
SimulationCraft 504-4

for World of Warcraft 5.0.4 Live (build level 15972)

Beta Release

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.76 2.19 2.90 - - - 2.19 - 1.54 1.41 1.86 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.71 2.05 2.85 - - - 2.05 - 1.50 1.41 1.87 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.69 2.08 2.83 - - - 2.08 - 1.50 1.46 1.80 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.76 2.14 2.89 - - - 2.14 - 1.53 1.47 1.88 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.71 1.98 2.85 - - - 1.98 - 1.49 1.28 1.86 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.65 1.84 2.83 - - - 1.84 - 1.50 1.58 1.80 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.89 2.10 2.93 - - - 2.10 - 1.49 1.30 2.06 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.83 1.88 2.87 - - - 1.88 - 1.46 1.29 2.06 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.81 2.00 2.85 - - - 2.00 - 1.45 1.21 1.99 - - - - - - wowhead lootrank

priest_90_di_fdcl : 97629 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
97629.2 97629.2 13.46 / 0.01% 3578 / 3.7% 23.5 4055.4 3864.3 Mana 0.00% 36.2 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.76 2.19 2.90 2.19 1.54 1.41 1.86
Normalized 1.00 0.58 0.77 0.58 0.41 0.37 0.50
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:175618|147025|125030|113263|100935|100264|94916|73387|73060|67480|65564|36538&chds=0,351236&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++175618++shadow_word_pain,9482C9,0,0,15|t++147025++vampiric_touch,9482C9,1,0,15|t++125030++halo_damage,9482C9,2,0,15|t++113263++devouring_plague,9482C9,3,0,15|t++100935++mind_spike,000066,4,0,15|t++100264++shadow_word_death,9482C9,5,0,15|t++94916++mind_flay_mastery,9482C9,6,0,15|t++73387++devouring_plague_mastery,9482C9,7,0,15|t++73060++mind_blast,9482C9,8,0,15|t++67480++vampiric_touch_mastery,9482C9,9,0,15|t++65564++shadow_word_pain_mastery,9482C9,10,0,15|t++36538++mind_flay,9482C9,11,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:19,11,10,10,9,9,6,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_spike|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery|shadowfiend: melee&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.76,2.90,2.19,2.19,1.86,1.54,1.41|3.74,2.88,2.17,2.17,1.84,1.52,1.39|3.78,2.92,2.21,2.21,1.88,1.56,1.43&chds=0,7.51&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.76++Int,FFFFFF,0,0,15,0.1|t++++2.90++SP,FFFFFF,0,1,15,0.1|t++++2.19++Spi,FFFFFF,0,2,15,0.1|t++++2.19++Hit,FFFFFF,0,3,15,0.1|t++++1.86++Mastery,FFFFFF,0,4,15,0.1|t++++1.54++Crit,FFFFFF,0,5,15,0.1|t++++1.41++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5576778776546556631zxvusrpomlkjjiiihhgghhhhhhhhgffffffffgggfffffffffghhhhhhhggggffeeedddddcccccccccccccccbbbbcbccccccddddeeeeffffffffffffffffeeddddddddddddddddddccdcddddddcccdddddeffhhhiijjjjkkklkkkkkjjihhhhggggggggfffeeedddddcccbbbaaaabbbcccccccddddeeefffggggfffffgggggfffeeddcccbcccccbbbbbbbbbcddeeffgghgghhiijjkkllllllllllmnnnnnnmmmmnnnnnnnnmnnnnnmllmmmmmllllllll&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=97629|max=173751&chxp=1,1,56,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,5,8,32,32,69,131,246,391,651,935,1413,1985,2658,3457,4294,4981,5926,6593,7177,7447,7451,7149,6687,6064,5492,4432,3715,2879,2244,1756,1181,896,584,409,260,151,79,60,29,23,12,10,1,0,1,0,0,1&chds=0,7451&chbh=5&chxt=x&chxl=0:|min=88597|avg=97629|max=108866&chxp=0,1,45,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:49.4,13.1,9.9,6.0,5.6,5.2,3.4,2.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 180.8s|mind_blast 48.1s|mind_spike 36.2s|vampiric_touch 22.1s|shadow_word_pain 20.5s|devouring_plague 19.0s|shadow_word_death 12.3s|halo_damage 10.5s|shadowfiend 2.1s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_fdcl 97629
berserking 0 0.0% 3.0 181.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5883 6.0% 16.3 23.74sec 132140 113263 110374 228521 132140 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 0.00 0.00 1.1667 0.0000 2153007.44 2153007.44 0.00 113262.53 113262.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 13.29 81.58% 110373.88 101932 143640 110365.14 102524 119566 1467057 1467057 0.00
crit 3.00 18.42% 228520.80 209981 295899 220135.97 0 295899 685951 685951 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2571 2.6% 42.8 8.53sec 21977 73387 18339 38053 21977 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 42.81 42.81 0.00 0.00 0.2995 0.0000 940815.82 940815.82 0.00 73386.57 73386.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.91 81.55% 18338.59 16899 23811 18337.99 17149 19992 640207 640207 0.00
crit 7.90 18.45% 38053.27 34812 49052 38036.61 0 49052 300609 300609 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 8197 8.4% 16.3 23.74sec 184130 0 0 0 0 0.0% 0.0% 0.0% 0.0% 137.1 18278 37861 21885 18.4% 0.0% 27.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 16.29 16.29 137.08 137.08 0.0000 0.7353 3000106.50 3000106.50 0.00 29764.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 111.8 81.58% 18278.38 16899 34429 18276.38 17300 19703 2044135 2044135 0.00
crit 25.2 18.42% 37860.70 34812 70923 37848.49 34981 42913 955971 955971 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3600 3.7% 9.0 42.75sec 146418 125030 121987 253542 146451 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1711 0.0000 1317568.06 1317568.06 0.00 125030.18 125030.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.32 81.40% 121986.82 113382 151460 121967.23 113382 146052 893385 893385 0.00
crit 1.67 18.60% 253541.76 233567 312007 214351.91 0 312007 424183 424183 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9605 9.8% 41.6 8.83sec 84469 73060 70557 146285 84469 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 41.62 41.62 0.00 0.00 1.1562 0.0000 3515562.32 3515562.32 0.00 73059.75 73059.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.97 81.63% 70557.22 65387 92606 70554.10 68018 73823 2397116 2397116 0.00
crit 7.65 18.37% 146285.44 134696 190769 146261.71 0 190769 1118446 1118446 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 18046 18.5% 108.5 3.30sec 60849 36538 0 0 0 0.0% 0.0% 0.0% 0.0% 231.7 23797 49416 28511 18.4% 0.0% 45.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 108.55 108.55 231.66 231.66 1.6654 0.7147 6605002.33 6605002.33 0.00 36537.95 36537.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 108.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 189.0 81.60% 23797.38 22015 31036 23797.27 23216 24372 4498476 4498476 0.00
crit 42.6 18.40% 49415.51 45350 63934 49415.46 46708 53404 2106526 2106526 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5621 5.8% 72.4 4.87sec 28427 94916 23737 49248 28427 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 72.37 72.37 0.00 0.00 0.2995 0.0000 2057297.82 2057297.82 0.00 94915.70 94915.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 59.07 81.61% 23736.68 22015 31036 23736.33 22659 24990 1402023 1402023 0.00
crit 13.31 18.39% 49247.77 45350 63934 49247.67 0 56859 655275 655275 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mind_spike 9993 10.2% 31.3 11.16sec 116745 100935 97587 202204 116745 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 31.33 31.33 0.00 0.00 1.1566 0.0000 3657261.66 3657261.66 0.00 100934.53 100934.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 25.59 81.69% 97586.61 90707 128900 97585.87 90707 105548 2497245 2497245 0.00
crit 5.74 18.31% 202204.43 186857 265535 201670.12 0 265535 1160016 1160016 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3366 3.4% 10.5 5.54sec 117257 100264 97690 201792 117257 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.51 10.51 0.00 0.00 1.1695 0.0000 1231947.31 1231947.31 0.00 100264.29 100264.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.53 81.20% 97689.96 87318 123950 97700.39 89636 106229 833452 833452 0.00
crit 1.97 18.80% 201792.43 179876 255337 179380.24 0 255337 398496 398496 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9849 10.1% 17.8 21.24sec 202839 175618 0 0 0 0.0% 0.0% 0.0% 0.0% 182.5 15143 31364 19753 28.4% 0.0% 98.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 17.77 17.77 182.50 182.50 1.1550 1.9667 3604913.78 3604913.78 0.00 9500.27 175618.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 130.6 71.58% 15143.15 13993 19714 15142.58 14594 15731 1978287 1978287 0.00
crit 51.9 28.42% 31363.97 28826 40611 31362.36 29728 33449 1626627 1626627 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3060 3.1% 57.0 6.31sec 19629 65564 15064 31181 19629 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 57.05 57.05 0.00 0.00 0.2994 0.0000 1119838.13 1119838.13 0.00 65564.29 65564.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.89 71.68% 15064.25 13993 19714 15064.19 14270 16043 615977 615977 0.00
crit 16.16 28.32% 31181.36 28826 40611 31182.41 28826 35216 503861 503861 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3681 3.8% 61.8 5.86sec 21800 0 18800 37857 22295 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 61.79 60.42 0.00 0.00 0.0000 0.0000 1347150.94 1347150.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 49.34 81.66% 18799.61 17400 24722 18799.36 17878 19858 927629 927629 0.00
crit 11.08 18.34% 37856.52 34800 49444 37859.53 34800 46923 419522 419522 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8860 9.1% 19.1 19.32sec 170009 147025 0 0 0 0.0% 0.0% 0.0% 0.0% 160.6 16877 35036 20197 18.3% 0.0% 95.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.07 19.07 160.55 160.55 1.1563 2.1719 3242788.21 3242788.21 0.00 8746.11 147025.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 131.2 81.72% 16877.25 15675 22432 16876.77 16187 17586 2214269 2214269 0.00
crit 29.4 18.28% 35036.40 32291 46209 35035.44 32621 38855 1028519 1028519 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2771 2.8% 50.2 7.09sec 20209 67480 16888 35011 20209 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 50.18 50.18 0.00 0.00 0.2995 0.0000 1014020.55 1014020.55 0.00 67479.91 67479.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.98 81.68% 16888.09 15675 22432 16888.03 16029 18005 692123 692123 0.00
crit 9.19 18.32% 35010.79 32291 46209 35010.19 0 44448 321898 321898 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 38509 / 2527
melee 38509 2.6% 30.0 6.65sec 30820 39562 26862 54575 30820 20.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 30.01 30.01 0.00 0.00 0.7790 0.0000 924994.21 924994.21 0.00 39561.79 39561.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.78 55.92% 26862.29 19884 32223 26861.54 23108 30269 450853 450853 0.00
crit 6.01 20.03% 54575.07 39769 64447 54524.57 0 64447 328093 328093 0.00
glance 7.22 24.05% 20235.27 14913 24168 20232.52 0 24168 146048 146048 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 4.0 62.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0469 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 16.3 48.9 3.0 3.0 44046.6
halo_damage Mana 9.0 404939.7 45000.0 45000.0 3.3
mind_blast Mana 41.6 265482.2 6378.8 6378.8 13.2
mind_flay Mana 108.5 325643.8 3000.0 3000.0 20.3
shadow_word_death Mana 10.5 81949.8 7800.0 7800.0 15.0
shadow_word_pain Mana 17.8 234594.6 13200.0 13200.0 15.4
vampiric_touch Mana 19.1 171667.7 9000.0 9000.0 18.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 375631.27 256.75 63268.73 14.42%
shadowfiend Mana 30.01 119847.79 3993.18 150270.38 55.63%
Shadow Orbs from Mind Blast Shadow Orb 41.62 41.62 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.41 5.41 1.00 0.00 0.00%
Devouring Plague Health Health 179.89 2249178.48 12502.85 248928.51 9.96%
Vampiric Touch Mana Mana 210.73 918862.08 4360.35 194994.39 17.51%
Resource RPS-Gain RPS-Loss
Health 6145.30 14867.22
Mana 3864.32 4055.40
Shadow Orb 0.13 0.13
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 6.11% 11.05%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.1%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.43%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 11.5 0.5 29.3sec 28.0sec 6.01% 26.81%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.0%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 62.8sec 62.8sec 32.79% 32.79%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
glyph_mind_spike 23.1 8.3 15.3sec 11.2sec 32.19% 36.81%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:24.8%
  • glyph_mind_spike_2:7.4%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 336.9sec 0.0sec 12.25% 12.25%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 53.9sec 53.9sec 22.96% 22.63%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.0%
relic_of_yulon 7.5 0.0 52.0sec 52.0sec 29.18% 29.18%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.2%
shadow_word_death_reset_cooldown 5.4 0.0 11.6sec 11.6sec 8.42% 48.54%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.4%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
surge_of_darkness 28.5 3.1 12.4sec 11.1sec 15.16% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:14.3%
  • surge_of_darkness_2:0.9%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 6.7 0.0 60.9sec 60.9sec 16.63% 16.63%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:16.6%
shadowfiend-shadowcrawl 4.0 0.0 62.6sec 62.6sec 83.26% 77.44%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:5.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 14.6%
shadowfiend-Mana Cap 14.6%
lightwell-Mana Cap 14.6%


Count Interval
Shadowy Recall Extra Tick 222.4 1.6sec
Shadowy Apparition Procced 61.8 5.9sec
Divine Insight Mind Blast CD Reset 12.0 28.0sec
FDCL Mind Spike proc 31.6 11.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%


Sample Data
Count 100000
Mean 97629.17
Minimum 88596.61
Maximum 108865.81
Spread ( max - min ) 20269.20
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 2172.2642
5th Percentile 94104.09
95th Percentile 101259.62
( 95th Percentile - 5th Percentile ) 7155.54
Mean Distribution
Standard Deviation 6.8693
95.00% Confidence Intervall ( 97615.70 - 97642.63 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1901
0.1 Scale Factor Error with Delta=300 40281
0.05 Scale Factor Error with Delta=300 161127
0.01 Scale Factor Error with Delta=300 4028180
Distribution Chart


Sample Data
Count 100000
Mean 97629.17


Sample Data
Count 100000
Mean 34807280.87


Sample Data
Count 100000
Mean 14867.22


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 220.86
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.76, Spirit=2.19, SpellDamage=2.90, HitRating=2.19, CritRating=1.54, HasteRating=1.41, MasteryRating=1.86 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.76, Spirit=2.19, SpellDamage=2.90, HitRating=0.00, CritRating=1.54, HasteRating=1.41, MasteryRating=1.86 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=3.76, Spirit=2.19, SpellDamage=2.90, HitRating=2.19, CritRating=1.54, HasteRating=1.41, MasteryRating=1.86 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=3.76, Spirit=2.19, SpellDamage=2.90, HitRating=0.00, CritRating=1.54, HasteRating=1.41, MasteryRating=1.86 )

priest_90_di_mb : 96095 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
96094.9 96094.9 11.75 / 0.01% 3126 / 3.3% 21.4 4174.5 4037.7 Mana 0.00% 31.7 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.71 2.05 2.85 2.05 1.50 1.41 1.87
Normalized 1.00 0.55 0.77 0.55 0.40 0.38 0.51
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:175909|147436|125243|113341|100233|94748|73435|73061|67440|65574|36857&chds=0,351818&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++175909++shadow_word_pain,9482C9,0,0,15|t++147436++vampiric_touch,9482C9,1,0,15|t++125243++halo_damage,9482C9,2,0,15|t++113341++devouring_plague,9482C9,3,0,15|t++100233++shadow_word_death,9482C9,4,0,15|t++94748++mind_flay_mastery,9482C9,5,0,15|t++73435++devouring_plague_mastery,9482C9,6,0,15|t++73061++mind_blast,9482C9,7,0,15|t++67440++vampiric_touch_mastery,9482C9,8,0,15|t++65574++shadow_word_pain_mastery,9482C9,9,0,15|t++36857++mind_flay,9482C9,10,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:24,11,10,10,9,8,7,6,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mindbender: melee|mind_flay_mastery|devouring_plague|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.71,2.85,2.05,2.05,1.87,1.50,1.41|3.69,2.84,2.03,2.03,1.86,1.48,1.39|3.72,2.87,2.07,2.07,1.89,1.51,1.43&chds=0,7.41&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.71++Int,FFFFFF,0,0,15,0.1|t++++2.85++SP,FFFFFF,0,1,15,0.1|t++++2.05++Spi,FFFFFF,0,2,15,0.1|t++++2.05++Hit,FFFFFF,0,3,15,0.1|t++++1.87++Mastery,FFFFFF,0,4,15,0.1|t++++1.50++Crit,FFFFFF,0,5,15,0.1|t++++1.41++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:55667777776676678420ywvtsqpnlkiihhhgffffgggggffeeeeeddddeeeeeeffggghikklllllkkkkjihggfeedccbbbaaabbaaabbaaaaaaaaabbbbbbbccdeeeffgghhiiiiiiiiihgffeffeeeddcccccccccccbcddddcbbbbbbcccccdeeffffghijjkkkkkkkkkjjjjjjjiiihhfeedcccccbbbaaZZZYYYYZZZaabbbbccdeefgghhijjkkjjjjjjjjiihggfedccbbabbbbaaaaaaaaaabccddeeffgffghhijkklmmnooopppqqrrrrrrqppppoonnnnnmmmmmmlkkllkkkkkkkkjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=96095|max=170582&chxp=1,1,56,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:5,1,9,12,27,32,84,107,183,327,466,687,1023,1318,1798,2296,2959,3444,4290,4955,5412,6024,6328,6663,6547,6470,6145,5685,5160,4520,3795,3102,2568,1989,1696,1151,859,600,455,289,194,135,74,42,37,20,11,3,0,3&chds=0,6663&chbh=5&chxt=x&chxl=0:|min=88456|avg=96095|max=104185&chxp=0,1,49,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:57.7,12.7,6.1,5.7,5.1,3.6,2.9,1.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 211.1s|mind_blast 46.6s|vampiric_touch 22.5s|shadow_word_pain 20.8s|devouring_plague 18.6s|shadow_word_death 13.0s|halo_damage 10.5s|mindbender 6.6s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_mb 96095
berserking 0 0.0% 3.0 181.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5770 6.0% 16.0 24.32sec 132165 113341 110345 228544 132165 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.98 15.98 0.00 0.00 1.1661 0.0000 2111991.04 2111991.04 0.00 113340.72 113340.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 13.03 81.54% 110345.11 101932 143640 110335.15 102471 119845 1437809 1437809 0.00
crit 2.95 18.46% 228544.08 209981 295899 219939.00 0 295899 674182 674182 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2518 2.6% 41.9 8.72sec 21994 73435 18350 38079 21994 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 41.90 41.90 0.00 0.00 0.2995 0.0000 921468.24 921468.24 0.00 73435.47 73435.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 34.16 81.53% 18350.31 16899 23811 18349.64 17186 19883 626806 626806 0.00
crit 7.74 18.47% 38078.79 34812 49052 38059.45 0 49052 294662 294662 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 8020 8.3% 16.0 24.32sec 183683 0 0 0 0 0.0% 0.0% 0.0% 0.0% 134.1 18277 37856 21882 18.4% 0.0% 26.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.98 15.98 134.14 134.14 0.0000 0.7345 2935250.45 2935250.45 0.00 29790.73 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 109.4 81.59% 18277.37 16899 32475 18275.35 17343 19801 2000434 2000434 0.00
crit 24.7 18.41% 37855.75 34812 66899 37844.03 34957 43803 934817 934817 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3603 3.7% 9.0 42.20sec 146506 125243 122014 253577 146506 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1698 0.0000 1318555.45 1318555.45 0.00 125242.73 125242.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.32 81.38% 122014.21 113382 151460 121997.60 113382 138976 893698 893698 0.00
crit 1.68 18.62% 253576.60 233567 312007 214111.66 0 312007 424857 424857 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9309 9.7% 40.4 9.11sec 84430 73061 70543 146241 84430 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.35 40.35 0.00 0.00 1.1556 0.0000 3407002.59 3407002.59 0.00 73061.47 73061.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 32.95 81.65% 70542.71 65387 92606 70540.12 67456 73550 2324399 2324399 0.00
crit 7.40 18.35% 146240.64 134696 190769 146208.14 0 182805 1082603 1082603 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 21261 22.1% 124.0 2.89sec 62756 36857 0 0 0 0.0% 0.0% 0.0% 0.0% 273.6 23750 49309 28446 18.4% 0.0% 53.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 124.00 124.00 273.55 273.55 1.7027 0.7162 7781523.93 7781523.93 0.00 36857.25 36857.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 124.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 223.3 81.62% 23749.60 22015 31036 23749.48 23288 24157 5302909 5302909 0.00
crit 50.3 18.38% 49308.93 45350 63934 49309.32 46546 52382 2478615 2478615 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6628 6.9% 85.5 4.14sec 28376 94748 23699 49162 28376 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 85.49 85.49 0.00 0.00 0.2995 0.0000 2425824.19 2425824.19 0.00 94747.65 94747.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 69.78 81.63% 23698.72 22015 31036 23698.46 22819 24763 1653781 1653781 0.00
crit 15.70 18.37% 49162.12 45350 63934 49160.26 45350 56512 772043 772043 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mindbender 0 0.0% 6.0 62.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 1.1062 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3571 3.7% 11.2 5.28sec 117045 100233 97526 201428 117045 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 1.1677 0.0000 1306935.14 1306935.14 0.00 100232.77 100232.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 9.07 81.21% 97525.87 87318 123950 97541.59 89841 106802 884409 884409 0.00
crit 2.10 18.79% 201428.14 179876 255337 181517.45 0 255337 422526 422526 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9982 10.4% 18.0 21.08sec 203209 175909 0 0 0 0.0% 0.0% 0.0% 0.0% 184.4 15184 31451 19815 28.5% 0.0% 98.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 17.98 17.98 184.37 184.37 1.1552 1.9593 3653280.38 3653280.38 0.00 9563.44 175909.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 131.9 71.53% 15184.49 13993 19714 15184.24 14626 15775 2002565 2002565 0.00
crit 52.5 28.47% 31451.12 28826 40611 31449.81 29695 33309 1650715 1650715 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3091 3.2% 57.6 6.25sec 19633 65574 15065 31179 19633 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 57.62 57.62 0.00 0.00 0.2994 0.0000 1131217.54 1131217.54 0.00 65574.03 65574.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.28 71.65% 15064.66 13993 19714 15064.65 14351 15993 621897 621897 0.00
crit 16.34 28.35% 31179.37 28826 40611 31179.67 28826 34866 509320 509320 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3715 3.9% 62.3 5.80sec 21814 0 18802 37859 22307 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 62.34 60.96 0.00 0.00 0.0000 0.0000 1359850.39 1359850.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 49.75 81.61% 18801.55 17400 24722 18801.18 17906 19729 935350 935350 0.00
crit 11.21 18.39% 37858.75 34800 49444 37860.21 0 47763 424500 424500 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9046 9.4% 19.5 19.01sec 170169 147436 0 0 0 0.0% 0.0% 0.0% 0.0% 163.5 16917 35102 20252 18.3% 0.0% 96.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.46 19.46 163.48 163.48 1.1542 2.1633 3310826.87 3310826.87 0.00 8802.77 147436.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 133.5 81.66% 16916.78 15675 22432 16916.52 16208 17503 2258423 2258423 0.00
crit 30.0 18.34% 35102.47 32291 46209 35101.43 32549 38448 1052404 1052404 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2818 2.9% 51.1 6.96sec 20198 67440 16881 34989 20198 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.07 51.07 0.00 0.00 0.2995 0.0000 1031492.56 1031492.56 0.00 67439.85 67439.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.72 81.68% 16880.51 15675 22432 16880.49 16141 17820 704172 704172 0.00
crit 9.35 18.32% 34988.88 32291 46209 34987.16 0 46209 327320 327320 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 27488 / 6764
melee 27488 7.0% 91.9 3.58sec 26928 29022 23777 48166 26928 18.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 91.93 91.93 0.00 0.00 0.9279 0.0000 2475525.46 2475525.46 0.00 29022.08 29022.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 52.67 57.29% 23776.60 19058 31273 23776.70 22379 25315 1252341 1252341 0.00
crit 17.20 18.71% 48166.14 38116 62546 48169.28 42485 55516 828579 828579 0.00
glance 22.06 23.99% 17890.54 14294 23455 17890.69 15949 20107 394605 394605 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:262.33
  • base_dd_max:262.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 18.0 19.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.00 18.00 0.00 0.00 1.0887 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 18.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 16.0 47.9 3.0 3.0 44054.9
halo_damage Mana 9.0 405000.0 45000.0 45000.0 3.3
mind_blast Mana 40.4 251381.0 6229.5 6229.5 13.6
mind_flay Mana 124.0 371987.5 3000.0 3000.0 20.9
shadow_word_death Mana 11.2 87095.7 7800.0 7800.0 15.0
shadow_word_pain Mana 18.0 237308.9 13200.0 13200.0 15.4
vampiric_touch Mana 19.5 175105.4 9000.0 9000.0 18.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 325587.66 222.55 113312.34 25.82%
mindbender Mana 91.93 363570.70 3954.85 739593.38 67.04%
Shadow Orbs from Mind Blast Shadow Orb 40.35 40.35 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.68 5.68 1.00 0.00 0.00%
Devouring Plague Health Health 176.04 2200232.64 12498.56 244350.08 10.00%
Vampiric Touch Mana Mana 214.55 788627.98 3675.68 345479.63 30.46%
Resource RPS-Gain RPS-Loss
Health 6011.56 14867.22
Mana 4037.67 4174.53
Shadow Orb 0.13 0.13
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.3sec 181.3sec 6.07% 7.58%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.1%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.49%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 11.6 0.6 29.1sec 27.7sec 6.58% 27.62%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.6%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 62.8sec 62.8sec 32.79% 32.79%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 337.0sec 0.0sec 12.25% 12.25%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 53.8sec 53.8sec 22.96% 22.62%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.0%
relic_of_yulon 7.6 0.0 51.9sec 51.9sec 29.20% 29.20%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.2%
shadow_word_death_reset_cooldown 5.7 0.0 11.2sec 11.2sec 8.73% 49.16%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.7%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.6 0.0 60.9sec 60.9sec 16.56% 16.56%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:16.6%
mindbender-shadowcrawl 18.0 0.0 19.0sec 19.0sec 85.19% 83.52%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.0%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.8 0.0 157.7sec 0.0sec 1.91% 1.91%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 25.9%
shadowfiend-Mana Cap 25.9%
lightwell-Mana Cap 25.9%


Count Interval
Shadowy Recall Extra Tick 236.1 1.5sec
Shadowy Apparition Procced 62.3 5.8sec
Divine Insight Mind Blast CD Reset 12.1 27.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%


Sample Data
Count 100000
Mean 96094.93
Minimum 88455.74
Maximum 104184.56
Spread ( max - min ) 15728.81
Range [ ( max - min ) / 2 * 100% ] 8.18%
Standard Deviation 1895.4634
5th Percentile 92997.36
95th Percentile 99249.98
( 95th Percentile - 5th Percentile ) 6252.62
Mean Distribution
Standard Deviation 5.9940
95.00% Confidence Intervall ( 96083.18 - 96106.68 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1494
0.1 Scale Factor Error with Delta=300 30670
0.05 Scale Factor Error with Delta=300 122680
0.01 Scale Factor Error with Delta=300 3067004
Distribution Chart


Sample Data
Count 100000
Mean 96094.93


Sample Data
Count 100000
Mean 32695218.77


Sample Data
Count 100000
Mean 14867.22


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 193.66
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
E shadow_word_death,if=num_targets<=4
F vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
G halo_damage
H mindbender,if=cooldown_react
I mind_sear,chain=1,interrupt=1,if=num_targets>=2
J mind_flay,chain=1,interrupt=1
K shadow_word_death,moving=1
L mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
M shadow_word_pain,moving=1
N dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=3.71, Spirit=2.05, SpellDamage=2.85, HitRating=2.05, CritRating=1.50, HasteRating=1.41, MasteryRating=1.87 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=3.71, Spirit=2.05, SpellDamage=2.85, HitRating=0.00, CritRating=1.50, HasteRating=1.41, MasteryRating=1.87 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=3.71, Spirit=2.05, SpellDamage=2.85, HitRating=2.05, CritRating=1.50, HasteRating=1.41, MasteryRating=1.87 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=3.71, Spirit=2.05, SpellDamage=2.85, HitRating=0.00, CritRating=1.50, HasteRating=1.41, MasteryRating=1.87 )

priest_90_di_swi : 95361 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
95360.7 95360.7 12.33 / 0.01% 3264 / 3.4% 20.6 4512.0 4214.7 Mana 0.00% 32.9 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.69 2.08 2.83 2.08 1.50 1.46 1.80
Normalized 1.00 0.56 0.77 0.56 0.40 0.40 0.49
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:146097|144910|141992|125426|113256|100202|95039|73484|73091|67543|65608|37206&chds=0,292195&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++146097++vampiric_touch,9482C9,0,0,15|t++144910++shadow_word_pain,9482C9,1,0,15|t++141992++shadow_word_insanity,9482C9,2,0,15|t++125426++halo_damage,9482C9,3,0,15|t++113256++devouring_plague,9482C9,4,0,15|t++100202++shadow_word_death,9482C9,5,0,15|t++95039++mind_flay_mastery,9482C9,6,0,15|t++73484++devouring_plague_mastery,9482C9,7,0,15|t++73091++mind_blast,9482C9,8,0,15|t++67543++vampiric_touch_mastery,9482C9,9,0,15|t++65608++shadow_word_pain_mastery,9482C9,10,0,15|t++37206++mind_flay,9482C9,11,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,10,10,9,9,8,7,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|vampiric_touch|shadow_word_pain|shadow_word_insanity|devouring_plague_tick|mind_flay_mastery|devouring_plague|halo_damage|shadow_word_death|shadowy_apparition|vampiric_touch_mastery|shadow_word_pain_mastery|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.69,2.83,2.08,2.08,1.80,1.50,1.46|3.67,2.81,2.06,2.06,1.78,1.48,1.45|3.71,2.84,2.10,2.10,1.81,1.51,1.48&chds=0,7.38&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.69++Int,FFFFFF,0,0,15,0.1|t++++2.83++SP,FFFFFF,0,1,15,0.1|t++++2.08++Spi,FFFFFF,0,2,15,0.1|t++++2.08++Hit,FFFFFF,0,3,15,0.1|t++++1.80++Mastery,FFFFFF,0,4,15,0.1|t++++1.50++Crit,FFFFFF,0,5,15,0.1|t++++1.46++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5576778777767556621zwvurqpnlkkjihghggfffgggggggffgffeeeefffffefeeeffgggfggggggggfffeeeeeddcccbbbbbbbbbccbbbcccbbcccccccddeeeefffeeeeefffffffeeddddddddddddddddddddddeeeedddcccccccdeffghhhiiiiijkkkkkkkkjjiihhhggggggggfefeddddcccbbaaaaaZZZabbcccccdddddeeeffffggggfffffffffffeeeedccccbccccbbbbbbbbbccdeefffgghgghhhiijjkklllllllmmmnnnnoonnonooonnnnnnnnnnmlllllllllkkkkkjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=95361|max=170903&chxp=1,1,56,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,1,3,4,16,29,56,82,128,270,422,615,940,1388,1908,2600,3152,4048,4952,5642,6321,6744,7066,7011,7005,6798,5970,5492,4677,4047,3304,2597,1941,1441,1079,741,566,341,230,161,89,37,37,18,14,5,8,0,2&chds=0,7066&chbh=5&chxt=x&chxl=0:|min=86575|avg=95361|max=104437&chxp=0,1,49,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:53.6,12.4,6.0,6.0,5.8,5.0,3.5,2.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 196.0s|mind_blast 45.4s|vampiric_touch 22.1s|shadow_word_pain 22.1s|shadow_word_insanity 21.2s|devouring_plague 18.2s|shadow_word_death 12.7s|halo_damage 10.5s|shadowfiend 2.1s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_di_swi 95361
berserking 0 0.0% 3.0 181.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5623 5.9% 15.6 24.96sec 132031 113256 110288 228483 132031 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.59 15.59 0.00 0.00 1.1658 0.0000 2057981.08 2057981.08 0.00 113256.35 113256.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 12.72 81.60% 110287.83 101932 143640 110275.52 101932 119806 1402828 1402828 0.00
crit 2.87 18.40% 228483.29 209981 295899 218815.91 0 295899 655153 655153 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2461 2.6% 40.9 8.93sec 22006 73484 18357 38097 22006 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 40.93 40.93 0.00 0.00 0.2995 0.0000 900624.72 900624.72 0.00 73484.39 73484.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 33.36 81.52% 18357.37 16899 23811 18356.89 17219 20039 612451 612451 0.00
crit 7.56 18.48% 38097.44 34812 49052 38077.06 0 49052 288174 288174 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 7823 8.2% 15.6 24.96sec 183694 0 0 0 0 0.0% 0.0% 0.0% 0.0% 131.0 18264 37828 21859 18.4% 0.0% 26.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 15.59 15.59 130.99 130.99 0.0000 0.7357 2863249.14 2863249.14 0.00 29711.93 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 15.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 106.9 81.62% 18263.56 16899 31688 18261.17 17272 19699 1952720 1952720 0.00
crit 24.1 18.38% 37828.03 34812 65277 37815.34 34812 42886 910529 910529 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3607 3.8% 9.0 41.94sec 146665 125426 122167 253922 146665 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1693 0.0000 1319981.77 1319981.77 0.00 125425.86 125425.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.33 81.41% 122166.84 113382 151460 122147.23 113382 137382 895058 895058 0.00
crit 1.67 18.59% 253922.46 233567 312007 213993.18 0 312007 424924 424924 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 9061 9.5% 39.3 9.35sec 84413 73091 70518 146211 84413 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 39.29 39.29 0.00 0.00 1.1549 0.0000 3316413.78 3316413.78 0.00 73090.62 73090.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 32.08 81.64% 70517.90 65387 92606 70514.67 66929 73768 2261944 2261944 0.00
crit 7.21 18.36% 146210.84 134696 190769 146163.50 0 190769 1054470 1054470 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 19924 20.9% 115.3 3.11sec 63225 37206 0 0 0 0.0% 0.0% 0.0% 0.0% 255.2 23837 49506 28569 18.4% 0.0% 49.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 115.34 115.34 255.25 255.25 1.6993 0.7139 7292177.29 7292177.29 0.00 37205.94 37205.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 115.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 208.2 81.57% 23837.15 22015 31036 23837.04 23271 24303 4962778 4962778 0.00
crit 47.1 18.43% 49505.52 45350 63934 49506.75 46913 53062 2329400 2329400 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6202 6.5% 79.8 4.44sec 28461 95039 23764 49301 28461 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 79.76 79.76 0.00 0.00 0.2995 0.0000 2270103.14 2270103.14 0.00 95039.07 95039.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 65.09 81.61% 23763.54 22015 31036 23763.34 22652 24868 1546768 1546768 0.00
crit 14.67 18.39% 49300.52 45350 63934 49302.11 45350 57117 723335 723335 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
shadow_word_death 3476 3.6% 10.9 5.33sec 117210 100202 97628 201683 117210 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.85 10.85 0.00 0.00 1.1697 0.0000 1272066.37 1272066.37 0.00 100202.16 100202.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.81 81.18% 97628.13 87318 123950 97635.58 89841 105490 860150 860150 0.00
crit 2.04 18.82% 201682.64 179876 255337 180233.44 0 255337 411917 411917 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 8219 8.6% 18.2 19.44sec 165195 141992 138304 286050 165195 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 0.00 0.00 1.1634 0.0000 3008101.00 3008101.00 0.00 141992.02 141992.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 14.90 81.80% 138303.88 129668 184234 138292.03 129668 147500 2060038 2060038 0.00
crit 3.31 18.20% 286049.74 267117 379523 278812.56 0 363558 948063 948063 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.430000
  • base_dd_min:2481.02
  • base_dd_max:2618.71
shadow_word_pain 8743 9.2% 19.1 19.47sec 167414 144910 0 0 0 0.0% 0.0% 0.0% 0.0% 163.2 15044 31158 19609 28.3% 0.0% 85.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.11 19.11 163.19 163.19 1.1553 1.9222 3199892.59 3199892.59 0.00 9530.55 144909.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 117.0 71.67% 15043.64 13993 19714 15043.66 14466 15657 1759446 1759446 0.00
crit 46.2 28.33% 31158.32 28826 40611 31157.77 29425 33389 1440446 1440446 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2737 2.9% 51.0 7.06sec 19647 65608 15072 31205 19647 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 50.99 50.99 0.00 0.00 0.2995 0.0000 1001900.73 1001900.73 0.00 65608.06 65608.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 36.53 71.64% 15072.40 13993 19714 15072.27 14314 16191 550660 550660 0.00
crit 14.46 28.36% 31204.92 28826 40611 31205.10 28826 35312 451240 451240 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.0361 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3383 3.5% 56.7 6.38sec 21856 0 18812 37888 22316 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 56.65 55.49 0.00 0.00 0.0000 0.0000 1238236.83 1238236.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 45.29 81.63% 18811.62 17400 24722 18811.57 17987 19902 852045 852045 0.00
crit 10.19 18.37% 37887.72 34800 49444 37889.46 0 49444 386192 386192 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8823 9.3% 19.1 19.46sec 168661 146097 0 0 0 0.0% 0.0% 0.0% 0.0% 159.4 16910 35134 20252 18.3% 0.0% 94.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.15 19.15 159.44 159.44 1.1544 2.1737 3229042.51 3229042.51 0.00 8758.51 146097.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 130.2 81.66% 16910.21 15675 22432 16910.31 16243 17699 2201693 2201693 0.00
crit 29.2 18.34% 35134.43 32291 46209 35135.08 32456 38664 1027349 1027349 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2754 2.9% 49.8 7.13sec 20228 67543 16902 35048 20228 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 49.84 49.84 0.00 0.00 0.2995 0.0000 1008077.31 1008077.31 0.00 67542.87 67542.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 40.70 81.67% 16902.23 15675 22432 16902.15 16155 17979 687959 687959 0.00
crit 9.13 18.33% 35048.12 32291 46209 35045.78 0 46209 320118 320118 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 38473 / 2525
melee 38473 2.6% 30.0 6.65sec 30838 39533 26871 54593 30838 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.97 29.97 0.00 0.00 0.7801 0.0000 924152.99 924152.99 0.00 39532.57 39532.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.77 55.97% 26871.16 19884 32223 26870.35 23065 30048 450721 450721 0.00
crit 6.01 20.05% 54592.87 39769 64447 54551.70 0 64447 328065 328065 0.00
glance 7.19 23.98% 20229.99 14913 24168 20226.14 0 24168 145367 145367 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 4.0 62.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.01 4.01 0.00 0.00 1.0463 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 15.6 46.8 3.0 3.0 44010.3
halo_damage Mana 9.0 404999.1 45000.0 45000.0 3.3
mind_blast Mana 39.3 254537.9 6478.7 6478.7 13.0
mind_flay Mana 115.3 346008.5 3000.0 3000.0 21.1
shadow_word_death Mana 10.9 84652.4 7800.0 7800.0 15.0
shadow_word_insanity Mana 18.2 136570.0 7500.0 7500.0 22.0
shadow_word_pain Mana 19.1 252300.6 13200.0 13200.0 12.7
vampiric_touch Mana 19.1 172306.7 9000.0 9000.0 18.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 406836.83 278.08 32063.17 7.31%
shadowfiend Mana 29.97 133915.20 4468.54 135800.67 50.35%
Shadow Orbs from Mind Blast Shadow Orb 39.29 39.29 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.60 5.60 1.00 0.00 0.00%
Devouring Plague Health Health 171.92 2152837.83 12522.62 234492.20 9.82%
Vampiric Touch Mana Mana 209.28 1001829.79 4787.13 104315.36 9.43%
Resource RPS-Gain RPS-Loss
Health 5882.07 14867.22
Mana 4214.70 4511.95
Shadow Orb 0.12 0.13
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 6.09% 11.72%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.1%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.75%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 10.3 0.4 32.3sec 30.9sec 6.09% 25.21%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.1%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 62.9sec 62.9sec 32.79% 32.79%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 336.9sec 0.0sec 12.25% 12.25%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 54.0sec 54.0sec 22.95% 22.75%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.0%
relic_of_yulon 7.5 0.0 52.0sec 52.0sec 29.14% 29.14%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.1%
shadow_word_death_reset_cooldown 5.6 0.0 11.1sec 11.1sec 8.70% 48.44%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.7%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.8 0.0 60.8sec 60.8sec 16.69% 16.69%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:16.7%
shadowfiend-shadowcrawl 4.0 0.0 62.7sec 62.7sec 83.26% 77.45%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:5.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 7.4%
shadowfiend-Mana Cap 7.4%
lightwell-Mana Cap 7.4%


Count Interval
Shadowy Recall Extra Tick 221.5 1.6sec
Shadowy Apparition Procced 56.7 6.4sec
Divine Insight Mind Blast CD Reset 10.7 30.9sec
Shadow Word: Insanity removed DoTs 18.2 19.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%


Sample Data
Count 100000
Mean 95360.66
Minimum 86574.74
Maximum 104436.86
Spread ( max - min ) 17862.12
Range [ ( max - min ) / 2 * 100% ] 9.37%
Standard Deviation 1989.5654
5th Percentile 92144.04
95th Percentile 98673.03
( 95th Percentile - 5th Percentile ) 6528.99
Mean Distribution
Standard Deviation 6.2916
95.00% Confidence Intervall ( 95348.33 - 95372.99 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1672
0.1 Scale Factor Error with Delta=300 33790
0.05 Scale Factor Error with Delta=300 135163
0.01 Scale Factor Error with Delta=300 3379092
Distribution Chart


Sample Data
Count 100000
Mean 95360.66


Sample Data
Count 100000
Mean 33977848.27


Sample Data
Count 100000
Mean 14867.22


Sample Data
Count 100000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00


Sample Data
Count 100000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 100000
Mean 200.73
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B shadow_word_insanity,if=num_targets<=4
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|ticks_remain<1)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=3.69, Spirit=2.08, SpellDamage=2.83, HitRating=2.08, CritRating=1.50, HasteRating=1.46, MasteryRating=1.80 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=3.69, Spirit=2.08, SpellDamage=2.83, HitRating=0.00, CritRating=1.50, HasteRating=1.46, MasteryRating=1.80 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=3.69, Spirit=2.08, SpellDamage=2.83, HitRating=2.08, CritRating=1.50, HasteRating=1.46, MasteryRating=1.80 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=3.69, Spirit=2.08, SpellDamage=2.83, HitRating=0.00, CritRating=1.50, HasteRating=1.46, MasteryRating=1.80 )

priest_90_pi_fdcl : 97544 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
97544.0 97544.0 12.95 / 0.01% 3440 / 3.5% 23.0 4135.7 3913.7 Mana 0.00% 36.0 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.76 2.14 2.89 2.14 1.53 1.47 1.88
Normalized 1.00 0.57 0.77 0.57 0.41 0.39 0.50
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.02 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Mastery > Crit > Haste

Charts,s,333333&chd=t:183734|152036|127217|112360|102017|100339|94867|73425|72973|67691|65707|37354&chds=0,367467&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++183734++shadow_word_pain,9482C9,0,0,15|t++152036++vampiric_touch,9482C9,1,0,15|t++127217++halo_damage,9482C9,2,0,15|t++112360++devouring_plague,9482C9,3,0,15|t++102017++mind_spike,000066,4,0,15|t++100339++shadow_word_death,9482C9,5,0,15|t++94867++mind_flay_mastery,9482C9,6,0,15|t++73425++mind_blast,9482C9,7,0,15|t++72973++devouring_plague_mastery,9482C9,8,0,15|t++67691++vampiric_touch_mastery,9482C9,9,0,15|t++65707++shadow_word_pain_mastery,9482C9,10,0,15|t++37354++mind_flay,9482C9,11,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:20,11,11,10,9,8,6,6,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_spike|vampiric_touch|mind_blast|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.76,2.89,2.14,2.14,1.88,1.53,1.47|3.74,2.87,2.12,2.12,1.86,1.51,1.45|3.78,2.91,2.15,2.15,1.90,1.55,1.49&chds=0,7.52&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.76++Int,FFFFFF,0,0,15,0.1|t++++2.89++SP,FFFFFF,0,1,15,0.1|t++++2.14++Spi,FFFFFF,0,2,15,0.1|t++++2.14++Hit,FFFFFF,0,3,15,0.1|t++++1.88++Mastery,FFFFFF,0,4,15,0.1|t++++1.53++Crit,FFFFFF,0,5,15,0.1|t++++1.47++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:5577787665446556621ywutrqomlkjjihfedddcddeeeffffeeeeeeeefffffedddccbcddeeefffffffeeeeeeddccbaaZZYZZZZaabaabbbbbbcccdddddddddddddeeeffggggggggffeeeeeddccbbbabbbbbbccccdddddcddddddcdddeeefffggghiijjjjjjiihhgggffeeeeeedddcccbbbbbbbbaaaaaaZaaabbbbccccddeffgghhhiiihhhhhgggffeedddcbbbaabbaaaaaaabbbbbbcccddeefffffggghhiiijjjjkkkkkkllllllkkllllllllllllllllkkkllkkkjjjjjjjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=97544|max=179526&chxp=1,1,54,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,0,7,12,15,52,102,166,263,431,653,980,1399,1831,2621,3314,4093,5049,5639,6448,6855,7247,7261,7201,6705,6148,5477,4713,3928,3078,2450,1898,1315,934,644,396,276,181,98,53,28,19,10,5,2,0,0,0,1&chds=0,7261&chbh=5&chxt=x&chxl=0:|min=88544|avg=97544|max=107757&chxp=0,1,47,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:51.3,11.6,10.0,6.0,5.6,4.7,3.4,2.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 187.9s|mind_blast 42.4s|mind_spike 36.7s|vampiric_touch 21.9s|shadow_word_pain 20.4s|devouring_plague 17.2s|shadow_word_death 12.5s|halo_damage 10.4s|shadowfiend 2.1s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS%% Count Interval DPE DPET Hit Crit Avg Crit%% Avoid%% G%% B%% Ticks T-Hit T-Crit T-Avg T-Crit%% T-Avoid%% Up%%
priest_90_pi_fdcl 97544
berserking 0 0.0% 3.0 181.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5283 5.4% 14.8 26.37sec 130765 112360 109358 226362 130765 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 14.79 14.79 0.00 0.00 1.1638 0.0000 1933597.81 1933597.81 0.00 112359.68 112359.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 12.08 81.70% 109357.53 101932 143640 109348.48 101932 117407 1321202 1321202 0.00
crit 2.71 18.30% 226362.25 209981 295899 215176.06 0 295899 612396 612396 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.712000
  • base_dd_min:1493.19
  • base_dd_max:1493.19
devouring_plague_mastery 2327 2.4% 39.0 9.40sec 21855 72973 18246 37870 21855 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 38.97 38.97 0.00 0.00 0.2995 0.0000 851594.80 851594.80 0.00 72972.99 72972.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 31.80 81.61% 18245.85 16899 23811 18246.68 17054 19843 580205 580205 0.00
crit 7.17 18.39% 37869.91 34812 49052 37843.81 0 49052 271389 271389 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.118000
  • base_dd_min:248.69
  • base_dd_max:248.69
devouring_plague_tick 7361 7.5% 14.8 26.37sec 182201 0 0 0 0 0.0% 0.0% 0.0% 0.0% 124.7 18068 37400 21601 18.3% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 14.79 14.79 124.73 124.73 0.0000 0.7308 2694187.32 2694187.32 0.00 29556.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 14.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 101.9 81.72% 18067.96 16899 23811 18066.63 17259 18888 1841692 1841692 0.00
crit 22.8 18.28% 37400.22 34812 49052 37395.75 34812 40749 852495 852495 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.118000
  • base_td:248.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3601 3.7% 9.0 42.43sec 146458 127217 122127 253754 146465 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1512 0.0000 1318100.29 1318100.29 0.00 127217.48 127217.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 7.34 81.51% 122127.25 113382 151460 122108.47 113382 135555 895863 895863 0.00
crit 1.66 18.49% 253754.32 233567 312007 213569.06 0 312007 422237 422237 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 8504 8.7% 36.9 9.96sec 84270 73425 70430 145975 84270 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 36.93 36.93 0.00 0.00 1.1477 0.0000 3112478.64 3112478.64 0.00 73424.83 73424.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 30.17 81.68% 70429.99 65387 92606 70427.93 67955 72818 2124722 2124722 0.00
crit 6.77 18.32% 145974.65 134696 190769 145916.56 0 190769 987756 987756 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.394000
  • base_dd_min:1965.43
  • base_dd_max:2076.58
mind_flay 19179 19.7% 114.0 3.14sec 61558 37354 0 0 0 0.0% 0.0% 0.0% 0.0% 246.0 23814 49441 28536 18.4% 0.0% 47.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 114.03 114.03 245.99 245.99 1.6480 0.7015 7019510.69 7019510.69 0.00 37353.52 37353.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 114.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 200.7 81.57% 23814.02 22015 31036 23813.76 23223 24317 4778605 4778605 0.00
crit 45.3 18.43% 49440.68 45350 63934 49440.44 46725 52686 2240906 2240906 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.462000
  • base_td:943.35
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5968 6.1% 76.9 4.59sec 28413 94867 23733 49237 28413 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 76.88 76.88 0.00 0.00 0.2995 0.0000 2184310.31 2184310.31 0.00 94866.90 94866.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 62.77 81.65% 23732.92 22015 31036 23732.55 22666 25040 1489717 1489717 0.00
crit 14.11 18.35% 49237.42 45350 63934 49236.51 45350 57452 694593 694593 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.462000
  • base_dd_min:943.35
  • base_dd_max:943.35
mind_spike 10220 10.5% 31.9 11.02sec 117183 102017 97904 202967 117183 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 31.92 31.92 0.00 0.00 1.1487 0.0000 3740367.74 3740367.74 0.00 102017.45 102017.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 26.06 81.65% 97903.87 90707 128900 97901.87 91190 106450 2551579 2551579 0.00
crit 5.86 18.35% 202966.89 186857 265535 202395.21 0 265535 1188789 1188789 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 3.5 121.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 3.50 3.50 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 3.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3415 3.5% 10.7 5.48sec 117215 100339 97639 201679 117215 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 10.66 10.66 0.00 0.00 1.1682 0.0000 1249716.99 1249716.99 0.00 100338.58 100338.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 8.66 81.18% 97638.98 87318 123950 97644.53 89919 107554 845132 845132 0.00
crit 2.01 18.82% 201679.50 179876 255337 179415.00 0 255337 404585 404585 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10257 10.5% 17.9 21.18sec 209898 183734 0 0 0 0.0% 0.0% 0.0% 0.0% 189.4 15186 31465 19819 28.5% 0.0% 98.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 17.89 17.89 189.42 189.42 1.1424 1.9000 3754045.09 3754045.09 0.00 9870.34 183733.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 17.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 135.5 71.54% 15185.68 13993 19714 15185.38 14613 15821 2057893 2057893 0.00
crit 53.9 28.46% 31465.41 28826 40611 31464.00 29629 33432 1696152 1696152 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3183 3.3% 59.2 6.09sec 19675 65707 15090 31240 19675 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 59.21 59.21 0.00 0.00 0.2994 0.0000 1164917.66 1164917.66 0.00 65706.90 65706.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 42.40 71.61% 15089.51 13993 19714 15089.34 14361 16026 639735 639735 0.00
crit 16.81 28.39% 31240.33 28826 40611 31241.05 28826 35910 525182 525182 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3792 3.9% 63.5 5.70sec 21848 0 18824 37916 22337 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 63.53 62.14 0.00 0.00 0.0000 0.0000 1387947.27 1387947.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 50.70 81.60% 18823.56 17400 24722 18823.63 17974 19692 954427 954427 0.00
crit 11.43 18.40% 37916.50 34800 49444 37916.94 0 47364 433520 433520 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9092 9.3% 19.1 19.37sec 174645 152036 0 0 0 0.0% 0.0% 0.0% 0.0% 163.6 16973 35300 20340 18.4% 0.0% 95.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 19.05 19.05 163.60 163.60 1.1487 2.1270 3327608.90 3327608.90 0.00 8996.87 152035.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 19.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 133.5 81.63% 16973.09 15675 22432 16972.89 16354 17675 2266546 2266546 0.00
crit 30.1 18.37% 35300.32 32291 46209 35299.89 32456 39373 1061063 1061063 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2831 2.9% 51.1 6.98sec 20272 67691 16940 35130 20272 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 51.11 51.11 0.00 0.00 0.2995 0.0000 1036208.06 1036208.06 0.00 67690.62 67690.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 41.75 81.68% 16940.48 15675 22432 16940.50 16022 17902 707285 707285 0.00
crit 9.36 18.32% 35130.28 32291 46209 35130.25 0 44448 328923 328923 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 38571 / 2531
melee 38571 2.6% 30.0 6.65sec 30895 39625 26911 54653 30895 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 29.99 29.99 0.00 0.00 0.7797 0.0000 926508.12 926508.12 0.00 39624.84 39624.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
hit 16.77 55.91% 26910.87 19884 32223 26910.18 23016 30296 451242 451242 0.00
crit 6.03 20.11% 54652.61 39769 64447 54616.67 0 64447 329547 329547 0.00
glance 7.19 23.98% 20263.85 14913 24168 20259.19 0 24168 145719 145719 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 4.0 62.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill %% Amount per Total Time Amount per Total Execute Time
damage 4.01 4.01 0.00 0.00 1.0472 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %%
none 4.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 14.8 44.4 3.0 3.0 43588.2
halo_damage Mana 9.0 379658.5 42185.0 42185.0 3.5
mind_blast Mana 36.9 325469.5 8812.1 8812.1 9.6
mind_flay Mana 114.0 330461.3 2898.0 2898.0 21.2
shadow_word_death Mana 10.7 82769.1 7763.2 7763.2 15.1
shadow_word_pain Mana 17.9 228136.1 12755.7 12755.7 16.5
vampiric_touch Mana 19.1 167183.2 8774.4 8774.4 19.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 380373.88 260.00 58526.12 13.33%
shadowfiend Mana 29.99 105616.71 3521.85 164283.93 60.87%
Shadow Orbs from Mind Blast Shadow Orb 36.93 36.93 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 5.48 5.48 1.00 0.00 0.00%
Devouring Plague Health Health 163.69 2073453.48 12666.88 199658.62 8.78%
Vampiric Touch Mana Mana 214.71 946420.68 4407.90 188496.18 16.61%
Resource RPS-Gain RPS-Loss
Health 5665.17 14867.22
Mana 3913.69 4135.73
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 6.12% 11.05%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.1%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.11%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 62.8sec 62.8sec 32.79% 32.79%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
glyph_mind_spike 23.0 8.9 15.4sec 11.0sec 34.05% 37.17%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:25.8%
  • glyph_mind_spike_2:8.2%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 336.9sec 0.0sec 12.25% 12.25%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 53.8sec 53.8sec 22.96% 22.77%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.0%
power_infusion 3.5 0.0 121.3sec 121.3sec 12.44% 13.14%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • power_infusion_1:12.4%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
relic_of_yulon 7.6 0.0 51.9sec 51.9sec 29.19% 29.19%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.2%
shadow_word_death_reset_cooldown 5.5 0.0 11.4sec 11.4sec 8.49% 48.59%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.5%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
surge_of_darkness 29.0 3.2 12.2sec 11.0sec 15.00% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:14.1%
  • surge_of_darkness_2:0.9%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 6.8 0.0 60.9sec 60.9sec 16.65% 16.65%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:16.7%
shadowfiend-shadowcrawl 4.0 0.0 62.7sec 62.7sec 83.26% 77.42%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:5.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %%
Uptimes %%
Mana Cap 13.5%
shadowfiend-Mana Cap 13.5%
lightwell-Mana Cap 13.5%


Count Interval
Shadowy Recall Extra Tick 226.2 1.6sec
Shadowy Apparition Procced 63.5 5.7sec
FDCL Mind Spike proc 32.2 11.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 100000
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%


Sample Data
Count 100000
Mean 97543.99
Minimum 88544.03
Maximum 107757.21
Spread ( max - min ) 19213.18
Range [ ( max - min ) / 2 * 100% ] 9.85%
Standard Deviation 2088.9898
5th Percentile 94124.85</