
SimulationCraft 504-4

for World of Warcraft 5.0.4 Live (build level 15972)

Beta Release

Table of Contents

Raid Summary


DPS Chart

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.72 2.33 2.97 - - - 2.33 - 1.64 1.48 1.60 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.66 2.20 2.93 - - - 2.20 - 1.61 1.55 1.61 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.64 2.24 2.91 - - - 2.24 - 1.60 1.62 1.51 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.73 2.37 2.98 - - - 2.37 - 1.63 1.59 1.60 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.68 2.01 2.91 - - - 2.01 - 1.60 1.62 1.60 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.65 2.15 2.91 - - - 2.15 - 1.60 1.37 1.51 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.76 2.32 3.00 - - - 2.32 - 1.66 1.51 1.63 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.69 2.05 2.95 - - - 2.05 - 1.62 1.57 1.60 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.69 2.17 2.94 - - - 2.17 - 1.62 1.69 1.52 - - - - - - wowhead lootrank

priest_90_di_fdcl : 99955 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99955.2 99955.2 12.61 / 0.01% 3345 / 3.3% 23.8 4082.4 3933.5 Mana 0.00% 35.7 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.72 2.33 2.97 2.33 1.64 1.48 1.60
Normalized 1.00 0.63 0.80 0.63 0.44 0.40 0.43
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery > Haste

Charts,s,333333&chd=t:177291|146819|125116|113273|101044|99894|94695|73201|73008|67409|65474|36385&chds=0,354582&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++177291++shadow_word_pain,9482C9,0,0,15|t++146819++vampiric_touch,9482C9,1,0,15|t++125116++halo_damage,9482C9,2,0,15|t++113273++devouring_plague,9482C9,3,0,15|t++101044++mind_spike,000066,4,0,15|t++99894++shadow_word_death,9482C9,5,0,15|t++94695++mind_flay_mastery,9482C9,6,0,15|t++73201++devouring_plague_mastery,9482C9,7,0,15|t++73008++mind_blast,9482C9,8,0,15|t++67409++vampiric_touch_mastery,9482C9,9,0,15|t++65474++shadow_word_pain_mastery,9482C9,10,0,15|t++36385++mind_flay,9482C9,11,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:20,10,10,10,9,9,6,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_spike|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.72,2.97,2.33,2.33,1.64,1.60,1.48|3.70,2.95,2.31,2.31,1.62,1.59,1.46|3.73,2.99,2.34,2.34,1.66,1.62,1.50&chds=0,7.43&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.72++Int,FFFFFF,0,0,15,0.1|t++++2.97++SP,FFFFFF,0,1,15,0.1|t++++2.33++Spi,FFFFFF,0,2,15,0.1|t++++2.33++Hit,FFFFFF,0,3,15,0.1|t++++1.64++Crit,FFFFFF,0,4,15,0.1|t++++1.60++Mastery,FFFFFF,0,5,15,0.1|t++++1.48++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5576778776546556631zxvusrpomlkjjiiihhiiiiiiiiiihhhhhhhhhhhhhhghghhhhhhhhhhhhgggggfffeeeeeddddddddddddccccccddddddddeeeeefffgggggghhhhhhgggggffeeeeddddddddddddddddddeeeeeeeeffffffgghhiijjjkkkkkkkkkkkkkjjiihhhhhhhhhhgggggggffffffeedddccccccccccccccddddeeffffgggggghhhhhhhhhgggffffeeeedddddcccccccccddddddeeeeeffffffgggggghhhhhhhhhhihhhhhhhhhhhhgggggggffffffffggghijkllmnooppqqqrrrrrrqqpoonnmmllkkkkjjjiiiihhhhhhggghhhhhiiijjkkklllmmmmmmmmmmmmmmmmmlllllllllllllllllllllmmmmmmmmmmmmmnnnnnnnnnnmmmmmmmmmmmmmnnnnnnnooooppppppqqqqqqppppooonnmmllkkjiihhhhgggfff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=99955|max=173717&chxp=1,1,58,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:9,4,20,38,64,116,177,317,500,770,1127,1673,2103,2705,3483,4120,4753,5520,6116,6267,6625,6583,6359,6035,5774,5091,4511,3961,3530,2677,2295,1803,1342,1038,738,555,423,251,186,129,77,57,31,13,17,6,6,3,0,2&chds=0,6625&chbh=5&chxt=x&chxl=0:|min=92623|avg=99955|max=109496&chxp=0,1,43,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:52.9,13.4,9.9,6.1,5.5,5.3,3.5,2.8,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 238.1s|mind_blast 60.4s|mind_spike 44.7s|vampiric_touch 27.3s|shadow_word_pain 24.9s|devouring_plague 23.7s|shadow_word_death 15.6s|halo_damage 12.7s|shadowfiend 3.0s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_fdcl 99955
berserking 0 0.0% 3.0 180.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5962 6.0% 20.3 23.06sec 131824 113273 110090 228185 131824 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.34 20.34 0.00 0.00 1.1638 0.0000 2681517.64 2681517.64 0.00 113273.25 113273.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.60 81.60% 110089.81 101932 143640 110114.76 102388 119160 1827265 1827265 0.00
crit 3.74 18.40% 228184.64 209981 295899 224217.54 0 295899 854253 854253 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2608 2.6% 53.5 8.40sec 21923 73201 18296 37979 21923 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 53.49 53.49 0.00 0.00 0.2995 0.0000 1172675.25 1172675.25 0.00 73200.70 73200.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 43.63 81.57% 18295.66 16899 23811 18301.15 17199 20010 798308 798308 0.00
crit 9.86 18.43% 37978.98 34812 49052 37988.25 0 49052 374368 374368 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 8313 8.3% 20.3 23.06sec 183797 0 0 0 0 0.0% 0.0% 0.0% 0.0% 171.2 18244 37818 21839 18.4% 0.0% 28.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.34 20.34 171.19 171.19 0.0000 0.7368 3738730.31 3738730.31 0.00 29640.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 20.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 139.7 81.63% 18244.07 16899 32995 18247.52 17371 19633 2549573 2549573 0.00
crit 31.4 18.37% 37818.16 34812 67969 37819.88 34984 41713 1189157 1189157 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3528 3.5% 10.9 42.62sec 145091 125116 121465 252397 145597 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.94 10.90 0.00 0.00 1.1596 0.0000 1587600.31 1587600.31 0.00 125116.27 125116.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.89 81.57% 121464.99 113382 151460 121441.45 113382 137239 1080358 1080358 0.00
crit 2.01 18.43% 252396.93 233567 312007 224661.91 0 312007 507242 507242 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9799 9.8% 52.3 8.64sec 84319 73008 70436 146097 84319 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 52.29 52.29 0.00 0.00 1.1549 0.0000 4409413.70 4409413.70 0.00 73008.37 73008.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 42.70 81.65% 70436.22 65387 92606 70451.04 67702 73724 3007589 3007589 0.00
crit 9.60 18.35% 146097.02 134696 190769 146132.46 0 182805 1401824 1401824 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 19255 19.3% 135.8 3.26sec 63790 36385 0 0 0 0.0% 0.0% 0.0% 0.0% 304.6 23749 49289 28442 18.4% 0.0% 48.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 135.80 135.80 304.57 304.57 1.7532 0.7226 8662616.17 8662616.17 0.00 36385.47 36385.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 135.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 248.6 81.63% 23749.10 22015 31036 23755.07 23228 24332 5904212 5904212 0.00
crit 56.0 18.37% 49288.86 45350 63934 49303.72 46678 52699 2758405 2758405 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6004 6.0% 95.2 4.61sec 28360 94695 23688 49131 28360 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 95.24 95.24 0.00 0.00 0.2995 0.0000 2700896.77 2700896.77 0.00 94695.21 94695.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 77.75 81.64% 23688.13 22015 31036 23693.82 22809 24842 1841790 1841790 0.00
crit 17.49 18.36% 49131.18 45350 63934 49145.66 45350 57685 859106 859106 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mind_spike 10048 10.1% 38.8 11.21sec 116656 101044 97507 202104 116656 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 38.75 38.75 0.00 0.00 1.1545 0.0000 4520406.12 4520406.12 0.00 101044.02 101044.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 31.66 81.69% 97507.14 90707 128900 97525.93 91635 106390 3086691 3086691 0.00
crit 7.09 18.31% 202103.94 186857 265535 201925.52 0 265535 1433715 1433715 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3460 3.5% 13.4 5.56sec 116423 99894 96899 201021 116423 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.37 13.37 0.00 0.00 1.1655 0.0000 1557141.70 1557141.70 0.00 99893.62 99893.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 10.87 81.25% 96899.12 87318 123950 97002.14 87318 108856 1052987 1052987 0.00
crit 2.51 18.75% 201020.92 179876 255337 187912.84 0 255337 504154 504154 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9802 9.8% 21.6 21.26sec 204503 177291 0 0 0 0.0% 0.0% 0.0% 0.0% 224.1 15095 31261 19683 28.4% 0.0% 98.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.57 21.57 224.09 224.09 1.1535 1.9757 4410641.66 4410641.66 0.00 9432.25 177290.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 21.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 160.5 71.62% 15094.69 13993 19714 15097.25 14603 15632 2422562 2422562 0.00
crit 63.6 28.38% 31261.42 28826 40611 31267.15 29510 33179 1988080 1988080 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3053 3.1% 70.1 6.34sec 19607 65474 15045 31147 19607 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 70.06 70.06 0.00 0.00 0.2995 0.0000 1373708.06 1373708.06 0.00 65473.91 65473.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.21 71.67% 15045.27 13993 19714 15048.50 14455 15996 755411 755411 0.00
crit 19.85 28.33% 31146.54 28826 40611 31154.75 28826 34804 618297 618297 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 1.0393 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3689 3.7% 75.9 5.87sec 21874 0 18768 37803 22262 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 75.89 74.57 0.00 0.00 0.0000 0.0000 1659983.58 1659983.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 60.88 81.65% 18768.48 17400 24722 18772.47 18032 19725 1142683 1142683 0.00
crit 13.68 18.35% 37803.15 34800 49444 37814.54 34800 46551 517300 517300 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8905 8.9% 23.7 19.22sec 169272 146819 0 0 0 0.0% 0.0% 0.0% 0.0% 198.4 16872 35016 20193 18.3% 0.0% 96.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 23.67 23.67 198.42 198.42 1.1529 2.1810 4006530.39 4006530.39 0.00 8709.32 146818.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 23.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 162.1 81.70% 16872.00 15675 22432 16876.61 16268 17604 2734998 2734998 0.00
crit 36.3 18.30% 35015.80 32291 46209 35026.68 32729 38158 1271532 1271532 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2784 2.8% 62.0 7.10sec 20187 67409 16876 35000 20187 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 62.04 62.04 0.00 0.00 0.2995 0.0000 1252455.79 1252455.79 0.00 67408.82 67408.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.71 81.73% 16875.58 15675 22432 16878.97 16070 17957 855699 855699 0.00
crit 11.34 18.27% 35000.31 32291 46209 35008.93 0 42687 396757 396757 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 35320 / 2746
melee 35320 2.7% 40.0 9.26sec 30572 36394 26698 54117 30572 19.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.04 40.04 0.00 0.00 0.8400 0.0000 1224183.31 1224183.31 0.00 36393.95 36393.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.46 56.08% 26698.46 19884 32223 26704.27 23163 29635 599563 599563 0.00
crit 7.97 19.91% 54116.93 39769 64447 54128.96 0 64447 431464 431464 0.00
glance 9.61 24.01% 20093.99 14913 24168 20097.74 0 24168 193156 193156 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.83 5.83 0.00 0.00 1.0661 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 20.3 61.0 3.0 3.0 43941.4
halo_damage Mana 10.9 492394.5 45000.0 45000.0 3.2
mind_blast Mana 52.3 336160.9 6428.2 6428.2 13.1
mind_flay Mana 135.8 407400.1 3000.0 3000.0 21.3
shadow_word_death Mana 13.4 104323.5 7800.0 7800.0 14.9
shadow_word_pain Mana 21.6 284692.3 13200.0 13200.0 15.5
vampiric_touch Mana 23.7 213022.2 9000.0 9000.0 18.8
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1800.39 465652.92 258.64 74464.58 13.79%
shadowfiend Mana 40.04 158597.05 3960.74 201783.55 55.99%
Shadow Orbs from Mind Blast Shadow Orb 52.29 52.29 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.85 6.85 1.00 0.00 0.00%
Devouring Plague Health Health 224.68 0.00 0.00 3120086.44 100.00%
Vampiric Touch Mana Mana 260.46 1146715.37 4402.69 229906.48 16.70%
Resource RPS-Gain RPS-Loss
Mana 3933.53 4082.41
Shadow Orb 0.13 0.14
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.62% 11.42%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.49%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.1 0.6 29.9sec 28.6sec 5.99% 26.82%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.0%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.7sec 62.7sec 33.18% 33.18%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.2%
glyph_mind_spike 28.5 10.2 15.3sec 11.2sec 32.33% 37.28%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:24.9%
  • glyph_mind_spike_2:7.4%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 420.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.7sec 53.7sec 23.14% 23.06%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
relic_of_yulon 9.1 0.0 52.0sec 52.0sec 29.92% 29.92%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.9%
shadow_word_death_reset_cooldown 6.9 0.0 11.5sec 11.5sec 8.75% 48.76%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.8%
surge_of_darkness 35.3 3.8 12.4sec 11.2sec 15.02% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:14.2%
  • surge_of_darkness_2:0.9%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.38% 17.38%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.8 0.0 74.0sec 74.0sec 83.36% 78.87%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 11.4%
shadowfiend-Mana Cap 11.4%
lightwell-Mana Cap 11.4%


Count Interval
Shadowy Recall Extra Tick 280.8 1.6sec
Shadowy Apparition Procced 75.9 5.9sec
Divine Insight Mind Blast CD Reset 14.7 28.6sec
FDCL Mind Spike proc 39.1 11.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 450.22
Minimum 348.45
Maximum 553.69
Spread ( max - min ) 205.24
Range [ ( max - min ) / 2 * 100% ] 22.79%


Sample Data
Count 100000
Mean 99955.22
Minimum 92623.45
Maximum 109495.86
Spread ( max - min ) 16872.41
Range [ ( max - min ) / 2 * 100% ] 8.44%
Standard Deviation 2035.0778
5th Percentile 96705.59
95th Percentile 103396.39
( 95th Percentile - 5th Percentile ) 6690.80
Mean Distribution
Standard Deviation 6.4355
95.00% Confidence Intervall ( 99942.61 - 99967.83 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1592
0.1 Scale Factor Error with Delta=300 35354
0.05 Scale Factor Error with Delta=300 141418
0.01 Scale Factor Error with Delta=300 3535458
Distribution Chart


Sample Data
Count 100000
Mean 99955.22


Sample Data
Count 100000
Mean 43734317.46


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 268.25
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.33, SpellDamage=2.97, HitRating=2.33, CritRating=1.64, HasteRating=1.48, MasteryRating=1.60 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.33, SpellDamage=2.97, HitRating=0.00, CritRating=1.64, HasteRating=1.48, MasteryRating=1.60 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.33, SpellDamage=2.97, HitRating=2.33, CritRating=1.64, HasteRating=1.48, MasteryRating=1.60 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.33, SpellDamage=2.97, HitRating=0.00, CritRating=1.64, HasteRating=1.48, MasteryRating=1.60 )

priest_90_di_mb : 98571 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
98570.7 98570.7 11.12 / 0.01% 2953 / 3.0% 21.8 4209.3 4142.1 Mana 0.00% 30.9 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.66 2.20 2.93 2.20 1.61 1.55 1.61
Normalized 1.00 0.60 0.80 0.60 0.44 0.42 0.44
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit = Mastery > Haste

Charts,s,333333&chd=t:176728|146476|125597|113316|99713|94639|73257|72993|67416|65448|36835&chds=0,353457&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++176728++shadow_word_pain,9482C9,0,0,15|t++146476++vampiric_touch,9482C9,1,0,15|t++125597++halo_damage,9482C9,2,0,15|t++113316++devouring_plague,9482C9,3,0,15|t++99713++shadow_word_death,9482C9,4,0,15|t++94639++mind_flay_mastery,9482C9,5,0,15|t++73257++devouring_plague_mastery,9482C9,6,0,15|t++72993++mind_blast,9482C9,7,0,15|t++67416++vampiric_touch_mastery,9482C9,8,0,15|t++65448++shadow_word_pain_mastery,9482C9,9,0,15|t++36835++mind_flay,9482C9,10,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:25,11,10,10,9,8,8,6,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|mindbender: melee|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.66,2.93,2.20,2.20,1.61,1.61,1.55|3.64,2.91,2.18,2.18,1.60,1.60,1.53|3.67,2.94,2.21,2.21,1.63,1.63,1.56&chds=0,7.31&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.66++Int,FFFFFF,0,0,15,0.1|t++++2.93++SP,FFFFFF,0,1,15,0.1|t++++2.20++Spi,FFFFFF,0,2,15,0.1|t++++2.20++Hit,FFFFFF,0,3,15,0.1|t++++1.61++Crit,FFFFFF,0,4,15,0.1|t++++1.61++Mastery,FFFFFF,0,5,15,0.1|t++++1.55++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:55667777776676677420ywvtsqpnlkiihhhggggghhhhhgggggggggfggffffgghhhijjkllllllkkllkjihggffeedccccccccbbbbbbbbccccccccccddddeefgghhiijjkkkkkkkkjiihhggffeedddcccccccccddeeeeeeddeeeeeeeffffffgghhiijjkkkkkjkkkjkkkkjjjiihhggffffeeeeddcccbbbbaaabbbbbbbbccddeffghhiijjkklllllllkkjiihggffeeddcccccbbbbbbbcccccccccddddeeeeffghhijjkklllmmmmmllllkkjjiihhgggffffeeeeeeeeeeffggghhiiijjkklmmnnooooppoooooooonnnmllkkjiihhhgggggggggghhhiijjjkkkkllllmmmmnnnnnnoooooooooppppooooonnnnnmmmmmmmmmmllllllllllllllllllmmmmnnooopppqqrrrsssttttttsssrrrqqppoonnmmlllkkjjihhhhgggggff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=98571|max=170646&chxp=1,1,58,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,8,11,32,46,97,173,282,476,702,1038,1533,1991,2641,3460,4102,4645,5500,6082,6549,6745,6822,6574,6278,5777,5162,4693,3939,3316,2733,2179,1722,1344,996,745,496,366,229,199,110,81,52,25,24,4,5,5,4,3&chds=0,6822&chbh=5&chxt=x&chxl=0:|min=91666|avg=98571|max=106836&chxp=0,1,46,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:61.6,13.1,6.2,5.6,5.2,3.6,2.8,1.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 277.6s|mind_blast 58.9s|vampiric_touch 27.7s|shadow_word_pain 25.1s|devouring_plague 23.3s|shadow_word_death 16.4s|halo_damage 12.8s|mindbender 8.5s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_mb 98571
berserking 0 0.0% 3.0 180.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.98 2.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5869 6.0% 20.0 23.48sec 131859 113316 110131 228286 131859 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 0.00 0.00 1.1636 0.0000 2639930.99 2639930.99 0.00 113316.35 113316.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.34 81.61% 110131.39 101932 143640 110157.31 101932 120311 1799455 1799455 0.00
crit 3.68 18.39% 228285.88 209981 295899 223841.90 0 295899 840476 840476 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2569 2.6% 52.7 8.54sec 21938 73257 18306 38007 21938 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 52.66 52.66 0.00 0.00 0.2995 0.0000 1155185.80 1155185.80 0.00 73256.76 73256.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 42.95 81.56% 18306.39 16899 23811 18312.27 17138 19870 786217 786217 0.00
crit 9.71 18.44% 38006.63 34812 49052 38013.10 0 49052 368969 368969 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 8185 8.3% 20.0 23.48sec 183866 0 0 0 0 0.0% 0.0% 0.0% 0.0% 168.5 18251 37833 21848 18.4% 0.0% 27.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 20.02 20.02 168.49 168.49 0.0000 0.7364 3681146.84 3681146.84 0.00 29669.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 20.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 137.5 81.63% 18250.82 16899 36171 18254.60 17352 19691 2510294 2510294 0.00
crit 30.9 18.37% 37833.02 34812 74512 37835.78 35045 42788 1170853 1170853 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3570 3.6% 11.1 42.15sec 145344 125597 121606 252632 145879 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.05 11.01 0.00 0.00 1.1572 0.0000 1606504.90 1606504.90 0.00 125596.51 125596.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.97 81.47% 121605.74 113382 151460 121599.07 113382 134397 1091106 1091106 0.00
crit 2.04 18.53% 252631.54 233567 312007 225442.89 0 312007 515399 515399 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9559 9.7% 51.0 8.86sec 84284 72993 70410 146017 84284 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.03 51.03 0.00 0.00 1.1547 0.0000 4301258.27 4301258.27 0.00 72993.00 72993.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.67 81.65% 70410.21 65387 92606 70425.11 68052 73360 2933853 2933853 0.00
crit 9.36 18.35% 146016.81 134696 190769 146060.87 0 182805 1367405 1367405 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 22728 23.1% 154.4 2.87sec 66211 36835 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 23727 49248 28414 18.4% 0.0% 57.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 154.41 154.41 359.81 359.81 1.7975 0.7230 10223620.58 10223620.58 0.00 36835.11 36835.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 154.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 293.7 81.64% 23727.38 22015 31036 23732.84 23345 24209 6969656 6969656 0.00
crit 66.1 18.36% 49248.47 45350 63934 49262.72 47249 52370 3253964 3253964 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 7091 7.2% 112.5 3.91sec 28343 94639 23677 49117 28343 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 112.54 112.54 0.00 0.00 0.2995 0.0000 3189704.14 3189704.14 0.00 94638.74 94638.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 91.89 81.66% 23676.50 22015 31036 23681.76 22787 24776 2175747 2175747 0.00
crit 20.64 18.34% 49117.48 45350 63934 49131.31 45350 55668 1013957 1013957 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mindbender 0 0.0% 7.6 62.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 7.63 7.63 0.00 0.00 1.1130 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 7.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3638 3.7% 14.1 5.30sec 116289 99713 96887 200999 116289 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 14.08 14.08 0.00 0.00 1.1662 0.0000 1637393.39 1637393.39 0.00 99713.38 99713.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.46 81.36% 96887.30 87318 123950 96986.59 87318 108925 1109977 1109977 0.00
crit 2.62 18.64% 200999.47 179876 255337 189365.99 0 255337 527417 527417 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9854 10.0% 21.7 21.11sec 204203 176728 0 0 0 0.0% 0.0% 0.0% 0.0% 225.3 15087 31243 19671 28.4% 0.0% 98.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 225.35 225.35 1.1555 1.9762 4432880.96 4432880.96 0.00 9423.40 176728.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 21.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 161.4 71.63% 15087.47 13993 19714 15091.78 14611 15674 2435269 2435269 0.00
crit 63.9 28.37% 31243.43 28826 40611 31252.97 29713 33214 1997612 1997612 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3069 3.1% 70.5 6.31sec 19596 65448 15041 31136 19596 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 70.46 70.46 0.00 0.00 0.2994 0.0000 1380683.60 1380683.60 0.00 65447.65 65447.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.52 71.70% 15040.63 13993 19714 15043.95 14357 15946 759789 759789 0.00
crit 19.94 28.30% 31136.24 28826 40611 31143.55 28826 35028 620894 620894 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3701 3.8% 76.1 5.86sec 21872 0 18765 37796 22258 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 76.14 74.82 0.00 0.00 0.0000 0.0000 1665295.57 1665295.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 61.09 81.65% 18764.72 17400 24722 18768.78 17975 19652 1146277 1146277 0.00
crit 13.73 18.35% 37796.34 34800 49444 37805.89 34800 45070 519019 519019 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9023 9.2% 24.0 18.94sec 169029 146476 0 0 0 0.0% 0.0% 0.0% 0.0% 201.2 16861 34979 20174 18.3% 0.0% 97.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 24.02 24.02 201.23 201.23 1.1540 2.1794 4059591.72 4059591.72 0.00 8706.36 146476.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 24.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 164.4 81.71% 16861.15 15675 22432 16865.32 16374 17497 2772526 2772526 0.00
crit 36.8 18.29% 34979.39 32291 46209 34989.33 32612 38133 1287066 1287066 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2824 2.9% 62.9 7.00sec 20190 67416 16871 34990 20190 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 62.92 62.92 0.00 0.00 0.2995 0.0000 1270378.04 1270378.04 0.00 67415.52 67415.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 51.40 81.68% 16871.29 15675 22432 16874.40 16067 17839 867135 867135 0.00
crit 11.52 18.32% 34990.14 32291 46209 34997.83 0 42072 403243 403243 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 27552 / 6889
melee 27552 7.0% 115.9 3.70sec 26699 28149 23599 47765 26699 18.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 115.94 115.94 0.00 0.00 0.9485 0.0000 3095494.52 3095494.52 0.00 28149.05 28149.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 66.54 57.39% 23599.46 19058 31273 23612.71 22219 25397 1570213 1570213 0.00
crit 21.60 18.63% 47765.49 38116 62546 47795.88 42567 54925 1031565 1031565 0.00
glance 27.81 23.99% 17754.03 14294 23455 17764.43 15943 20029 493717 493717 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:262.33
  • base_dd_max:262.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 22.6 19.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.57 22.57 0.00 0.00 1.0939 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 22.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 20.0 60.1 3.0 3.0 43953.0
halo_damage Mana 11.1 497389.5 45000.0 45000.0 3.2
mind_blast Mana 51.0 321989.9 6309.5 6309.5 13.4
mind_flay Mana 154.4 463229.3 3000.0 3000.0 22.1
shadow_word_death Mana 14.1 109826.7 7800.0 7800.0 14.9
shadow_word_pain Mana 21.7 286548.1 13200.0 13200.0 15.5
vampiric_touch Mana 24.0 216154.1 9000.0 9000.0 18.8
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1800.39 404961.76 224.93 135155.74 25.02%
mindbender Mana 115.94 476126.50 4106.62 915167.06 65.78%
Shadow Orbs from Mind Blast Shadow Orb 51.03 51.03 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.13 7.13 1.00 0.00 0.00%
Devouring Plague Health Health 221.15 0.00 0.00 3070992.83 100.00%
Vampiric Touch Mana Mana 264.15 983795.97 3724.39 412334.97 29.53%
Resource RPS-Gain RPS-Loss
Mana 4142.13 4209.33
Shadow Orb 0.13 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.62% 7.19%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.05%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.1 0.7 29.8sec 28.4sec 6.55% 27.51%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.5%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.7sec 62.7sec 33.16% 33.16%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.2%
jade_serpent_potion 2.0 0.0 420.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.7sec 53.7sec 23.18% 23.07%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.2%
relic_of_yulon 9.1 0.0 51.9sec 51.9sec 29.95% 29.95%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.0%
shadow_word_death_reset_cooldown 7.1 0.0 11.1sec 11.1sec 9.11% 49.39%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.1%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.37% 17.37%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
mindbender-shadowcrawl 22.6 0.0 19.6sec 19.6sec 85.38% 84.01%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.3%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 10.7%
shadowfiend-Mana Cap 10.7%
lightwell-Mana Cap 10.7%


Count Interval
Shadowy Recall Extra Tick 298.6 1.5sec
Shadowy Apparition Procced 76.1 5.9sec
Divine Insight Mind Blast CD Reset 14.8 28.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 450.22
Minimum 348.45
Maximum 553.69
Spread ( max - min ) 205.24
Range [ ( max - min ) / 2 * 100% ] 22.79%


Sample Data
Count 100000
Mean 98570.70
Minimum 91666.41
Maximum 106836.27
Spread ( max - min ) 15169.86
Range [ ( max - min ) / 2 * 100% ] 7.69%
Standard Deviation 1794.4342
5th Percentile 95712.31
95th Percentile 101618.34
( 95th Percentile - 5th Percentile ) 5906.03
Mean Distribution
Standard Deviation 5.6745
95.00% Confidence Intervall ( 98559.58 - 98581.82 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1273
0.1 Scale Factor Error with Delta=300 27487
0.05 Scale Factor Error with Delta=300 109950
0.01 Scale Factor Error with Delta=300 2748772
Distribution Chart


Sample Data
Count 100000
Mean 98570.70


Sample Data
Count 100000
Mean 41243574.79


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 231.68
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
E shadow_word_death,if=num_targets<=4
F vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
G halo_damage
H mindbender,if=cooldown_react
I mind_sear,chain=1,interrupt=1,if=num_targets>=2
J mind_flay,chain=1,interrupt=1
K shadow_word_death,moving=1
L mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
M shadow_word_pain,moving=1
N dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=3.66, Spirit=2.20, SpellDamage=2.93, HitRating=2.20, CritRating=1.61, HasteRating=1.55, MasteryRating=1.61 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=3.66, Spirit=2.20, SpellDamage=2.93, HitRating=0.00, CritRating=1.61, HasteRating=1.55, MasteryRating=1.61 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=3.66, Spirit=2.20, SpellDamage=2.93, HitRating=2.20, CritRating=1.61, HasteRating=1.55, MasteryRating=1.61 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=3.66, Spirit=2.20, SpellDamage=2.93, HitRating=0.00, CritRating=1.61, HasteRating=1.55, MasteryRating=1.61 )

priest_90_di_swi : 98046 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
98046.2 98046.2 11.78 / 0.01% 3121 / 3.2% 20.9 4564.7 4344.6 Mana 0.00% 32.4 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.64 2.24 2.91 2.24 1.60 1.62 1.51
Normalized 1.00 0.62 0.80 0.62 0.44 0.45 0.42
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Haste > Crit > Mastery

Charts,s,333333&chd=t:146486|144722|142860|125966|113318|99767|94732|73301|73002|67453|65491|36991&chds=0,292972&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++146486++vampiric_touch,9482C9,0,0,15|t++144722++shadow_word_pain,9482C9,1,0,15|t++142860++shadow_word_insanity,9482C9,2,0,15|t++125966++halo_damage,9482C9,3,0,15|t++113318++devouring_plague,9482C9,4,0,15|t++99767++shadow_word_death,9482C9,5,0,15|t++94732++mind_flay_mastery,9482C9,6,0,15|t++73301++devouring_plague_mastery,9482C9,7,0,15|t++73002++mind_blast,9482C9,8,0,15|t++67453++vampiric_touch_mastery,9482C9,9,0,15|t++65491++shadow_word_pain_mastery,9482C9,10,0,15|t++36991++mind_flay,9482C9,11,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:22,10,9,9,9,8,7,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|vampiric_touch|shadow_word_pain|shadow_word_insanity|devouring_plague_tick|mind_flay_mastery|devouring_plague|halo_damage|shadow_word_death|shadowy_apparition|vampiric_touch_mastery|shadow_word_pain_mastery|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.64,2.91,2.24,2.24,1.62,1.60,1.51|3.62,2.89,2.22,2.22,1.60,1.58,1.50|3.66,2.92,2.26,2.26,1.64,1.62,1.53&chds=0,7.28&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.64++Int,FFFFFF,0,0,15,0.1|t++++2.91++SP,FFFFFF,0,1,15,0.1|t++++2.24++Spi,FFFFFF,0,2,15,0.1|t++++2.24++Hit,FFFFFF,0,3,15,0.1|t++++1.62++Haste,FFFFFF,0,4,15,0.1|t++++1.60++Crit,FFFFFF,0,5,15,0.1|t++++1.51++Mastery,FFFFFF,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5576778777767556621zxvurqpnmkkjihhhghhhhhhhhhhhhiiihgghhhhggggggggghhhggggggggggggffffffeddddccccddccccccdddddddddddddeefffgggggggggggggggggfeeeeedddddddddddddddeefffffffeeeefffffghhiiiijjjkkkkkkkkkkkjjiiihhgggggggggggggggffeeddddcccccccccccccdddddeeeeffffggggghhggggggggggffffffeeedddddddddddddddddddddeeeeeeeeefffgggghhhhhhhiiiiiiiiiiiihhhhhggggffffeeeeffffghijjklmnoopqqrrrsssrrrqpponnmlllkkjjjiiiiihhhhhhhhhhhhiiijjjkkkllllmmmmmmmmmmmmlllllllllllllmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmnnnnnnnnnnnoooooooppppppppppppppppppooonnnmmmlllkkjjiiiiihhhh&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=98046|max=170852&chxp=1,1,57,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,7,10,9,43,67,143,184,312,487,730,1047,1501,2057,2832,3429,4076,4803,5479,6038,6411,6645,6714,6315,6126,5634,5179,4494,3798,3457,2729,2260,1803,1417,1047,823,577,458,297,202,131,82,58,31,19,17,11,5,3&chds=0,6714&chbh=5&chxt=x&chxl=0:|min=90577|avg=98046|max=106281&chxp=0,1,48,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:57.2,12.8,6.0,6.0,5.8,5.1,3.6,2.9,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 257.5s|mind_blast 57.5s|shadow_word_pain 27.2s|vampiric_touch 27.1s|shadow_word_insanity 26.3s|devouring_plague 22.8s|shadow_word_death 16.1s|halo_damage 12.9s|shadowfiend 3.1s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_swi 98046
berserking 0 0.0% 3.0 181.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.98 2.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5739 5.9% 19.6 24.04sec 131832 113318 110084 228198 131832 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.58 19.58 0.00 0.00 1.1634 0.0000 2581158.76 2581158.76 0.00 113318.06 113318.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.97 81.59% 110083.94 101932 143640 110108.65 102744 119785 1758491 1758491 0.00
crit 3.61 18.41% 228197.50 209981 295899 223563.95 0 295899 822668 822668 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2512 2.6% 51.5 8.74sec 21951 73301 18315 38019 21951 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.46 51.46 0.00 0.00 0.2995 0.0000 1129566.87 1129566.87 0.00 73300.90 73300.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.97 81.55% 18315.23 16899 23811 18321.17 17083 20123 768606 768606 0.00
crit 9.49 18.45% 38019.41 34812 49052 38026.09 0 49052 360961 360961 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 7995 8.2% 19.6 24.04sec 183637 0 0 0 0 0.0% 0.0% 0.0% 0.0% 164.6 18242 37811 21839 18.4% 0.0% 27.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.58 19.58 164.63 164.63 0.0000 0.7373 3595463.99 3595463.99 0.00 29620.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 134.4 81.62% 18242.41 16899 34712 18246.19 17387 19600 2451248 2451248 0.00
crit 30.3 18.38% 37810.65 34812 71506 37813.90 35024 43420 1144216 1144216 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3600 3.7% 11.1 41.87sec 145652 125966 121830 252987 146180 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.12 11.08 0.00 0.00 1.1563 0.0000 1619287.03 1619287.03 0.00 125965.54 125965.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.02 81.43% 121830.17 113382 151460 121845.19 113382 138976 1099004 1099004 0.00
crit 2.06 18.57% 252986.85 233567 312007 226363.08 0 312007 520283 520283 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9323 9.5% 49.8 9.08sec 84259 73002 70395 145989 84259 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 49.79 49.79 0.00 0.00 1.1542 0.0000 4195275.32 4195275.32 0.00 73001.94 73001.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.66 81.66% 70394.67 65387 92606 70409.65 67840 73382 2862110 2862110 0.00
crit 9.13 18.34% 145988.81 134696 190769 146029.72 0 190769 1333165 1333165 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 21178 21.6% 143.2 3.10sec 66541 36991 0 0 0 0.0% 0.0% 0.0% 0.0% 334.7 23766 49329 28464 18.4% 0.0% 53.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 143.16 143.16 334.68 334.68 1.7989 0.7220 9526331.25 9526331.25 0.00 36990.86 36990.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 143.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 273.2 81.62% 23765.74 22015 31036 23771.85 23354 24251 6491925 6491925 0.00
crit 61.5 18.38% 49328.72 45350 63934 49344.27 46893 52668 3034407 3034407 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6600 6.7% 104.6 4.20sec 28369 94732 23700 49159 28369 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 104.65 104.65 0.00 0.00 0.2995 0.0000 2968805.77 2968805.77 0.00 94731.99 94731.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 85.45 81.66% 23700.18 22015 31036 23705.90 22893 24710 2025295 2025295 0.00
crit 19.19 18.34% 49159.13 45350 63934 49173.87 45350 56649 943511 943511 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
shadow_word_death 3563 3.6% 13.8 5.39sec 116335 99767 96871 200919 116335 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.78 13.78 0.00 0.00 1.1661 0.0000 1603255.88 1603255.88 0.00 99767.01 99767.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.20 81.29% 96871.02 87318 123950 96968.37 88895 109919 1085283 1085283 0.00
crit 2.58 18.71% 200918.95 179876 255337 188926.28 0 255337 517973 517973 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 8335 8.5% 22.6 19.41sec 165742 142860 138639 287011 165742 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 22.65 22.65 0.00 0.00 1.1602 0.0000 3753510.20 3753510.20 0.00 142860.25 142860.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.51 81.73% 138638.61 129668 184234 138639.09 130959 146816 2566178 2566178 0.00
crit 4.14 18.27% 287011.40 267117 379523 283566.06 0 379523 1187332 1187332 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.430000
  • base_dd_min:2481.02
  • base_dd_max:2618.71
shadow_word_pain 8744 8.9% 23.6 19.43sec 167056 144722 0 0 0 0.0% 0.0% 0.0% 0.0% 200.6 15047 31170 19614 28.3% 0.0% 85.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 23.55 23.55 200.59 200.59 1.1543 1.9289 3934416.92 3934416.92 0.00 9500.97 144722.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 23.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 143.8 71.67% 15046.91 13993 19714 15048.92 14520 15636 2163306 2163306 0.00
crit 56.8 28.33% 31169.86 28826 40611 31174.72 29588 33379 1771110 1771110 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2733 2.8% 62.7 7.08sec 19617 65491 15051 31164 19617 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 62.68 62.68 0.00 0.00 0.2995 0.0000 1229587.12 1229587.12 0.00 65490.66 65490.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 44.92 71.66% 15051.15 13993 19714 15054.71 14302 16093 676096 676096 0.00
crit 17.76 28.34% 31163.68 28826 40611 31172.55 28826 35294 553491 553491 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.94 2.94 0.00 0.00 1.0389 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3388 3.5% 69.7 6.40sec 21885 0 18780 37831 22276 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 69.67 68.45 0.00 0.00 0.0000 0.0000 1524819.76 1524819.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 55.89 81.65% 18780.31 17400 24722 18784.89 17933 19712 1049686 1049686 0.00
crit 12.56 18.35% 37830.83 34800 49444 37843.51 0 45883 475134 475134 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8828 9.0% 23.5 19.37sec 169018 146486 0 0 0 0.0% 0.0% 0.0% 0.0% 196.7 16873 35041 20196 18.3% 0.0% 95.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 23.50 23.50 196.71 196.71 1.1538 2.1870 3972701.08 3972701.08 0.00 8687.13 146486.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 23.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 160.7 81.71% 16872.62 15675 22432 16875.68 16217 17644 2711803 2711803 0.00
crit 36.0 18.29% 35041.35 32291 46209 35049.32 32642 39113 1260898 1260898 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2761 2.8% 61.5 7.16sec 20203 67453 16886 35015 20203 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 61.50 61.50 0.00 0.00 0.2995 0.0000 1242421.48 1242421.48 0.00 67453.25 67453.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.25 81.71% 16886.31 15675 22432 16889.93 15926 17881 848505 848505 0.00
crit 11.25 18.29% 35015.01 32291 46209 35023.89 0 42687 393916 393916 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 35290 / 2746
melee 35290 2.8% 40.0 9.27sec 30589 36380 26703 54129 30589 19.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.02 40.02 0.00 0.00 0.8408 0.0000 1224122.77 1224122.77 0.00 36380.25 36380.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.44 56.07% 26703.37 19884 32223 26709.07 23272 29751 599200 599200 0.00
crit 7.98 19.94% 54128.80 39769 64447 54141.53 0 64447 431980 431980 0.00
glance 9.60 23.99% 20100.92 14913 24168 20105.39 0 24168 192943 192943 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.83 5.83 0.00 0.00 1.0655 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 19.6 58.7 3.0 3.0 43944.0
halo_damage Mana 11.1 500287.5 45000.0 45000.0 3.2
mind_blast Mana 49.8 325572.6 6538.9 6538.9 12.9
mind_flay Mana 143.2 429492.1 3000.0 3000.0 22.2
shadow_word_death Mana 13.8 107494.9 7800.0 7800.0 14.9
shadow_word_insanity Mana 22.6 169850.4 7500.0 7500.0 22.1
shadow_word_pain Mana 23.6 310879.3 13200.0 13200.0 12.7
vampiric_touch Mana 23.5 211541.0 9000.0 9000.0 18.8
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1800.39 503988.61 279.93 36128.89 6.69%
shadowfiend Mana 40.02 203638.93 5088.63 156526.85 43.46%
Shadow Orbs from Mind Blast Shadow Orb 49.79 49.79 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.06 7.06 1.00 0.00 0.00%
Devouring Plague Health Health 216.09 0.00 0.00 3000786.99 100.00%
Vampiric Touch Mana Mana 258.20 1248423.06 4835.04 116302.38 8.52%
Resource RPS-Gain RPS-Loss
Mana 4344.62 4564.67
Shadow Orb 0.13 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.61% 12.15%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.79%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 12.7 0.5 33.0sec 31.7sec 6.09% 25.27%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.1%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.8sec 62.8sec 33.12% 33.12%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.1%
jade_serpent_potion 2.0 0.0 420.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.8sec 53.8sec 23.11% 23.18%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
relic_of_yulon 9.1 0.0 52.0sec 52.0sec 29.90% 29.90%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.9%
shadow_word_death_reset_cooldown 7.1 0.0 11.1sec 11.1sec 9.01% 48.80%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.0%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.39% 17.39%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.8 0.0 74.0sec 74.0sec 83.37% 78.92%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
lightwell-Mana Cap 6.4%


Count Interval
Shadowy Recall Extra Tick 280.3 1.6sec
Shadowy Apparition Procced 69.7 6.4sec
Divine Insight Mind Blast CD Reset 13.2 31.7sec
Shadow Word: Insanity removed DoTs 22.6 19.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 450.22
Minimum 348.45
Maximum 553.69
Spread ( max - min ) 205.24
Range [ ( max - min ) / 2 * 100% ] 22.79%


Sample Data
Count 100000
Mean 98046.23
Minimum 90577.09
Maximum 106281.49
Spread ( max - min ) 15704.39
Range [ ( max - min ) / 2 * 100% ] 8.01%
Standard Deviation 1900.6960
5th Percentile 95050.29
95th Percentile 101291.55
( 95th Percentile - 5th Percentile ) 6241.26
Mean Distribution
Standard Deviation 6.0105
95.00% Confidence Intervall ( 98034.45 - 98058.01 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1443
0.1 Scale Factor Error with Delta=300 30839
0.05 Scale Factor Error with Delta=300 123358
0.01 Scale Factor Error with Delta=300 3083961
Distribution Chart


Sample Data
Count 100000
Mean 98046.23


Sample Data
Count 100000
Mean 42876601.43


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 242.92
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B shadow_word_insanity,if=num_targets<=4
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|ticks_remain<1)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=3.64, Spirit=2.24, SpellDamage=2.91, HitRating=2.24, CritRating=1.60, HasteRating=1.62, MasteryRating=1.51 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=3.64, Spirit=2.24, SpellDamage=2.91, HitRating=0.00, CritRating=1.60, HasteRating=1.62, MasteryRating=1.51 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=3.64, Spirit=2.24, SpellDamage=2.91, HitRating=2.24, CritRating=1.60, HasteRating=1.62, MasteryRating=1.51 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=3.64, Spirit=2.24, SpellDamage=2.91, HitRating=0.00, CritRating=1.60, HasteRating=1.62, MasteryRating=1.51 )

priest_90_pi_fdcl : 100331 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
100330.5 100330.5 12.07 / 0.01% 3194 / 3.2% 23.4 4166.0 4006.0 Mana 0.00% 35.5 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.73 2.37 2.98 2.37 1.63 1.59 1.60
Normalized 1.00 0.63 0.80 0.63 0.44 0.43 0.43
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery = Haste

Charts,s,333333&chd=t:185165|152601|128197|113872|102274|101262|94702|73478|73012|67610|65582|37313&chds=0,370330&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++185165++shadow_word_pain,9482C9,0,0,15|t++152601++vampiric_touch,9482C9,1,0,15|t++128197++halo_damage,9482C9,2,0,15|t++113872++devouring_plague,9482C9,3,0,15|t++102274++mind_spike,000066,4,0,15|t++101262++shadow_word_death,9482C9,5,0,15|t++94702++mind_flay_mastery,9482C9,6,0,15|t++73478++mind_blast,9482C9,7,0,15|t++73012++devouring_plague_mastery,9482C9,8,0,15|t++67610++vampiric_touch_mastery,9482C9,9,0,15|t++65582++shadow_word_pain_mastery,9482C9,10,0,15|t++37313++mind_flay,9482C9,11,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,11,10,9,9,8,7,6,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_spike|shadow_word_pain|vampiric_touch|mind_blast|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.73,2.98,2.37,2.37,1.63,1.60,1.59|3.72,2.97,2.35,2.35,1.61,1.58,1.57|3.75,3.00,2.38,2.38,1.65,1.62,1.60&chds=0,7.47&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.73++Int,FFFFFF,0,0,15,0.1|t++++2.98++SP,FFFFFF,0,1,15,0.1|t++++2.37++Spi,FFFFFF,0,2,15,0.1|t++++2.37++Hit,FFFFFF,0,3,15,0.1|t++++1.63++Crit,FFFFFF,0,4,15,0.1|t++++1.60++Mastery,FFFFFF,0,5,15,0.1|t++++1.59++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5577787665546556621ywutrqomlkjjihfeeeeeeeffffggggggggggghhgggffeeddddddeefffffgggffffeeeedccbaaZZaaaaabbccddddddddeeeeeeeeeeeeeefgghhiiijiiiihggffeedccbaaaaaabbcddeefffffffffffeeeeeeeeeffghhiijjjjjjjjjihhggffeedddddddeeefffffeeedddcccbbbaaaaaaabccdefghhiiiiijjjiiiihggffeedddddeeeeddddddcccccccbbaaaaaabbccddeeefffffggggggggffffffffffffggggggggfffffeeedddddddefgijkmnopqrrssttttttssrqonmmlkkjjjiiiihhhhgggggffffffffffggghhiijjkkkklllllllllkkkkkkjjjjjjjjjjkkkkkkkkkkkkkkkkkkkkkkllllmmmmnnnnnooooooooppppoooooooooooooooooooooooonnnmmmllkkkjjiihgggffeeeddd&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=553|1:|0|avg=100331|max=179606&chxp=1,1,56,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,10,21,33,66,112,189,343,551,857,1263,1900,2482,3265,4032,4833,5519,6127,6736,6959,7049,6828,6426,6061,5289,4688,3996,3363,2735,2164,1673,1261,931,697,490,364,226,172,107,69,41,19,16,13,8,4,2,0,0,2&chds=0,7049&chbh=5&chxt=x&chxl=0:|min=93229|avg=100331|max=110239&chxp=0,1,42,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:54.9,11.9,10.1,6.0,5.5,4.7,3.5,2.8,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 247.3s|mind_blast 53.5s|mind_spike 45.3s|vampiric_touch 27.0s|shadow_word_pain 24.7s|devouring_plague 21.4s|shadow_word_death 15.7s|halo_damage 12.5s|shadowfiend 3.0s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_pi_fdcl 100331
berserking 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5410 5.4% 18.5 25.45sec 131398 113872 109772 227502 131398 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.52 18.52 0.00 0.00 1.1539 0.0000 2434003.79 2434003.79 0.00 113871.52 113871.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.12 81.63% 109771.69 101932 143640 109763.04 102672 117348 1659866 1659866 0.00
crit 3.40 18.37% 227502.09 209981 295899 221700.21 0 295899 774137 774137 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2400 2.4% 49.4 9.10sec 21868 73012 18252 37902 21868 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 49.38 49.38 0.00 0.00 0.2995 0.0000 1079853.34 1079853.34 0.00 73012.40 73012.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.29 81.60% 18251.60 16899 23811 18252.62 17107 19707 735417 735417 0.00
crit 9.09 18.40% 37901.75 34812 49052 37901.17 0 49052 344436 344436 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 7631 7.6% 18.5 25.45sec 185409 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.0 18165 37643 21733 18.3% 0.0% 25.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.52 18.52 158.03 158.03 0.0000 0.7217 3434485.00 3434485.00 0.00 30114.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 18.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 129.1 81.68% 18165.31 16899 23811 18162.97 17442 18924 2344909 2344909 0.00
crit 28.9 18.32% 37642.92 34812 49052 37635.25 35073 41122 1089576 1089576 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3560 3.5% 11.0 42.36sec 145570 128197 121713 252907 146077 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.00 10.97 0.00 0.00 1.1355 0.0000 1601948.30 1601948.30 0.00 128196.89 128196.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.93 81.43% 121712.71 113382 151460 121695.22 113382 135459 1086880 1086880 0.00
crit 2.04 18.57% 252907.25 233567 312007 225617.77 0 312007 515068 515068 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 8737 8.7% 46.7 9.70sec 84166 73478 70329 145810 84166 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 46.72 46.72 0.00 0.00 1.1455 0.0000 3932004.47 3932004.47 0.00 73477.56 73477.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 38.15 81.67% 70329.07 65387 92606 70343.22 67942 72983 2683297 2683297 0.00
crit 8.56 18.33% 145810.05 134696 190769 145831.07 0 182805 1248707 1248707 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 20504 20.4% 142.7 3.11sec 64652 37313 0 0 0 0.0% 0.0% 0.0% 0.0% 324.1 23766 49325 28464 18.4% 0.0% 50.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 142.70 142.70 324.13 324.13 1.7327 0.7071 9225951.13 9225951.13 0.00 37312.75 37312.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 142.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 264.5 81.62% 23765.96 22015 31036 23771.78 23264 24360 6287203 6287203 0.00
crit 59.6 18.38% 49324.73 45350 63934 49339.38 46905 52733 2938748 2938748 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6388 6.4% 101.3 4.34sec 28363 94702 23693 49142 28363 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 101.34 101.34 0.00 0.00 0.2995 0.0000 2874304.15 2874304.15 0.00 94702.12 94702.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 82.75 81.65% 23693.30 22015 31036 23698.63 22701 24894 1960548 1960548 0.00
crit 18.59 18.35% 49142.46 45350 63934 49156.27 45350 60606 913756 913756 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mind_spike 10299 10.3% 39.6 11.02sec 117024 102274 97769 202753 117024 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.60 39.60 0.00 0.00 1.1442 0.0000 4633708.06 4633708.06 0.00 102273.56 102273.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 32.33 81.66% 97768.77 90707 128900 97791.54 91650 105290 3161218 3161218 0.00
crit 7.26 18.34% 202752.75 186857 265535 202648.45 0 265535 1472490 1472490 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.26 4.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3522 3.5% 13.6 5.47sec 116389 101262 96895 201116 116389 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 13.62 13.62 0.00 0.00 1.1494 0.0000 1584946.93 1584946.93 0.00 101261.62 101261.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 11.07 81.30% 96894.81 87318 123950 96997.62 88358 110977 1072671 1072671 0.00
crit 2.55 18.70% 201115.70 179876 255337 188600.50 0 255337 512276 512276 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10156 10.1% 21.6 21.20sec 211338 185165 0 0 0 0.0% 0.0% 0.0% 0.0% 231.6 15123 31331 19728 28.4% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 21.62 21.62 231.59 231.59 1.1413 1.9161 4568765.39 4568765.39 0.00 9753.48 185165.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 21.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 165.8 71.59% 15122.99 13993 19714 15126.01 14659 15728 2507366 2507366 0.00
crit 65.8 28.41% 31330.69 28826 40611 31336.99 29686 33340 2061400 2061400 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3161 3.2% 72.4 6.14sec 19638 65582 15065 31195 19638 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 72.41 72.41 0.00 0.00 0.2994 0.0000 1421884.36 1421884.36 0.00 65582.05 65582.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 51.88 71.65% 15065.01 13993 19714 15068.58 14360 15969 781549 781549 0.00
crit 20.53 28.35% 31194.68 28826 40611 31202.64 28826 36052 640335 640335 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.94 2.94 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3784 3.8% 77.7 5.74sec 21901 0 18791 37855 22290 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 77.74 76.39 0.00 0.00 0.0000 0.0000 1702713.53 1702713.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 62.37 81.64% 18791.13 17400 24722 18795.55 18110 19640 1171940 1171940 0.00
crit 14.02 18.36% 37854.92 34800 49444 37866.49 34800 44349 530774 530774 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9166 9.1% 23.6 19.26sec 174475 152601 0 0 0 0.0% 0.0% 0.0% 0.0% 202.9 16966 35271 20329 18.4% 0.0% 95.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 23.64 23.64 202.87 202.87 1.1433 2.1279 4124044.48 4124044.48 0.00 8990.88 152601.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 23.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 165.6 81.63% 16966.10 15675 22432 16970.84 16414 17636 2809499 2809499 0.00
crit 37.3 18.37% 35270.68 32291 46209 35283.11 32725 39143 1314545 1314545 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2854 2.8% 63.4 6.97sec 20248 67610 16920 35096 20248 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 63.42 63.42 0.00 0.00 0.2995 0.0000 1284055.56 1284055.56 0.00 67610.34 67610.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 51.80 81.69% 16920.44 15675 22432 16925.01 16112 18095 876552 876552 0.00
crit 11.61 18.31% 35095.56 32291 46209 35105.27 0 46209 407503 407503 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 35399 / 2759
melee 35399 2.7% 40.1 9.26sec 30678 36496 26776 54259 30678 20.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.08 40.08 0.00 0.00 0.8406 0.0000 1229504.57 1229504.57 0.00 36495.73 36495.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 22.46 56.03% 26775.78 19884 32223 26780.78 23498 29984 601267 601267 0.00
crit 8.01 19.98% 54259.34 39769 64447 54272.81 0 64447 434496 434496 0.00
glance 9.61 23.99% 20150.05 14913 24168 20154.21 0 24168 193742 193742 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 73.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 5.84 5.84 0.00 0.00 1.0478 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 5.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.5 55.6 3.0 3.0 43799.5
halo_damage Mana 11.0 466382.1 42380.5 42380.5 3.4
mind_blast Mana 46.7 410243.2 8781.4 8781.4 9.6
mind_flay Mana 142.7 413126.2 2895.0 2895.0 22.3
shadow_word_death Mana 13.6 103030.1 7565.9 7565.9 15.4
shadow_word_pain Mana 21.6 276100.8 12771.6 12771.6 16.5
vampiric_touch Mana 23.6 206744.9 8746.7 8746.7 19.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1800.39 471795.57 262.05 68321.93 12.65%
shadowfiend Mana 40.08 145421.49 3628.43 215283.48 59.68%
Shadow Orbs from Mind Blast Shadow Orb 46.72 46.72 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.95 6.95 1.00 0.00 0.00%
Devouring Plague Health Health 207.41 0.00 0.00 2880265.38 100.00%
Vampiric Touch Mana Mana 266.28 1186370.62 4455.34 221066.51 15.71%
Resource RPS-Gain RPS-Loss
Mana 4005.99 4165.99
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.9sec 180.9sec 6.62% 11.50%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.24%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.6sec 62.6sec 33.20% 33.20%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.2%
glyph_mind_spike 28.5 11.0 15.4sec 11.0sec 34.23% 37.77%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:26.0%
  • glyph_mind_spike_2:8.3%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 420.5sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.8 0.0 53.7sec 53.7sec 23.17% 23.37%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.2%
power_infusion 4.3 0.0 121.4sec 121.4sec 13.92% 15.55%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • power_infusion_1:13.9%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
relic_of_yulon 9.1 0.0 52.0sec 52.0sec 29.94% 29.94%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.9%
shadow_word_death_reset_cooldown 7.0 0.0 11.3sec 11.3sec 8.88% 48.95%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.9%
surge_of_darkness 36.1 3.8 12.2sec 11.0sec 14.88% 100.00%

Buff details