 4925476.40 4925476.40 0.00 86177.52 86177.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 37.51 80.04% 86729.18 82915 108661 86751.59 84183 89970 3253147 3253147 0.00
crit 9.34 19.93% 179048.87 170805 223841 179097.20 0 223841 1672329 1672329 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 21062 21.6% 130.0 3.42sec 73167 43406 0 0 0 0.0% 0.0% 0.0% 0.0% 267.3 29269 60502 35583 20.2% 0.0% 43.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 129.98 129.98 267.26 267.26 1.6856 0.7327 9510015.54 9510015.54 0.00 43405.90 43405.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 129.94 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 213.2 79.78% 29269.15 27880 36400 29274.57 28766 29831 6241076 6241076 0.00
crit 54.0 20.22% 60502.49 57433 74983 60515.28 58291 64041 3268939 3268939 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5283 5.4% 77.5 5.66sec 30780 102773 25337 52357 30780 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 77.49 77.49 0.00 0.00 0.2995 0.0000 2385045.19 2385045.19 0.00 102772.66 102772.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 61.84 79.80% 25336.57 24241 31649 25340.56 24536 26507 1566721 1566721 0.00
crit 15.63 20.17% 52357.22 49937 65196 52366.28 49937 58770 818324 818324 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.8 61.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 1.1572 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 7.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3713 3.8% 13.6 5.42sec 123747 103610 101659 210141 123747 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.57 13.57 0.00 0.00 1.1944 0.0000 1678995.17 1678995.17 0.00 103609.70 103609.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.80 79.59% 101659.04 94128 123585 101755.37 94128 111143 1097798 1097798 0.00
crit 2.77 20.38% 210141.00 193905 254586 199908.33 0 254586 581197 581197 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 11341 11.7% 54.1 8.28sec 94727 80915 0 0 0 0.0% 0.0% 0.0% 0.0% 247.0 15809 32637 20757 29.4% 0.0% 95.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 54.12 54.12 246.98 246.98 1.1707 1.7477 5126582.58 5126582.58 0.00 10356.88 80914.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 54.11 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 174.4 70.59% 15808.67 15106 19713 15815.72 15387 16321 2756251 2756251 0.00
crit 72.6 29.41% 32637.01 31119 40608 32651.67 31548 34222 2370332 2370332 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3281 3.4% 71.6 6.21sec 20729 69237 15739 32486 20729 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 71.56 71.56 0.00 0.00 0.2994 0.0000 1483338.39 1483338.39 0.00 69237.23 69237.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.20 70.15% 15738.87 15106 19713 15742.28 15172 16463 790083 790083 0.00
crit 21.34 29.82% 32486.41 31119 40608 32493.72 31119 35182 693255 693255 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowy_apparition 3806 3.9% 81.0 5.51sec 21239 0 18011 36112 21614 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 81.04 79.64 0.00 0.00 0.0000 0.0000 1721230.89 1721230.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 63.74 80.04% 18010.71 17249 22664 18014.19 17492 18649 1148004 1148004 0.00
crit 15.87 19.93% 36111.72 34498 45328 36120.27 34498 40413 573227 573227 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8739 9.0% 22.8 19.97sec 173319 143342 0 0 0 0.0% 0.0% 0.0% 0.0% 180.7 17991 37104 21853 20.2% 0.0% 86.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.78 22.78 180.65 180.65 1.2091 2.1724 3947786.87 3947786.87 0.00 9399.87 143342.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.77 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 144.2 79.80% 17991.15 16883 22312 17997.70 17449 18599 2593467 2593467 0.00
crit 36.5 20.20% 37104.43 34779 45963 37118.58 35043 40351 1354319 1354319 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2470 2.5% 52.3 8.40sec 21324 71207 17579 36326 21324 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 52.33 52.33 0.00 0.00 0.2995 0.0000 1115950.31 1115950.31 0.00 71206.63 71206.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.85 79.97% 17578.84 16883 22312 17581.59 16946 18437 735729 735729 0.00
crit 10.47 20.00% 36325.58 34779 45963 36330.78 0 44049 380221 380221 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - mindbender 26024 / 6654
melee 26024 6.8% 110.8 3.93sec 27082 26829 23508 47025 27082 21.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 110.84 110.84 0.00 0.00 1.0094 0.0000 3001882.35 3001882.35 0.00 26829.11 26829.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 60.65 54.72% 23507.71 18891 28643 23512.89 21988 25046 1425814 1425814 0.00
crit 23.53 21.23% 47025.48 37781 57286 47052.49 41181 52042 1106591 1106591 0.00
glance 26.63 24.02% 17631.10 14168 21482 17636.37 15959 19299 469478 469478 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:262.33
  • base_dd_max:262.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.2 19.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 23.17 23.17 0.00 0.00 1.1544 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 23.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.6 55.6 3.0 3.0 115530.8
halo_damage Mana 11.2 503879.4 45000.0 45000.0 3.2
mind_blast Mana 46.9 277172.2 5914.7 5914.7 17.8
mind_flay Mana 130.0 389931.5 3000.0 3000.0 24.4
shadow_word_death Mana 13.6 105830.5 7800.0 7800.0 15.9
shadow_word_pain Mana 54.1 714377.3 13200.0 13200.0 7.2
vampiric_touch Mana 22.8 204998.6 9000.0 9000.0 19.3
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1808.39 430224.77 237.90 112292.63 20.70%
mindbender Mana 110.81 589236.45 5317.41 740514.63 55.69%
Shadow Orbs from Mind Blast Shadow Orb 46.85 46.85 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.91 6.91 1.00 0.00 0.00%
Devouring Plague Health Health 180.87 0.00 0.00 2487438.33 100.00%
Vampiric Touch Mana Mana 232.99 1133955.42 4867.04 420964.89 27.07%
Resource RPS-Gain RPS-Loss
Mana 4761.85 4856.44
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 7% 11%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 11%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.2 0.7 27.9sec 26.5sec 7% 30%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.5%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.3sec 123.3sec 18% 18%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:17.9%
jade_magistrate_figurine 7.7 0.0 61.1sec 61.1sec 25% 25%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.1%
jade_serpent_potion 2.0 0.0 423.3sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.4sec 54.4sec 23% 23%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
raid_movement 15.5 0.0 30.0sec 30.0sec 17% 17%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
shadow_word_death_reset_cooldown 6.9 0.0 11.2sec 11.2sec 9% 49%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.8%
stunned 8.0 0.0 60.0sec 0.0sec 4% 4%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
synapse_springs_2 8.0 0.0 60.9sec 60.7sec 17% 17%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
mindbender-raid_movement 0.2 0.0 60.0sec 60.0sec 0% 0%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:0.1%
mindbender-shadowcrawl 23.2 0.0 19.4sec 19.4sec 85% 84%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.8%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 10.0%
shadowfiend-Mana Cap 10.0%
lightwell-Mana Cap 10.0%


Count Interval
Shadowy Recall Extra Tick 242.0 1.8sec
Shadowy Apparition Procced 81.0 5.5sec
Divine Insight Mind Blast CD Reset 15.9 26.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 452.22
Minimum 349.36
Maximum 556.80
Spread ( max - min ) 207.44
Range [ ( max - min ) / 2 * 100% ] 22.94%


Sample Data
Count 100000
Mean 97250.04
Minimum 89303.12
Maximum 107200.83
Spread ( max - min ) 17897.71
Range [ ( max - min ) / 2 * 100% ] 9.20%
Standard Deviation 2056.4662
5th Percentile 93951.92
95th Percentile 100721.11
( 95th Percentile - 5th Percentile ) 6769.18
Mean Distribution
Standard Deviation 6.5031
95.00% Confidence Intervall ( 97237.29 - 97262.78 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1717
0.1 Scale Factor Error with Delta=300 36101
0.05 Scale Factor Error with Delta=300 144406
0.01 Scale Factor Error with Delta=300 3610162
Distribution Chart


Sample Data
Count 100000
Mean 97250.04


Sample Data
Count 100000
Mean 40938343.13


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 265.84
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I mindbender,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=3.73, Spirit=2.27, SpellDamage=2.99, HitRating=2.27, CritRating=1.55, HasteRating=1.45, MasteryRating=1.51 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=3.73, Spirit=2.27, SpellDamage=2.99, HitRating=0.00, CritRating=1.55, HasteRating=1.45, MasteryRating=1.51 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=3.73, Spirit=2.27, SpellDamage=2.99, HitRating=2.27, CritRating=1.55, HasteRating=1.45, MasteryRating=1.51 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=3.73, Spirit=2.27, SpellDamage=2.99, HitRating=0.00, CritRating=1.55, HasteRating=1.45, MasteryRating=1.51 )

priest_90_di_swi : 93903 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
93903.2 93903.2 12.84 / 0.01% 3412 / 3.6% 18.0 5056.1 4755.5 Mana 0.58% 35.9 100.0%
  • dark_binding
  • fade
  • inner_sanctum
  • shadow_ravens
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.58 2.22 2.87 2.22 1.51 1.43 1.44
Normalized 1.00 0.62 0.80 0.62 0.42 0.40 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery = Haste

Charts,s,333333&chd=t:290429|141928|120604|103612|103057|94079|86333|84364|74703|71215|69338|43642&chds=0,580858&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++290429++devouring_plague,9482C9,0,0,15|t++141928++vampiric_touch,9482C9,1,0,15|t++120604++halo_damage,9482C9,2,0,15|t++103612++shadow_word_death,9482C9,3,0,15|t++103057++mind_flay_mastery,9482C9,4,0,15|t++94079++shadow_word_insanity,9482C9,5,0,15|t++86333++mind_blast,9482C9,6,0,15|t++84364++devouring_plague_mastery,9482C9,7,0,15|t++74703++shadow_word_pain,9482C9,8,0,15|t++71215++vampiric_touch_mastery,9482C9,9,0,15|t++69338++shadow_word_pain_mastery,9482C9,10,0,15|t++43642++mind_flay,9482C9,11,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:22,12,12,9,8,7,6,4,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadow_word_insanity|shadowy_apparition|halo_damage|shadow_word_pain_mastery|shadowfiend: melee|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.58,2.87,2.22,2.22,1.51,1.44,1.43|3.56,2.86,2.20,2.20,1.49,1.43,1.41|3.60,2.89,2.24,2.24,1.53,1.46,1.45&chds=0,7.16&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.58++Int,8A8A8A,0,0,15,0.1|t++++2.87++SP,8A8A8A,0,1,15,0.1|t++++2.22++Spi,8A8A8A,0,2,15,0.1|t++++2.22++Hit,8A8A8A,0,3,15,0.1|t++++1.51++Crit,8A8A8A,0,4,15,0.1|t++++1.44++Mastery,8A8A8A,0,5,15,0.1|t++++1.43++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:xz022101111035587331zxvtqpppoonnmljjhijjijjkkllkjjigffeeeeddddddcbbccccdfffghihhgggffeeeeeeeeddccbbcdddddefffedbaZYYYYYYYZaabaaabbcdghikkkklkjihgfffffffeddcbcbcccdefghgggfeddddffhijklmmkkkkllmnnooponmkihffefffffeeeeddcddeeffggggffdcaaZYZYYYYYZZZZZZabbdfgijkkkkkjiihggggggffeedcdddddeefghggffedddcddddddeeedcdddeefgghiiihhggfeeeefffffffeeeeffgghijjjjihfdcbbcdeeghiijjjkklmoqstuvuuutsrponnnnnnmmllkjjjjjjjkkllllkjiiiihiiiiijjjkjjjkkkmnnnooooooonmmllllllmmllllklllmmnnoppoomkihhghhggggggfffghhiknpqqrrrtttuutttttttttssrrrrrqqrqrrrrqqommmmlmmnnmmmmmlkklllmonnn&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=93903|max=165323&chxp=1,1,57,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:6,3,5,12,21,41,82,118,227,358,592,962,1322,1856,2491,3180,4023,4627,5477,6200,6721,7062,7060,6788,6682,6004,5420,4714,4029,3423,2669,2124,1636,1192,935,656,452,312,200,111,95,37,30,25,10,4,2,2,1,1&chds=0,7062&chbh=5&chxt=x&chxl=0:|min=85581|avg=93903|max=103827&chxp=0,1,46,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:46.4,14.2,12.4,6.0,4.8,3.8,3.5,2.9,0.7,0.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 209.6s|shadow_word_pain 64.3s|mind_blast 56.1s|vampiric_touch 27.2s|devouring_plague 21.8s|shadow_word_insanity 17.4s|shadow_word_death 15.9s|halo_damage 13.1s|shadowfiend 3.1s|dispersion 0.0s|waiting 2.6s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_swi 93903
berserking 0 0.0% 3.0 180.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 13991 14.9% 18.3 25.67sec 346163 290429 127446 263059 154687 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.27 18.27 0.00 0.00 1.1919 0.0000 2826251.76 2826251.76 0.00 290428.84 290428.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 14.59 79.86% 127446.39 120670 157491 127493.67 120670 137146 1859582 1859582 0.00
crit 3.67 20.11% 263059.49 248580 324432 258125.04 0 324432 966670 966670 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2227 2.4% 39.9 10.68sec 25266 84364 20873 43076 25266 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.87 39.87 0.00 0.00 0.2995 0.0000 1007389.86 1007389.86 0.00 84363.94 84363.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 31.96 80.16% 20872.95 20014 26121 20875.13 20014 22269 667124 667124 0.00
crit 7.90 19.81% 43075.97 41228 53810 43057.35 0 52602 340266 340266 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 7735 8.2% 18.3 25.67sec 191476 0 0 0 0 0.0% 0.0% 0.0% 0.0% 137.7 20932 43177 25410 20.1% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.27 18.27 137.68 137.68 0.0000 0.7530 3498417.09 3498417.09 0.00 33746.68 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 110.0 79.87% 20932.47 20021 49442 20933.82 20021 23096 2301766 2301766 0.00
crit 27.7 20.13% 43176.97 41243 101851 43182.98 41243 54574 1196651 1196651 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3484 3.7% 11.1 42.11sec 141829 120604 117889 243780 142339 19.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.10 11.06 0.00 0.00 1.1760 0.0000 1574369.66 1574369.66 0.00 120604.39 120604.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.91 80.53% 117889.33 112598 140757 117914.70 112598 127001 1050080 1050080 0.00
crit 2.15 19.44% 243779.53 231952 289959 220916.83 0 289959 524289 524289 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 10721 11.4% 46.1 9.79sec 105229 86333 86819 179219 105229 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 46.06 46.06 0.00 0.00 1.2189 0.0000 4846907.80 4846907.80 0.00 86333.01 86333.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 36.86 80.03% 86819.13 82915 108661 86840.95 84239 90572 3200179 3200179 0.00
crit 9.19 19.95% 179218.81 170805 223841 179260.57 0 213655 1646729 1646729 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 20255 21.6% 123.9 3.58sec 73836 43642 0 0 0 0.0% 0.0% 0.0% 0.0% 256.3 29358 60685 35690 20.2% 0.0% 41.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 123.89 123.89 256.31 256.31 1.6919 0.7315 9147647.26 9147647.26 0.00 43642.11 43642.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 123.86 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 204.5 79.79% 29358.38 27880 36400 29363.72 28910 29913 6003992 6003992 0.00
crit 51.8 20.21% 60684.98 57433 74983 60698.15 58467 64500 3143656 3143656 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5078 5.4% 74.3 5.91sec 30864 103057 25403 52499 30864 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 74.30 74.30 0.00 0.00 0.2995 0.0000 2293234.33 2293234.33 0.00 103057.45 103057.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 59.29 79.79% 25402.96 24241 31649 25406.64 24550 26521 1506061 1506061 0.00
crit 14.99 20.18% 52499.17 49937 65196 52507.85 49937 60303 787174 787174 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3651 3.9% 13.3 5.48sec 123739 103612 101668 210175 123739 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.35 13.35 0.00 0.00 1.1942 0.0000 1651679.25 1651679.25 0.00 103612.02 103612.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.63 79.61% 101668.04 94128 123585 101769.23 94128 110897 1080319 1080319 0.00
crit 2.72 20.37% 210175.42 193905 254586 199502.37 0 254586 571360 571360 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_insanity 3612 3.9% 14.6 30.28sec 111714 94079 91565 188755 111714 20.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 14.62 14.62 0.00 0.00 1.1875 0.0000 1633772.05 1633772.05 0.00 94078.78 94078.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.58 79.21% 91565.17 89698 117855 91576.63 89698 97034 1060741 1060741 0.00
crit 3.04 20.76% 188755.26 184778 242782 182065.34 0 231642 573031 573031 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:1990.94
  • base_dd_max:2101.44
shadow_word_pain 10626 11.3% 54.6 8.20sec 87941 74703 0 0 0 0.0% 0.0% 0.0% 0.0% 230.0 15912 32859 20878 29.3% 0.0% 87.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 54.61 54.61 230.01 230.01 1.1772 1.7126 4802109.25 4802109.25 0.00 10480.52 74702.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 54.59 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 162.6 70.70% 15912.11 15106 19713 15920.52 15461 16436 2587507 2587507 0.00
crit 67.4 29.30% 32858.91 31119 40608 32876.79 31473 34466 2214602 2214602 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3060 3.3% 66.6 6.66sec 20760 69338 15775 32562 20760 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 66.64 66.64 0.00 0.00 0.2994 0.0000 1383423.04 1383423.04 0.00 69337.56 69337.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 46.81 70.25% 15774.73 15106 19713 15778.34 15264 16463 738483 738483 0.00
crit 19.81 29.72% 32562.26 31119 40608 32570.95 31119 35409 644940 644940 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowfiend 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0390 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3603 3.8% 76.6 5.83sec 21281 0 18047 36191 21652 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 76.56 75.24 0.00 0.00 0.0000 0.0000 1629179.06 1629179.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 60.26 80.08% 18046.86 17249 22664 18050.67 17496 18693 1087430 1087430 0.00
crit 14.97 19.89% 36191.20 34498 45328 36201.15 34498 40754 541749 541749 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8544 9.1% 22.3 20.36sec 172865 141928 0 0 0 0.0% 0.0% 0.0% 0.0% 176.4 18049 37239 21889 20.0% 0.0% 85.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.33 22.33 176.38 176.38 1.2180 2.1817 3860736.89 3860736.89 0.00 9370.52 141928.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.33 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 141.1 79.99% 18048.87 16883 22312 18054.00 17545 18605 2546531 2546531 0.00
crit 35.3 20.01% 37239.04 34779 45963 37251.65 35039 40470 1314206 1314206 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.376000
  • base_td:67.16
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2411 2.6% 51.1 8.60sec 21327 71215 17587 36338 21327 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.08 51.08 0.00 0.00 0.2995 0.0000 1089452.18 1089452.18 0.00 71215.33 71215.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.87 80.00% 17587.30 16883 22312 17590.23 16938 18492 718747 718747 0.00
crit 10.20 19.97% 36337.94 34779 45963 36340.77 0 43815 370705 370705 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.376000
  • base_dd_min:67.16
  • base_dd_max:67.16
pet - shadowfiend 33301 / 2639
melee 33301 2.8% 40.1 9.51sec 29399 34381 25601 51468 29399 20.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.11 40.11 0.00 0.00 0.8551 0.0000 1179236.60 1179236.60 0.00 34381.08 34381.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.21 55.37% 25601.34 19717 29593 25607.99 23701 27935 568619 568619 0.00
crit 8.27 20.62% 51468.40 39434 59187 51474.37 0 59187 425635 425635 0.00
glance 9.62 23.98% 19227.96 14788 22195 19231.89 0 22195 184982 184982 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.0395 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.3 54.8 3.0 3.0 115408.7
halo_damage Mana 11.1 499521.6 45000.0 45000.0 3.2
mind_blast Mana 46.1 279702.0 6072.5 6072.5 17.3
mind_flay Mana 123.9 371671.9 3000.0 3000.0 24.6
shadow_word_death Mana 13.3 104115.4 7800.0 7800.0 15.9
shadow_word_insanity Mana 14.6 109684.5 7500.0 7500.0 14.9
shadow_word_pain Mana 54.6 720801.6 13200.0 13200.0 6.7
vampiric_touch Mana 22.3 201004.4 9000.0 9000.0 19.2
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1808.39 510611.68 282.36 31905.71 5.88%
dispersion Mana 0.03 500.04 18000.00 0.00 0.00%
shadowfiend Mana 40.10 258296.22 6441.17 102611.43 28.43%
Shadow Orbs from Mind Blast Shadow Orb 46.05 46.05 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.87 6.87 1.00 0.00 0.00%
Devouring Plague Health Health 177.55 0.00 0.00 2441744.39 100.00%
Vampiric Touch Mana Mana 227.46 1381155.87 6071.98 136874.16 9.02%
Resource RPS-Gain RPS-Loss
Mana 4755.55 5056.14
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.6sec 180.6sec 7% 17%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9% 12%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.2 0.6 29.7sec 28.3sec 6% 29%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.2%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.2 0.0 123.1sec 123.1sec 18% 18%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:17.9%
jade_magistrate_figurine 7.7 0.0 61.0sec 61.0sec 25% 25%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:jade_magistrate_figurine_trinket2
  • max_stacks:1
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:2822.00

    Stack Uptimes

    • jade_magistrate_figurine_1:25.1%
jade_serpent_potion 2.0 0.0 423.3sec 0.0sec 10% 10%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.5sec 54.5sec 23% 23%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
raid_movement 15.5 0.0 30.0sec 30.0sec 17% 17%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
shadow_word_death_reset_cooldown 6.9 0.0 11.3sec 11.3sec 9% 49%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.7%
stunned 8.0 0.0 60.0sec 0.0sec 4% 4%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
synapse_springs_2 8.0 0.0 60.9sec 60.6sec 17% 17%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83% 81%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.6%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 5.7%
shadowfiend-Mana Cap 5.7%
lightwell-Mana Cap 5.7%


Count Interval
Shadowy Recall Extra Tick 231.9 1.9sec
Shadowy Apparition Procced 76.6 5.8sec
Divine Insight Mind Blast CD Reset 14.8 28.3sec
Shadow Word: Insanity removed DoTs 14.6 30.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 452.22
Minimum 349.36
Maximum 556.80
Spread ( max - min ) 207.44
Range [ ( max - min ) / 2 * 100% ] 22.94%


Sample Data
Count 100000
Mean 93903.16
Minimum 85580.89
Maximum 103827.07
Spread ( max - min ) 18246.18
Range [ ( max - min ) / 2 * 100% ] 9.72%
Standard Deviation 2072.1810
5th Percentile 90575.30
95th Percentile 97400.09
( 95th Percentile - 5th Percentile ) 6824.79
Mean Distribution
Standard Deviation 6.5528
95.00% Confidence Intervall ( 93890.31 - 93916.00 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1870
0.1 Scale Factor Error with Delta=300 36655
0.05 Scale Factor Error with Delta=300 146621
0.01 Scale Factor Error with Delta=300 3665549
Distribution Chart


Sample Data
Count 100000
Mean 93903.16


Sample Data
Count 100000
Mean 41244569.48


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 270.93
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 use_item,name=jade_magistrate_figurine
A jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
B devouring_plague,if=shadow_orb=3
C berserking
D shadow_word_insanity,if=num_targets<=4
E mind_blast,if=num_targets<=4&cooldown_react
F shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|ticks_remain<1)&miss_react
G shadow_word_death,if=num_targets<=4
H vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
I halo_damage
J shadowfiend,if=cooldown_react
K mind_sear,chain=1,interrupt=1,if=num_targets>=2
L mind_flay,chain=1,interrupt=1
M shadow_word_death,moving=1
N mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
O shadow_word_pain,moving=1
P dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21407 19023 17915
Spirit 4206 4206 3989
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35457 26920 7907
Spell Hit 14.97% 14.97% 1102
Spell Crit 21.09% 15.15% 3843
Spell Haste 25.40% 19.43% 8259
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 14.97% 14.97% 1102
Melee Crit 14.77% 9.76% 3843
Melee Haste 19.43% 19.43% 8259
Swing Speed 31.38% 19.43% 8259
Expertise 0.00% / 0.00% 0.00% / 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.11% 11.11% 1867


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17915
# gear_spirit=3989
# gear_spell_power=7907
# gear_hit_rating=1102
# gear_crit_rating=3843
# gear_haste_rating=8259
# gear_mastery_rating=1867
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=3.58, Spirit=2.22, SpellDamage=2.87, HitRating=2.22, CritRating=1.51, HasteRating=1.43, MasteryRating=1.44 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=3.58, Spirit=2.22, SpellDamage=2.87, HitRating=0.00, CritRating=1.51, HasteRating=1.43, MasteryRating=1.44 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=3.58, Spirit=2.22, SpellDamage=2.87, HitRating=2.22, CritRating=1.51, HasteRating=1.43, MasteryRating=1.44 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=3.58, Spirit=2.22, SpellDamage=2.87, HitRating=0.00, CritRating=1.51, HasteRating=1.43, MasteryRating=1.44 )

priest_90_pi_fdcl : 95978 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
95978.0 95978.0 12.36 / 0.01% 3283 / 3.4% 18.7 4982.5 4718.1 Mana 0.58% 37.9 100.0%
  • mind_spike
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.67 2.24 2.95 2.24 1.55 1.44 1.45
Normalized 1.00 0.61 0.80 0.61 0.42 0.39 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery = Haste

Charts,s,333333&chd=t:294806|148099|122227|104897|103209|85464|85251|84608|77583|71208|69386|44892&chds=0,589613&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9&chm=t++294806++devouring_plague,9482C9,0,0,15|t++148099++vampiric_touch,9482C9,1,0,15|t++122227++halo_damage,9482C9,2,0,15|t++104897++shadow_word_death,9482C9,3,0,15|t++103209++mind_flay_mastery,9482C9,4,0,15|t++85464++shadow_word_pain,9482C9,5,0,15|t++85251++mind_blast,9482C9,6,0,15|t++84608++devouring_plague_mastery,9482C9,7,0,15|t++77583++mind_spike,000066,8,0,15|t++71208++vampiric_touch_mastery,9482C9,9,0,15|t++69386++shadow_word_pain_mastery,9482C9,10,0,15|t++44892++mind_flay,9482C9,11,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,12,10,9,8,7,6,5,4,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowfiend: melee|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.67,2.95,2.24,2.24,1.55,1.45,1.44|3.65,2.93,2.22,2.22,1.53,1.43,1.43|3.69,2.97,2.26,2.26,1.57,1.47,1.46&chds=0,7.34&chco=C0C0C0&chm=E,FF0000,1:0,,1:20|t++++3.67++Int,8A8A8A,0,0,15,0.1|t++++2.95++SP,8A8A8A,0,1,15,0.1|t++++2.24++Spi,8A8A8A,0,2,15,0.1|t++++2.24++Hit,8A8A8A,0,3,15,0.1|t++++1.55++Crit,8A8A8A,0,4,15,0.1|t++++1.45++Mastery,8A8A8A,0,5,15,0.1|t++++1.44++Haste,8A8A8A,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:y0134222222134686331zxvtqopppoonnmlkiijjiiiijkkjiihffeeddeeddeeeeddddddeffffhhfffffedceeeeeeeeeddcccdddcdefeeecbZYXXYYZabcdeeeffgghiklmnonnnmlkihghggfffeeedddddddeefghggfedddddffghiklllkkklllmnnooommljigfeeffffffeeededdeeeffffgffedbaZYYZZZabbccddeeffghjkmnonnnmlkjihhhhggffffeedeedeeefgggfffeeddddddcddddeddddddeffgghhhhhgffedffffffgffffffffgghhijiiigecbbbddefhijlmmnoopqsuwxzyyxxwvtrqooonnnmmlljjjjjjjjjjklkkkihhhihiiiiijjjjjkkkkklnnnnonoooonmmlmlllllllllllllllmmmnoonnmkiggghiiiiiijjjklmnnprtuvwwvwwwwvututtttttssrrrqqqqqqqqrqppnmmmmlnnnnnmmmmmmllllnoono&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=556|1:|0|avg=95978|max=165838&chxp=1,1,58,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,4,3,13,14,37,63,129,226,423,608,884,1333,1803,2437,3197,3870,4752,5473,6214,6496,6947,6979,6790,6486,6071,5342,4739,4103,3430,2722,2254,1688,1254,1017,674,510,366,239,146,96,63,42,27,14,11,3,4,3&chds=0,6979&chbh=5&chxt=x&chxl=0:|min=87692|avg=95978|max=105021&chxp=0,1,48,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:43.7,13.6,11.4,9.0,5.9,4.4,3.4,2.8,0.7,0.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 197.7s|shadow_word_pain 61.4s|mind_blast 51.5s|mind_spike 40.5s|vampiric_touch 26.7s|devouring_plague 19.8s|shadow_word_death 15.5s|halo_damage 12.9s|shadowfiend 3.1s|dispersion 0.0s|waiting 2.6s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_pi_fdcl 95978
berserking 0 0.0% 3.0 180.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Attack and casting speed increased.
  • description:Increases your attack and casting speed by $s1% for $d.
devouring_plague 12932 13.5% 16.8 28.01sec 347896 294806 127702 263524 154842 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.81 16.81 0.00 0.00 1.1801 0.0000 2602205.67 2602205.67 0.00 294806.43 294806.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 13.44 79.97% 127701.95 120670 157491 127755.19 120670 137413 1716201 1716201 0.00
crit 3.36 20.01% 263524.16 248580 324432 256726.78 0 324432 886005 886005 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.850000
  • base_dd_min:1783.86
  • base_dd_max:1783.86
devouring_plague_mastery 2069 2.2% 36.9 11.47sec 25340 84608 20958 43264 25340 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 36.93 36.93 0.00 0.00 0.2995 0.0000 935764.14 935764.14 0.00 84607.97 84607.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 29.65 80.30% 20957.96 20014 26121 20957.98 20014 22563 621481 621481 0.00
crit 7.26 19.67% 43263.54 41228 53810 43223.90 0 53810 314283 314283 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.141000
  • base_dd_min:294.86
  • base_dd_max:294.86
devouring_plague_tick 7173 7.5% 16.8 28.01sec 193055 0 0 0 0 0.0% 0.0% 0.0% 0.0% 127.5 20971 43231 25443 20.1% 0.0% 20.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.81 16.81 127.51 127.51 0.0000 0.7354 3244395.54 3244395.54 0.00 34597.66 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 101.9 79.91% 20971.37 20021 49975 20971.06 20038 23186 2136887 2136887 0.00
crit 25.6 20.09% 43230.88 41243 102948 43237.58 41243 50025 1107508 1107508 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.141000
  • base_td:296.96
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3485 3.6% 11.1 42.09sec 141790 122227 117969 243817 142338 19.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.11 11.06 0.00 0.00 1.1601 0.0000 1574888.98 1574888.98 0.00 122226.54 122226.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.92 80.58% 117969.29 112598 140757 117999.16 112598 127736 1051794 1051794 0.00
crit 2.15 19.39% 243817.05 231952 289959 220276.82 0 289959 523095 523095 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9705 10.1% 41.7 10.83sec 105171 85251 86786 179096 105171 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 41.72 41.72 0.00 0.00 1.2337 0.0000 4388112.03 4388112.03 0.00 85250.75 85250.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.39 80.03% 86785.97 82915 108661 86809.91 84117 90044 2897994 2897994 0.00
crit 8.32 19.94% 179096.37 170805 223841 179098.14 0 223841 1490118 1490118 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.783000
  • base_dd_min:2513.42
  • base_dd_max:2655.57
mind_flay 19642 20.5% 119.2 3.72sec 74422 44892 0 0 0 0.0% 0.0% 0.0% 0.0% 248.3 29392 60734 35745 20.3% 0.0% 39.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 119.24 119.24 248.26 248.26 1.6578 0.7136 8874206.38 8874206.38 0.00 44891.55 44891.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 119.21 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 197.9 79.73% 29391.60 27880 36400 29397.03 28886 30091 5817663 5817663 0.00
crit 50.3 20.27% 60733.94 57433 74983 60747.20 58224 64220 3056543 3056543 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.590000
  • base_td:1206.73
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4924 5.1% 72.0 6.09sec 30909 103209 25432 52535 30909 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 71.97 71.97 0.00 0.00 0.2995 0.0000 2224566.59 2224566.59 0.00 103208.99 103208.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 57.39 79.74% 25431.66 24241 31649 25434.67 24533 26647 1459523 1459523 0.00
crit 14.56 20.23% 52535.28 49937 65196 52543.94 49937 58425 765044 765044 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6951 7.2% 34.6 12.56sec 90768 77583 74756 154463 90768 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 34.61 34.61 0.00 0.00 1.1700 0.0000 3141084.14 3141084.14 0.00 77582.54 77582.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 27.64 79.86% 74755.98 71937 94532 74766.60 71937 80357 2065906 2065906 0.00
crit 6.96 20.11% 154462.74 148190 194736 154328.41 0 194736 1075178 1075178 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.33 4.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the target with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3605 3.8% 13.2 5.56sec 123707 104897 101593 210067 123707 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.18 13.18 0.00 0.00 1.1793 0.0000 1631038.22 1631038.22 0.00 104896.66 104896.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.49 79.57% 101593.06 94128 123585 101686.14 94128 110872 1065777 1065777 0.00
crit 2.69 20.41% 210067.02 193905 254586 198964.60 0 254586 565261 565261 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.040000
  • base_dd_min:2371.48
  • base_dd_max:2371.48
shadow_word_pain 11604 12.1% 52.7 8.51sec 99551 85464 0 0 0 0.0% 0.0% 0.0% 0.0% 250.9 15924 32882 20900 29.3% 0.0% 94.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 52.67 52.67 250.89 250.89 1.1648 1.7054 5243502.91 5243502.91 0.00 10718.09 85464.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 52.66 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 177.3 70.66% 15923.69 15106 19713 15932.32 15490 16424 2822729 2822729 0.00
crit 73.6 29.34% 32881.83 31119 40608 32899.58 31661 34511 2420774 2420774 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.319000
  • base_td:677.87
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3341 3.5% 72.7 6.12sec 20773 69386 15771 32553 20773 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 72.71 72.71 0.00 0.00 0.2994 0.0000 1510325.11 1510325.11 0.00 69386.00 69386.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 51.00 70.14% 15770.80 15106 19713 15774.47 15175 16547 804263 804263 0.00
crit 21.69 29.83% 32552.93 31119 40608 32560.61 31119 35238 706062 706062 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:677.87
  • base_dd_max:677.87
shadowfiend 0 0.0% 3.0 181.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0381 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3871 4.0% 82.2 5.44sec 21298 0 18054 36198 21671 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 82.17 80.76 0.00 0.00 0.0000 0.0000 1750123.76 1750123.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 64.62 80.01% 18053.85 17249 22664 18057.69 17515 18635 1166623 1166623 0.00
crit 16.12 19.96% 36197.51 34498 45328 36206.77 34498 40802 583501 583501 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8744 9.1% 22.5 20.24sec 175956 148099 0 0 0 0.0% 0.0% 0.0% 0.0% 180.3 18073 37292 21920 20.0% 0.0% 84.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.46 22.46 180.26 180.26 1.1881 2.1155 3951432.96 3951432.96 0.00 9684.17 148099.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%