
SimulationCraft 504-5

for World of Warcraft 5.0.4 Live (build level 16004)

Beta Release

Table of Contents

Raid Summary


DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.72 2.49 2.98 - - - 2.49 - 1.62 1.52 1.52 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.65 2.35 2.93 - - - 2.35 - 1.60 1.66 1.50 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.60 2.46 2.85 - - - 2.46 - 1.56 1.62 1.61 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.68 2.48 2.93 - - - 2.48 - 1.63 1.44 1.52 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.65 2.24 2.89 - - - 2.24 - 1.62 1.74 1.46 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.51 2.48 2.81 - - - 2.48 - 1.55 1.78 1.61 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.70 2.57 2.96 - - - 2.57 - 1.61 1.60 1.61 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.66 2.20 2.93 - - - 2.20 - 1.62 2.08 1.46 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.51 2.27 2.84 - - - 2.27 - 1.56 1.69 1.74 - - - - - - wowhead lootrank

priest_90_di_fdcl : 100608 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
100608.4 100608.4 30.88 / 0.03% 4066 / 4.0% 20.3 4682.3 4319.3 Mana 0.59% 37.6 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.72 2.49 2.98 2.49 1.62 1.52 1.52
Normalized 1.00 0.67 0.80 0.67 0.43 0.41 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.04 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Haste = Mastery

Charts,s,333333&chd=t:139857|124675|124249|103017|100763|99591|97315|83838|79512|67258|65272|38446&chds=0,279714&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++139857++vampiric_touch,9482C9,0,0,15|t++124675++halo_damage,9482C9,1,0,15|t++124249++devouring_plague,9482C9,2,0,15|t++103017++mind_flay_mastery,9482C9,3,0,15|t++100763++mind_spike,000066,4,0,15|t++99591++shadow_word_death,9482C9,5,0,15|t++97315++mind_blast,9482C9,6,0,15|t++83838++shadow_word_pain,9482C9,7,0,15|t++79512++devouring_plague_mastery,9482C9,8,0,15|t++67258++vampiric_touch_mastery,9482C9,9,0,15|t++65272++shadow_word_pain_mastery,9482C9,10,0,15|t++38446++mind_flay,9482C9,11,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:17,13,11,10,9,8,6,6,5,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mind_spike|vampiric_touch|devouring_plague_tick|devouring_plague|shadowfiend: melee|mind_flay_mastery|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.72,2.98,2.49,2.49,1.62,1.52,1.52|3.68,2.94,2.44,2.44,1.57,1.48,1.48|3.77,3.03,2.53,2.53,1.66,1.57,1.56&chds=0,7.45&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.72++Int,FFFFFF,0,0,15,0.1|t++++2.98++SP,FFFFFF,0,1,15,0.1|t++++2.49++Spi,FFFFFF,0,2,15,0.1|t++++2.49++Hit,FFFFFF,0,3,15,0.1|t++++1.62++Crit,FFFFFF,0,4,15,0.1|t++++1.52++Haste,FFFFFF,0,5,15,0.1|t++++1.52++Mastery,FFFFFF,0,6,15,0.1&chtt=priest_90_di_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:3568754433224445500xuspnkjjjiihhgffeeeeeeeeffffffedccccbbbbbbbbbbbbbbccdedeeeeeeeeddccccbbbbbaaaaZZZZZZZaabbbbaYXXWWWWVWWXXXXXXXXYYZaccdeddeddcbbabaaaaaaaaZZZZaaabbcdddddcbbbbcefghiklllllllllmnnnnmlkjigfedcdddddddddddcdddddddddcccaZYXWVWVVVVVVVVVVWWWWYZabcdcdeddddcccccccddccccbbcbcccccdcccbaaaaZZZZZZaaaaZZaaaabccccdddeeeddddeeeefffffeeeeeeeefffffeecbZYYYZabcdfghiijkllmnprrssrrqponlkjjiiihhhgggffffffffffggffedddddeeeeffffgggghhhijjjjjjjjjjjiihhhhhiiiiiiiiiiiiijjjkkkkigfdddeeddcccccbcccdceghiijiijjkkjjjjjjjjjkjkjkjjjjjkkkklllljiihhhiijjkkllllljjkklmmnnon&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=100608|max=194044&chxp=1,1,52,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,0,0,0,0,1,2,4,7,10,11,25,24,53,91,160,271,362,509,746,960,1238,1377,1590,1803,1910,1909,1870,1769,1632,1371,1255,984,826,661,502,326,253,180,120,70,42,22,19,14,5,5,2,3&chds=0,1910&chbh=5&chxt=x&chxl=0:|min=87377|avg=100608|max=111150&chxp=0,1,56,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:42.5,12.8,12.8,9.0,5.9,4.9,3.5,2.8,0.7,0.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 191.9s|shadow_word_pain 57.8s|mind_blast 57.7s|mind_spike 40.9s|vampiric_touch 26.8s|devouring_plague 22.3s|shadow_word_death 15.8s|halo_damage 12.8s|shadowfiend 3.1s|dispersion 0.1s|waiting 2.7s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 100608
berserking 0 0.0% 3.0 180.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6138 6.1% 19.1 24.36sec 144967 124249 121130 251042 144967 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.12 19.12 0.00 0.00 1.1667 0.0000 2772363.32 2772363.32 0.00 124248.79 124248.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.62 81.65% 121129.56 112097 157964 121173.00 113292 130106 1891455 1891455 0.00
crit 3.51 18.35% 251042.49 230921 325407 245191.72 0 325407 880908 880908 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2434 2.4% 46.2 9.19sec 23808 79512 19923 41259 23808 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.22 46.22 0.00 0.00 0.2994 0.0000 1100289.48 1100289.48 0.00 79512.18 79512.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.80 81.79% 19923.35 18617 26232 19927.52 18942 21531 753139 753139 0.00
crit 8.41 18.21% 41259.10 38350 54037 41250.19 0 50067 347150 347150 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7803 7.8% 19.1 24.36sec 184467 0 0 0 0 0.0% 0.0% 0.0% 0.0% 147.9 19940 41289 23847 18.3% 0.0% 24.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.12 19.12 147.93 147.93 0.0000 0.7352 3527767.46 3527767.46 0.00 32433.87 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.9 81.70% 19939.96 18617 38765 19943.93 18917 21212 2410012 2410012 0.00
crit 27.1 18.30% 41289.50 38350 79856 41292.75 38350 47959 1117755 1117755 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3545 3.5% 11.1 42.18sec 144747 124675 121344 251594 145244 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.06 11.02 0.00 0.00 1.1610 0.0000 1600331.77 1600331.77 0.00 124675.27 124675.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 81.65% 121344.42 113382 151460 121353.70 113382 134491 1091668 1091668 0.00
crit 2.02 18.35% 251594.25 233567 312007 223389.22 0 312007 508664 508664 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 12438 12.4% 48.5 9.27sec 115820 97315 96754 200625 115820 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.51 48.51 0.00 0.00 1.1902 0.0000 5618843.19 5618843.19 0.00 97314.52 97314.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.61 81.64% 96753.80 89919 127351 96776.09 93585 100788 3832280 3832280 0.00
crit 8.90 18.36% 200625.03 185234 262343 200694.61 0 242828 1786563 1786563 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16345 16.2% 116.7 3.80sec 63241 38446 0 0 0 0.0% 0.0% 0.0% 0.0% 238.1 25853 53665 30980 18.4% 0.0% 37.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.66 116.66 238.14 238.14 1.6449 0.7176 7377714.21 7377714.21 0.00 38446.02 38446.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.2 81.56% 25853.24 23861 33624 25859.28 25235 26567 5021730 5021730 0.00
crit 43.9 18.44% 53664.94 49154 69266 53679.28 50897 57374 2355985 2355985 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5087 5.1% 74.4 5.90sec 30856 103017 25747 53416 30856 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.43 74.43 0.00 0.00 0.2995 0.0000 2296548.29 2296548.29 0.00 103016.57 103016.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.68 81.53% 25746.56 23861 33624 25751.91 24678 27100 1562416 1562416 0.00
crit 13.74 18.47% 53416.49 49154 69266 53427.26 49154 61660 734133 734133 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 9123 9.1% 35.5 12.25sec 116136 100763 97134 201317 116136 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.46 35.46 0.00 0.00 1.1526 0.0000 4117899.02 4117899.02 0.00 100763.43 100763.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.99 81.76% 97134.47 90707 128900 97158.12 90707 104583 2815975 2815975 0.00
crit 6.47 18.24% 201317.05 186857 265535 200986.42 0 265535 1301924 1301924 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3468 3.5% 13.5 5.63sec 116024 99591 96670 200671 116024 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 13.54 0.00 0.00 1.1650 0.0000 1571142.53 1571142.53 0.00 99590.68 99590.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.02 81.39% 96670.34 87318 123950 96815.31 88061 107699 1065466 1065466 0.00
crit 2.52 18.61% 200671.42 179876 255337 187256.28 0 255337 505677 505677 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10731 10.7% 50.7 8.85sec 95648 83838 0 0 0 0.0% 0.0% 0.0% 0.0% 246.5 15086 31218 19661 28.4% 0.0% 94.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.67 50.67 246.49 246.49 1.1409 1.7386 4846258.23 4846258.23 0.00 9964.43 83838.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.6 71.64% 15086.45 13993 19714 15094.03 14572 15690 2664100 2664100 0.00
crit 69.9 28.36% 31218.49 28826 40611 31234.54 29761 33195 2182158 2182158 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3336 3.3% 77.1 5.78sec 19544 65272 15002 31044 19544 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.10 77.10 0.00 0.00 0.2994 0.0000 1506929.17 1506929.17 0.00 65271.76 65271.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.27 71.68% 15001.64 13993 19714 15005.76 14394 15783 829152 829152 0.00
crit 21.83 28.32% 31043.55 28826 40611 31054.23 28993 34027 677777 677777 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 181.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0386 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3878 3.9% 80.2 5.56sec 21836 0 18736 37711 22212 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.22 78.86 0.00 0.00 0.0000 0.0000 1751738.46 1751738.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.41 81.68% 18735.51 17400 24722 18739.50 18025 19482 1206813 1206813 0.00
crit 14.45 18.32% 37710.79 34800 49444 37722.02 34800 43123 544925 544925 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8315 8.3% 22.6 20.14sec 166442 139857 0 0 0 0.0% 0.0% 0.0% 0.0% 181.6 17222 35777 20665 18.6% 0.0% 85.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.55 22.55 181.64 181.64 1.1901 2.1293 3753618.70 3753618.70 0.00 9075.09 139856.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 147.9 81.45% 17221.76 15675 22432 17226.30 16543 17815 2547799 2547799 0.00
crit 33.7 18.55% 35776.71 32291 46209 35787.84 33371 39493 1205819 1205819 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2532 2.5% 56.8 7.74sec 20137 67258 16833 34904 20137 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.76 56.76 0.00 0.00 0.2994 0.0000 1143041.76 1143041.76 0.00 67257.53 67257.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.39 81.72% 16833.45 15675 22432 16837.42 16106 17895 780834 780834 0.00
crit 10.38 18.28% 34903.87 32291 46209 34913.40 0 42687 362208 362208 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 69037 / 5435
melee 69037 5.3% 39.7 9.56sec 61116 71351 53422 107908 61116 19.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.71 39.71 0.00 0.00 0.8565 0.0000 2427161.48 2427161.48 0.00 71351.43 71351.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.27 56.06% 53422.48 39609 64095 53435.57 48302 58541 1189458 1189458 0.00
crit 7.92 19.95% 107907.56 79218 128189 107891.16 0 128189 854851 854851 0.00
glance 9.53 23.99% 40186.71 29707 48071 40193.93 33319 48071 382852 382852 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.0446 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 19.1 57.4 3.0 3.0 48322.2
halo_damage Mana 11.1 497522.2 45000.0 45000.0 3.2
mind_blast Mana 48.5 291241.2 6003.3 6003.3 19.3
mind_flay Mana 116.7 349981.3 3000.0 3000.0 21.1
shadow_word_death Mana 13.5 105624.2 7800.0 7800.0 14.9
shadow_word_pain Mana 50.7 668815.3 13200.0 13200.0 7.2
vampiric_touch Mana 22.6 202968.4 9000.0 9000.0 18.5
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1807.28 514794.01 284.85 27388.77 5.05%
dispersion Mana 0.12 2221.56 18000.00 0.00 0.00%
shadowfiend Mana 39.71 264522.10 6660.67 92904.21 25.99%
Shadow Orbs from Mind Blast Shadow Orb 48.51 48.51 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.99 6.99 1.00 0.00 0.00%
Devouring Plague Health Health 194.15 0.00 0.00 2696090.66 100.00%
Vampiric Touch Mana Mana 238.41 1170551.94 4909.87 89605.76 7.11%
Resource RPS-Gain RPS-Loss
Mana 4319.32 4682.34
Shadow Orb 0.12 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.5sec 180.5sec 6.64% 14.77%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.85%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.5 0.7 27.3sec 26.1sec 6.18% 30.16%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.2%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.8sec 62.8sec 32.85% 32.85%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
glyph_mind_spike 26.3 9.1 16.6sec 12.2sec 29.44% 34.28%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:23.0%
  • glyph_mind_spike_2:6.4%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 420.9sec 0.0sec 10.07% 10.07%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.2sec 54.2sec 22.78% 22.91%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
relic_of_yulon 9.1 0.0 52.2sec 52.2sec 29.60% 29.60%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shadow_word_death_reset_cooldown 7.0 0.0 11.5sec 11.5sec 8.89% 48.38%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.9%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
surge_of_darkness 32.3 3.4 13.5sec 12.2sec 13.67% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:12.9%
  • surge_of_darkness_2:0.8%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 8.0 0.0 60.9sec 60.6sec 17.42% 17.42%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.38% 81.08%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.6%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.1%
shadowfiend-Mana Cap 5.1%
lightwell-Mana Cap 5.1%


Count Interval
Shadowy Recall Extra Tick 254.5 1.8sec
Shadowy Apparition Procced 80.2 5.6sec
Divine Insight Mind Blast CD Reset 16.2 26.1sec
FDCL Mind Spike proc 35.7 12.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24996
Mean 451.94
Minimum 346.26
Maximum 558.05
Spread ( max - min ) 211.79
Range [ ( max - min ) / 2 * 100% ] 23.43%


Sample Data
Count 24996
Mean 100608.40
Minimum 87376.88
Maximum 111149.57
Spread ( max - min ) 23772.69
Range [ ( max - min ) / 2 * 100% ] 11.81%
Standard Deviation 2490.8331
5th Percentile 96651.63
95th Percentile 104782.82
( 95th Percentile - 5th Percentile ) 8131.19
Mean Distribution
Standard Deviation 15.7547
95.00% Confidence Intervall ( 100577.52 - 100639.28 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2354
0.1 Scale Factor Error with Delta=300 52963
0.05 Scale Factor Error with Delta=300 211852
0.01 Scale Factor Error with Delta=300 5296304
Distribution Chart


Sample Data
Count 24996
Mean 100608.40


Sample Data
Count 24996
Mean 42984485.59


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 24996
Mean 283.48
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.49, SpellDamage=2.98, HitRating=2.49, CritRating=1.62, HasteRating=1.52, MasteryRating=1.52 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.49, SpellDamage=2.98, HitRating=0.00, CritRating=1.62, HasteRating=1.52, MasteryRating=1.52 )
RhadaTip Standard ( RhadaTip: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.49, SpellDamage=2.98, HitRating=2.49, CritRating=1.62, HasteRating=1.52, MasteryRating=1.52 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_fdcl": Intellect=3.72, Spirit=2.49, SpellDamage=2.98, HitRating=0.00, CritRating=1.62, HasteRating=1.52, MasteryRating=1.52 )

priest_90_di_mb : 99205 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99205.4 99205.4 26.18 / 0.03% 3474 / 3.5% 18.2 4927.6 4802.2 Mana 0.56% 34.4 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.65 2.35 2.93 2.35 1.60 1.66 1.50
Normalized 1.00 0.64 0.80 0.64 0.44 0.45 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.04 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Haste > Crit > Mastery

Charts,s,333333&chd=t:141291|125582|124320|102725|99495|97072|79501|78554|67213|65220|38696&chds=0,282582&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++141291++vampiric_touch,9482C9,0,0,15|t++125582++halo_damage,9482C9,1,0,15|t++124320++devouring_plague,9482C9,2,0,15|t++102725++mind_flay_mastery,9482C9,3,0,15|t++99495++shadow_word_death,9482C9,4,0,15|t++97072++mind_blast,9482C9,5,0,15|t++79501++devouring_plague_mastery,9482C9,6,0,15|t++78554++shadow_word_pain,9482C9,7,0,15|t++67213++vampiric_touch_mastery,9482C9,8,0,15|t++65220++shadow_word_pain_mastery,9482C9,9,0,15|t++38696++mind_flay,9482C9,10,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:21,14,12,11,9,9,7,7,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.65,2.93,2.35,2.35,1.66,1.60,1.50|3.61,2.89,2.32,2.32,1.62,1.56,1.46|3.69,2.96,2.39,2.39,1.70,1.64,1.54&chds=0,7.30&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.65++Int,FFFFFF,0,0,15,0.1|t++++2.93++SP,FFFFFF,0,1,15,0.1|t++++2.35++Spi,FFFFFF,0,2,15,0.1|t++++2.35++Hit,FFFFFF,0,3,15,0.1|t++++1.66++Haste,FFFFFF,0,4,15,0.1|t++++1.60++Crit,FFFFFF,0,5,15,0.1|t++++1.50++Mastery,FFFFFF,0,6,15,0.1&chtt=priest_90_di_mb Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:02345455444356678331ywtrpnnlkkjjihhffgggfgggghhgggfdddddeeeefghijjjkkllmnnnnnnmmlkjhgefedddcccbaaaaaaaaabbccccbZYYXXYZZaacdeeeffgggikllmmmllkjigedddcccbcbbaaaaaabcdeeffeedcccccddefghiiiijkkllmnnoooonnmkjiihhgggffeeeeeeeeeefeeeeeddcaZYXXYXXXXYYZaabcddefhjkllllmllkjighgfffffeedddddcdddeefeeedcbbaaababbccddddefgghjkklmmmmmllkkjkjjjjjiihgggggggghhhhgggecaZYYZZaabccdefghijkmpqstuuuuttsrqoonnmllkjjhhhhhghhhhiiiiiggfggggggghhhijjkklmmopqqrssssssrrqppooooonnmlllllllmmmmnnnnljhfffggffeeeeeefghiikmoqqrrrtttutsssrqqqqqppoonnnnnnnoopooonllllkmlllkkkkkjilllkmnnmnon&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=99205|max=174512&chxp=1,1,57,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,2,6,7,15,24,52,101,129,202,340,486,635,745,1006,1209,1378,1503,1611,1730,1806,1759,1630,1444,1395,1247,1020,859,672,511,429,310,214,173,115,85,56,26,24,12,9,10,3,2,1,0,0,0,1&chds=0,1806&chbh=5&chxt=x&chxl=0:|min=91069|avg=99205|max=109664&chxp=0,1,44,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18,s,333333&chd=t:48.7,14.0,12.5,6.0,4.9,3.7,2.9,2.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 220.3s|shadow_word_pain 63.2s|mind_blast 56.5s|vampiric_touch 27.1s|devouring_plague 22.0s|shadow_word_death 16.6s|halo_damage 12.9s|mindbender 9.0s|waiting 2.6s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 99205
berserking 0 0.0% 3.0 180.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6048 6.1% 18.8 24.77sec 145014 124320 121131 251065 145014 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.84 18.84 0.00 0.00 1.1665 0.0000 2731557.87 2731557.87 0.00 124319.95 124319.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.37 81.62% 121130.82 112097 157964 121174.26 113745 129945 1862272 1862272 0.00
crit 3.46 18.38% 251064.84 230921 325407 245070.69 0 325407 869285 869285 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2392 2.4% 45.4 9.36sec 23810 79501 19922 41252 23810 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.42 45.42 0.00 0.00 0.2995 0.0000 1081454.48 1081454.48 0.00 79501.17 79501.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.14 81.77% 19922.13 18617 26232 19926.26 18853 21297 739922 739922 0.00
crit 8.28 18.23% 41251.87 38350 54037 41242.08 0 50067 341533 341533 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7661 7.7% 18.8 24.77sec 183883 0 0 0 0 0.0% 0.0% 0.0% 0.0% 145.3 19936 41281 23838 18.3% 0.0% 23.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.84 18.84 145.30 145.30 0.0000 0.7350 3463710.85 3463710.85 0.00 32432.05 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.7 81.72% 19935.55 18617 35512 19939.37 18969 21443 2367128 2367128 0.00
crit 26.6 18.28% 41280.92 38350 73155 41283.61 38768 46945 1096583 1096583 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3600 3.6% 11.2 41.72sec 145187 125582 121581 252002 145781 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 11.14 0.00 0.00 1.1561 0.0000 1624524.10 1624524.10 0.00 125581.64 125581.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.08 81.44% 121581.12 113382 151460 121615.44 113382 132444 1103452 1103452 0.00
crit 2.07 18.56% 252001.78 233567 312007 225208.33 0 312007 521072 521072 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 12131 12.2% 47.4 9.50sec 115642 97072 96650 200283 115642 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.39 47.39 0.00 0.00 1.1913 0.0000 5480465.11 5480465.11 0.00 97071.54 97071.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.71 81.67% 96649.95 89919 127351 96672.66 92761 100514 3740967 3740967 0.00
crit 8.69 18.33% 200283.25 185234 262343 200368.37 0 252586 1739498 1739498 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18897 19.0% 132.3 3.36sec 64433 38696 0 0 0 0.0% 0.0% 0.0% 0.0% 275.8 25803 53559 30909 18.4% 0.0% 43.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.31 132.31 275.81 275.81 1.6651 0.7178 8525135.58 8525135.58 0.00 38695.56 38695.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 225.1 81.60% 25803.19 23861 33624 25809.09 25313 26406 5807688 5807688 0.00
crit 50.7 18.40% 53559.28 49154 69266 53575.17 50787 56875 2717448 2717448 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5878 5.9% 86.2 5.08sec 30765 102725 25697 53318 30765 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.20 86.20 0.00 0.00 0.2995 0.0000 2651841.54 2651841.54 0.00 102724.83 102724.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.38 81.65% 25696.53 23861 33624 25701.35 24785 27027 1808483 1808483 0.00
crit 15.82 18.35% 53317.68 49154 69266 53332.14 49154 60392 843358 843358 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.8 61.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.81 0.00 0.00 1.1573 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
shadow_word_death 3642 3.7% 14.2 5.39sec 116018 99495 96647 200500 116018 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.22 14.22 0.00 0.00 1.1661 0.0000 1650019.24 1650019.24 0.00 99494.65 99494.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.57 81.35% 96646.94 87318 123950 96784.56 88477 108024 1118144 1118144 0.00
crit 2.65 18.65% 200499.89 179876 255337 189344.75 0 255337 531875 531875 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10984 11.1% 55.7 8.04sec 89159 78554 0 0 0 0.0% 0.0% 0.0% 0.0% 253.5 15023 31091 19571 28.3% 0.0% 95.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.65 55.65 253.54 253.54 1.1350 1.7013 4962094.56 4962094.56 0.00 10034.26 78553.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.8 71.69% 15023.37 13993 19714 15030.71 14514 15555 2730854 2730854 0.00
crit 71.8 28.31% 31091.00 28826 40611 31106.10 29673 33148 2231241 2231241 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3427 3.5% 79.3 5.61sec 19527 65220 14988 31013 19527 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.29 79.29 0.00 0.00 0.2994 0.0000 1548194.95 1548194.95 0.00 65220.11 65220.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.83 71.68% 14987.57 13993 19714 14991.39 14454 15769 851721 851721 0.00
crit 22.46 28.32% 31013.46 28826 40611 31024.29 28826 34966 696474 696474 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3939 4.0% 81.6 5.48sec 21815 0 18720 37670 22191 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.60 80.21 0.00 0.00 0.0000 0.0000 1779960.64 1779960.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.52 81.68% 18719.64 17400 24722 18723.60 18091 19423 1226495 1226495 0.00
crit 14.69 18.32% 37669.53 34800 49444 37679.36 34800 42898 553466 553466 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8467 8.5% 22.8 19.91sec 167349 141291 0 0 0 0.0% 0.0% 0.0% 0.0% 185.4 17187 35705 20617 18.5% 0.0% 87.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.84 22.84 185.38 185.38 1.1844 2.1218 3821915.77 3821915.77 0.00 9091.64 141290.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.0 81.48% 17186.72 15675 22432 17192.31 16432 17851 2595832 2595832 0.00
crit 34.3 18.52% 35704.98 32291 46209 35717.66 33514 39014 1226084 1226084 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2585 2.6% 58.0 7.58sec 20131 67213 16829 34886 20131 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.96 57.96 0.00 0.00 0.2995 0.0000 1166876.97 1166876.97 0.00 67212.54 67212.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.36 81.71% 16828.94 15675 22432 16832.40 16103 18000 797080 797080 0.00
crit 10.60 18.29% 34886.04 32291 46209 34892.84 32291 40911 369797 369797 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37433 / 9556
melee 37433 9.6% 111.5 3.90sec 38633 38667 34009 68701 38633 19.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.45 111.45 0.00 0.00 0.9991 0.0000 4305749.53 4305749.53 0.00 38667.22 38667.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.36 56.85% 34008.99 26525 42986 34023.05 31883 36238 2154908 2154908 0.00
crit 21.36 19.16% 68701.05 53051 85971 68726.65 61166 76967 1467252 1467252 0.00
glance 26.73 23.99% 25572.18 19894 32239 25582.11 23139 28163 683589 683589 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.1 19.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.11 23.11 0.00 0.00 1.1429 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.8 56.5 3.0 3.0 48338.1
halo_damage Mana 11.2 503513.6 45000.0 45000.0 3.2
mind_blast Mana 47.4 275457.0 5812.4 5812.4 19.9
mind_flay Mana 132.3 396932.4 3000.0 3000.0 21.5
shadow_word_death Mana 14.2 110932.5 7800.0 7800.0 14.9
shadow_word_pain Mana 55.7 734637.3 13200.0 13200.0 6.8
vampiric_touch Mana 22.8 205542.5 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1807.28 455739.31 252.17 86443.47 15.94%
mindbender Mana 111.45 681235.01 6112.38 656185.54 49.06%
Shadow Orbs from Mind Blast Shadow Orb 47.39 47.39 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.24 7.24 1.00 0.00 0.00%
Devouring Plague Health Health 190.72 0.00 0.00 2648493.64 100.00%
Vampiric Touch Mana Mana 243.34 1033355.88 4246.55 252793.54 19.66%
Resource RPS-Gain RPS-Loss
Mana 4802.21 4927.64
Shadow Orb 0.12 0.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 6.65% 10.28%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 10.57%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.9 0.8 26.7sec 25.3sec 6.71% 31.51%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.7%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.8sec 62.8sec 32.86% 32.86%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
jade_serpent_potion 2.0 0.0 420.9sec 0.0sec 10.07% 10.07%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.2sec 54.2sec 22.81% 22.94%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
relic_of_yulon 9.1 0.0 52.2sec 52.2sec 29.63% 29.63%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shadow_word_death_reset_cooldown 7.2 0.0 11.2sec 11.2sec 9.19% 49.11%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.2%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
synapse_springs_2 7.9 0.0 60.9sec 60.7sec 17.39% 17.39%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
mindbender-raid_movement 0.2 0.0 60.0sec 60.0sec 0.43% 0.43%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:0.1%
mindbender-shadowcrawl 23.1 0.0 19.4sec 19.4sec 85.26% 84.17%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:21.8%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.8%
shadowfiend-Mana Cap 9.8%
lightwell-Mana Cap 9.8%


Count Interval
Shadowy Recall Extra Tick 268.9 1.7sec
Shadowy Apparition Procced 81.6 5.5sec
Divine Insight Mind Blast CD Reset 16.7 25.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24996
Mean 451.94
Minimum 346.26
Maximum 558.05
Spread ( max - min ) 211.79
Range [ ( max - min ) / 2 * 100% ] 23.43%


Sample Data
Count 24996
Mean 99205.36
Minimum 91068.80
Maximum 109664.14
Spread ( max - min ) 18595.33
Range [ ( max - min ) / 2 * 100% ] 9.37%
Standard Deviation 2112.1028
5th Percentile 95828.97
95th Percentile 102777.13
( 95th Percentile - 5th Percentile ) 6948.17
Mean Distribution
Standard Deviation 13.3592
95.00% Confidence Intervall ( 99179.18 - 99231.54 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1741
0.1 Scale Factor Error with Delta=300 38081
0.05 Scale Factor Error with Delta=300 152325
0.01 Scale Factor Error with Delta=300 3808147
Distribution Chart


Sample Data
Count 24996
Mean 99205.36


Sample Data
Count 24996
Mean 40487751.67


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 24996
Mean 258.90
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B berserking
C mind_blast,if=num_targets<=4&cooldown_react
D shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
E shadow_word_death,if=num_targets<=4
F vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
G halo_damage
H mindbender,if=cooldown_react
I mind_sear,chain=1,interrupt=1,if=num_targets>=2
J mind_flay,chain=1,interrupt=1
K shadow_word_death,moving=1
L mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
M shadow_word_pain,moving=1
N dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_mb": Intellect=3.65, Spirit=2.35, SpellDamage=2.93, HitRating=2.35, CritRating=1.60, HasteRating=1.66, MasteryRating=1.50 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_mb": Intellect=3.65, Spirit=2.35, SpellDamage=2.93, HitRating=0.00, CritRating=1.60, HasteRating=1.66, MasteryRating=1.50 )
RhadaTip Standard ( RhadaTip: "priest_90_di_mb": Intellect=3.65, Spirit=2.35, SpellDamage=2.93, HitRating=2.35, CritRating=1.60, HasteRating=1.66, MasteryRating=1.50 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_mb": Intellect=3.65, Spirit=2.35, SpellDamage=2.93, HitRating=0.00, CritRating=1.60, HasteRating=1.66, MasteryRating=1.50 )

priest_90_di_swi : 96756 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
96755.7 96755.7 36.77 / 0.04% 4874 / 5.0% 17.9 5095.9 4564.3 Mana 0.70% 35.1 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.60 2.46 2.85 2.46 1.56 1.62 1.61
Normalized 1.00 0.68 0.79 0.68 0.43 0.45 0.45
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.05 0.05 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Haste = Mastery = Crit

Charts,s,333333&chd=t:141125|140643|125777|124210|103034|99459|96989|79538|71825|67105|65352|38805&chds=0,282249&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++141125++vampiric_touch,9482C9,0,0,15|t++140643++shadow_word_insanity,9482C9,1,0,15|t++125777++halo_damage,9482C9,2,0,15|t++124210++devouring_plague,9482C9,3,0,15|t++103034++mind_flay_mastery,9482C9,4,0,15|t++99459++shadow_word_death,9482C9,5,0,15|t++96989++mind_blast,9482C9,6,0,15|t++79538++devouring_plague_mastery,9482C9,7,0,15|t++71825++shadow_word_pain,9482C9,8,0,15|t++67105++vampiric_touch_mastery,9482C9,9,0,15|t++65352++shadow_word_pain_mastery,9482C9,10,0,15|t++38805++mind_flay,9482C9,11,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:20,13,11,9,8,6,6,6,6,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_insanity|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.60,2.85,2.46,2.46,1.62,1.61,1.56|3.54,2.79,2.41,2.41,1.57,1.56,1.51|3.65,2.90,2.52,2.52,1.68,1.66,1.61&chds=0,7.19&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.60++Int,FFFFFF,0,0,15,0.1|t++++2.85++SP,FFFFFF,0,1,15,0.1|t++++2.46++Spi,FFFFFF,0,2,15,0.1|t++++2.46++Hit,FFFFFF,0,3,15,0.1|t++++1.62++Haste,FFFFFF,0,4,15,0.1|t++++1.61++Mastery,FFFFFF,0,5,15,0.1|t++++1.56++Crit,FFFFFF,0,6,15,0.1&chtt=priest_90_di_swi Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:356874332213433440zxuromjijiiihgeeeddeddddeeeffeedcbbbaaaaZZZaaZZZZZZaabddeeeeefeedccbbbbbbaaZYXYYYYXYYZaabaabZYXWWVWWWWWXXXWWWXXXXYbdddedeeddcbaaaaaaaaaYXXXYYYYZbbccddddcbaabcefghjkkkkjkkkkklmnonnlkjhgfdcbccccccccbaaabbbccdcccccbaYXWWVWVVVVVVVUUVVVWWXZbccdcdedddccbcbcccccbaaaaaaaabcccccccbaZZZYYZYZZZZYYXYYYYYZbcccdedeeddddcdddeeeedcccccccdeeeeeeedcaYYYYabcdfghiijjkklmoprsssrqqonljihhhhhggffeddddddeffffgfffedddddddeeeeeeeeeefffghiiiiijjiihhgfggggggffeeeeeeeffggghhhhfecbbabbaaZZYYXXXXXXXYabcccccddddcccccccccccccccccddeffgggggffeeeeghhijjkkllkllmmopqrsts&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=96756|max=192061&chxp=1,1,50,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,2,1,9,6,8,23,20,27,44,47,73,102,159,169,247,341,388,558,639,793,1014,1138,1240,1401,1642,1759,1696,1709,1714,1566,1403,1242,1007,828,633,421,325,235,158,101,45,40,15,3,1,1,1&chds=0,1759&chbh=5&chxt=x&chxl=0:|min=82086|avg=96756|max=107292&chxp=0,1,58,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18,s,333333&chd=t:46.2,14.4,12.2,5.9,4.7,3.8,3.3,2.8,0.7,0.4,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 209.0s|shadow_word_pain 65.0s|mind_blast 54.9s|vampiric_touch 26.6s|devouring_plague 21.3s|shadow_word_insanity 17.1s|shadow_word_death 15.1s|halo_damage 12.4s|shadowfiend 3.1s|dispersion 1.9s|waiting 3.2s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 96756
berserking 0 0.0% 3.0 180.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5855 6.1% 18.2 25.60sec 144903 124210 121102 251015 144903 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.22 18.22 0.00 0.00 1.1666 0.0000 2639838.37 2639838.37 0.00 124210.15 124210.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.88 81.68% 121101.92 112097 157964 121144.18 113065 129917 1802028 1802028 0.00
crit 3.34 18.32% 251014.69 230921 325407 243945.75 0 325407 837810 837810 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2315 2.4% 43.9 9.65sec 23822 79538 19920 41258 23822 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.87 43.87 0.00 0.00 0.2995 0.0000 1045128.53 1045128.53 0.00 79537.94 79537.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.85 81.71% 19919.62 18617 26232 19923.95 18819 21418 714116 714116 0.00
crit 8.02 18.29% 41257.98 38350 54037 41259.36 0 50914 331013 331013 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7414 7.7% 18.2 25.60sec 183681 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.5 19925 41264 23818 18.2% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.22 18.22 140.50 140.50 0.0000 0.7349 3346284.62 3346284.62 0.00 32409.54 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.9 81.76% 19925.21 18617 36663 19928.88 18852 21282 2288789 2288789 0.00
crit 25.6 18.24% 41263.57 38350 75527 41263.59 38350 46632 1057495 1057495 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3473 3.6% 10.8 42.53sec 145161 125777 121475 251771 145610 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 10.75 0.00 0.00 1.1541 0.0000 1564793.42 1564793.42 0.00 125777.14 125777.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.76 81.48% 121474.79 113382 151460 121492.50 113382 132525 1063609 1063609 0.00
crit 1.99 18.52% 251770.66 233567 312007 222815.38 0 312007 501184 501184 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11807 12.2% 46.0 9.74sec 115693 96989 96690 200471 115693 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.05 46.05 0.00 0.00 1.1928 0.0000 5327509.72 5327509.72 0.00 96989.02 96989.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.62 81.69% 96689.92 89919 127351 96712.79 93009 100909 3637183 3637183 0.00
crit 8.43 18.31% 200470.74 185234 262343 200514.43 0 256867 1690327 1690327 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17959 18.6% 126.1 3.51sec 64303 38805 0 0 0 0.0% 0.0% 0.0% 0.0% 261.5 25882 53728 31021 18.5% 0.0% 41.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.13 126.13 261.46 261.46 1.6571 0.7174 8110709.06 8110709.06 0.00 38804.81 38804.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 213.2 81.55% 25882.10 23861 33624 25887.13 25313 26521 5518453 5518453 0.00
crit 48.2 18.45% 53728.10 49154 69266 53743.62 51022 57416 2592256 2592256 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5591 5.8% 81.8 5.37sec 30860 103034 25766 53472 30860 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.82 81.82 0.00 0.00 0.2995 0.0000 2524847.04 2524847.04 0.00 103033.95 103033.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.78 81.62% 25766.00 23861 33624 25770.07 24732 27002 1720540 1720540 0.00
crit 15.04 18.38% 53471.83 49154 69266 53481.58 0 61884 804307 804307 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3334 3.4% 12.9 5.78sec 115887 99459 96558 200244 115887 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.95 12.95 0.00 0.00 1.1652 0.0000 1500235.11 1500235.11 0.00 99458.71 99458.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.53 81.36% 96558.45 87318 123950 96618.60 0 114111 1016993 1016993 0.00
crit 2.41 18.64% 200244.15 179876 255337 185093.96 0 255337 483242 483242 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 5313 5.5% 14.7 29.96sec 162911 140643 136630 282500 162911 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.72 14.72 0.00 0.00 1.1583 0.0000 2398659.41 2398659.41 0.00 140642.59 140642.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.07 81.98% 136630.27 129668 184234 136637.20 129668 146153 1649271 1649271 0.00
crit 2.65 18.02% 282499.80 267117 379523 265996.04 0 379523 749388 749388 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:(null)
  • description:Consumes your Shadow Word: Pain to deal $s1 Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.430000
  • base_dd_min:2481.02
  • base_dd_max:2618.71
shadow_word_pain 10354 10.7% 57.0 7.82sec 81897 71825 0 0 0 0.0% 0.0% 0.0% 0.0% 237.4 15096 31236 19682 28.4% 0.0% 87.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.04 57.04 237.36 237.36 1.1402 1.6561 4671681.61 4671681.61 0.00 10197.33 71824.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.9 71.59% 15095.52 13993 19714 15103.27 14627 15701 2565013 2565013 0.00
crit 67.4 28.41% 31236.08 28826 40611 31252.44 29788 33007 2106668 2106668 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|ticks_remain<1)&miss_react
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3218 3.3% 74.2 5.97sec 19567 65352 15020 31081 19567 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.22 74.22 0.00 0.00 0.2994 0.0000 1452321.87 1452321.87 0.00 65352.20 65352.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.21 71.69% 15020.25 13993 19714 15024.72 14416 15800 799282 799282 0.00
crit 21.01 28.31% 31081.17 28826 40611 31091.66 29082 34305 653040 653040 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 180.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0393 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3751 3.9% 77.4 5.75sec 21880 0 18750 37753 22226 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.40 76.19 0.00 0.00 0.0000 0.0000 1693385.75 1693385.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.25 81.71% 18750.06 17400 24722 18754.65 18152 19512 1167223 1167223 0.00
crit 13.94 18.29% 37752.94 34800 49444 37761.77 34800 43327 526162 526162 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8338 8.6% 22.4 20.03sec 167523 141125 0 0 0 0.0% 0.0% 0.0% 0.0% 182.4 17177 35681 20606 18.5% 0.0% 85.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.44 22.44 182.42 182.42 1.1871 2.1151 3758854.19 3758854.19 0.00 9113.21 141124.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.6 81.47% 17176.96 15675 22432 17181.47 16513 17810 2552733 2552733 0.00
crit 33.8 18.53% 35681.26 32291 46209 35692.52 32926 39209 1206121 1206121 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2545 2.6% 57.1 7.61sec 20098 67105 16808 34846 20098 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.07 57.07 0.00 0.00 0.2995 0.0000 1147089.78 1147089.78 0.00 67104.82 67104.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.66 81.76% 16808.12 15675 22432 16811.63 16114 17805 784321 784321 0.00
crit 10.41 18.24% 34846.01 32291 46209 34859.01 0 42687 362769 362769 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 69158 / 5490
melee 69158 5.6% 40.1 9.53sec 61034 71508 53357 107762 61034 19.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.14 40.14 0.00 0.00 0.8535 0.0000 2449719.35 2449719.35 0.00 71507.95 71507.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.51 56.07% 53357.21 39609 64095 53371.35 48553 58753 1200868 1200868 0.00
crit 8.01 19.95% 107761.50 79218 128189 107761.69 0 128189 862709 862709 0.00
glance 9.62 23.98% 40119.31 29707 48071 40127.94 33416 47083 386143 386143 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.96 5.96 0.00 0.00 1.0395 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 18.2 54.7 3.0 3.0 48301.0
halo_damage Mana 10.8 485085.8 45000.0 45000.0 3.2
mind_blast Mana 46.0 273269.0 5934.3 5934.3 19.5
mind_flay Mana 126.1 378399.3 3000.0 3000.0 21.4
shadow_word_death Mana 12.9 100976.2 7800.0 7800.0 14.9
shadow_word_insanity Mana 14.7 110428.2 7500.0 7500.0 21.7
shadow_word_pain Mana 57.0 752970.9 13200.0 13200.0 6.2
vampiric_touch Mana 22.4 201940.5 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1807.28 525019.58 290.50 17163.20 3.17%
dispersion Mana 2.41 43399.90 18000.00 0.00 0.00%
shadowfiend Mana 40.14 280801.22 6996.11 80429.81 22.27%
Shadow Orbs from Mind Blast Shadow Orb 46.05 46.05 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.73 6.73 1.00 0.00 0.00%
Devouring Plague Health Health 184.37 0.00 0.00 2560270.11 100.00%
Vampiric Touch Mana Mana 239.49 1213573.99 5067.32 52146.12 4.12%
Resource RPS-Gain RPS-Loss
Mana 4564.27 5095.92
Shadow Orb 0.12 0.12
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart


Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.4sec 180.4sec 6.65% 16.30%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 12.22%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.9 0.7 28.3sec 27.0sec 6.46% 30.24%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:-1.00

Stack Uptimes

  • divine_insight_shadow_1:6.5%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:$@spelldesc109175
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 62.9sec 62.9sec 32.83% 32.83%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
jade_serpent_potion 2.0 0.0 421.0sec 0.0sec 10.07% 10.07%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.3sec 54.3sec 22.74% 22.94%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:17.1%
relic_of_yulon 9.1 0.0 52.3sec 52.3sec 29.58% 29.58%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shadow_word_death_reset_cooldown 6.7 0.0 11.8sec 11.8sec 8.60% 47.99%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:8.6%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.6%
synapse_springs_2 7.9 0.0 60.9sec 60.7sec 17.41% 17.41%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2940.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
shadowfiend-shadowcrawl 6.0 0.0 74.3sec 74.3sec 83.38% 81.10%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.6%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.2%
shadowfiend-Mana Cap 3.2%
lightwell-Mana Cap 3.2%


Count Interval
Shadowy Recall Extra Tick 257.0 1.7sec
Shadowy Apparition Procced 77.4 5.7sec
Divine Insight Mind Blast CD Reset 15.6 27.0sec
Shadow Word: Insanity removed DoTs 14.7 30.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 24996
Mean 451.94
Minimum 346.26
Maximum 558.05
Spread ( max - min ) 211.79
Range [ ( max - min ) / 2 * 100% ] 23.43%


Sample Data
Count 24996
Mean 96755.67
Minimum 82085.87
Maximum 107291.97
Spread ( max - min ) 25206.10
Range [ ( max - min ) / 2 * 100% ] 13.03%
Standard Deviation 2965.9449
5th Percentile 91620.84
95th Percentile 101369.58
( 95th Percentile - 5th Percentile ) 9748.74
Mean Distribution
Standard Deviation 18.7598
95.00% Confidence Intervall ( 96718.91 - 96792.44 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3609
0.1 Scale Factor Error with Delta=300 75094
0.05 Scale Factor Error with Delta=300 300379
0.01 Scale Factor Error with Delta=300 7509479
Distribution Chart


Sample Data
Count 24996
Mean 96755.67


Sample Data
Count 24996
Mean 41181338.47


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00


Sample Data
Count 24996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 24996
Mean 264.04
Timeline DPS Error Chart DPS Error Chart

Action Priority List

# action,conditions
0 flask,type=warm_sun
1 food,type=mogu_fish_stew
2 power_word_fortitude,if=!aura.stamina.up
3 inner_fire
4 shadowform
5 snapshot_stats
6 jade_serpent_potion
Default action list
# action,conditions
7 shadowform
8 use_item,name=guardian_serpent_gloves
9 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A devouring_plague,if=shadow_orb=3
B shadow_word_insanity,if=num_targets<=4
C berserking
D mind_blast,if=num_targets<=4&cooldown_react
E shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|ticks_remain<1)&miss_react
F shadow_word_death,if=num_targets<=4
G vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H halo_damage
I shadowfiend,if=cooldown_react
J mind_sear,chain=1,interrupt=1,if=num_targets>=2
K mind_flay,chain=1,interrupt=1
L shadow_word_death,moving=1
M mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N shadow_word_pain,moving=1
O dispersion

Sample Sequence



Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21137 18765 17669
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35777 27196 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625


15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo



actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains actions+=/halo_damage
# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17669
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit

Gear Weights

Pawn Standard ( Pawn: v1: "priest_90_di_swi": Intellect=3.60, Spirit=2.46, SpellDamage=2.85, HitRating=2.46, CritRating=1.56, HasteRating=1.62, MasteryRating=1.61 )
Zero Hit/Expertise ( Pawn: v1: "priest_90_di_swi": Intellect=3.60, Spirit=2.46, SpellDamage=2.85, HitRating=0.00, CritRating=1.56, HasteRating=1.62, MasteryRating=1.61 )
RhadaTip Standard ( RhadaTip: "priest_90_di_swi": Intellect=3.60, Spirit=2.46, SpellDamage=2.85, HitRating=2.46, CritRating=1.56, HasteRating=1.62, MasteryRating=1.61 )
Zero Hit/Expertise ( RhadaTip: "priest_90_di_swi": Intellect=3.60, Spirit=2.46, SpellDamage=2.85, HitRating=0.00, CritRating=1.56, HasteRating=1.62, MasteryRating=1.61 )

priest_90_pi_fdcl : 99868 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99867.6 99867.6 29.58 / 0.03% 3908 / 3.9% 19.6 4818.0 4408.7 Mana 0.59% 37.2 100.0%
  • dark_binding
  • mind_spike
  • inner_sanctum
? Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.68 2.48 2.93 2.48 1.63 1.44 1.52
Normalized 1.00 0.67 0.80 0.67 0.44 0.39 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.04 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Stat Ranking
  • Int > SP > Spi = Hit > Crit > Mastery > Haste

Charts,s,333333&chd=t:146645|127885|126638|103050|101501|101121|95673|83396|80089|67218|65383|39880&chds=0,293291&chco=9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++146645++vampiric_touch,9482C9,0,0,15|t++127885++halo_damage,9482C9,1,0,15|t++126638++devouring_plague,9482C9,2,0,15|t++103050++mind_flay_mastery,9482C9,3,0,15|t++101501++mind_spike,000066,4,0,15|t++101121++shadow_word_death,9482C9,5,0,15|t++95673++mind_blast,9482C9,6,0,15|t++83396++shadow_word_pain,9482C9,7,0,15|t++80089++devouring_plague_mastery,9482C9,8,0,15|t++67218++vampiric_touch_mastery,9482C9,9,0,15|t++65383++shadow_word_pain_mastery,9482C9,10,0,15|t++39880++mind_flay,9482C9,11,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18,s,333333&chd=t:19,12,11,10,9,7,6,6,6,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|mind_spike|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_death|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.68,2.93,2.48,2.48,1.63,1.52,1.44|3.64,2.89,2.43,2.43,1.59,1.47,1.40|3.73,2.97,2.52,2.52,1.67,1.56,1.48&chds=0,7.37&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.68++Int,FFFFFF,0,0,15,0.1|t++++2.93++SP,FFFFFF,0,1,15,0.1|t++++2.48++Spi,FFFFFF,0,2,15,0.1|t++++2.48++Hit,FFFFFF,0,3,15,0.1|t++++1.63++Crit,FFFFFF,0,4,15,0.1|t++++1.52++Mastery,FFFFFF,0,5,15,0.1|t++++1.44++Haste,FFFFFF,0,6,15,0.1&chtt=priest_90_pi_fdcl Scale Factors&chts=dddddd,18,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:35687544322133442zyvsqnkigihhggggfedcdddddddeeeddcbaZZZYZaaZaabbbbbbbbbcddddeedddccbaZaaaaaaaaZZZYYZZYYYZaaaaZYXWVUUWWWWXYZaaaaaabbcdefghfffedcbaZaaaZaZZZZYYYZZZZabbcdcccbaaaabddeghikkkjkjkkklmmmmmkjigfdcbbcccccccccbbbbcccccccdcbbZYWWVVWVVWWXXXYYYYZZZbcdefgfffeeddcbccccccbbbaaaabaabbbccbbbaZZZZYZYYYYYZZZYYYYZZZabbbddcdddcccbdddddeeeddddddddddeeedddbaYXXYZabceghjklmmnooqstuvvttsrpnlkiihhgggffeddddddddeeefeeedccddcedddeeefffffggghiiiijiiiiiihgghggghhhhhghggghhhhiijjjihfdcccddddddeeeefffgghjkllmlllllkkjijihihhhhhggggggghhhijiiigfffffhhiiijjkkjjkkllmoopprp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=99868|max=195955&chxp=1,1,51,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,0,3,0,3,2,4,21,14,36,47,61,95,166,271,400,559,818,1019,1290,1612,1870,2099,2042,2093,1998,1855,1595,1274,1056,790,630,424,287,223,131,93,46,30,15,8,7,4,1,1,0,0,0,1&chds=0,2099&chbh=5&chxt=x&chxl=0:|min=87483|avg=99868|max=112186&chxp=0,1,50,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18,s,333333&chd=t:44.1,13.5,11.1,9.1,5.8,4.3,3.5,2.8,0.7,0.1,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 199.3s|shadow_word_pain 60.9s|mind_blast 50.1s|mind_spike 41.3s|vampiric_touch 26.1s|devouring_plague 19.3s|shadow_word_death 15.7s|halo_damage 12.6s|shadowfiend 3.1s|dispersion 0.3s|waiting 2.7s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18


Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 99868
berserking 0 0.0% 3.0 180.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.02 3.02 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 5423 5.4% 16.8 27.85sec 145858 126638 121763 252257 145858 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.79 16.79 0.00 0.00 1.1518 0.0000 2448800.11 2448800.11 0.00 126638.06 126638.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.69 81.54% 121762.86 112097 157964 121808.99 113416 132558 1666811 1666811 0.00
crit 3.10 18.46% 252256.65 230921 325407 242950.09 0 325407 781990 781990 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2165 2.2% 40.8 10.34sec 23987 80089 20047 41506 23987 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.80 40.80 0.00 0.00 0.2995 0.0000 978769.80 978769.80 0.00 80089.17 80089.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.31 81.64% 20047.43 18617 26232 20050.75 18782 21672 667837 667837 0.00
crit 7.49 18.36% 41505.96 38350 54037 41482.67 0 52052 310933 310933 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6925 6.9% 16.8 27.85sec 186504 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.6 20033 41489 23967 18.3% 0.0% 20.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.79 16.79 130.65 130.65 0.0000 0.7188 3131201.27 3131201.27 0.00 33345.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.7 81.66% 20032.70 18617 26232 20036.28 18961 21082 2137286 2137286 0.00
crit 24.0 18.34% 41488.54 38350 54037 41488.53 38350 46155 993916 993916 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3562 3.6% 11.1 42.02sec 145037 127885 121437 251749 145535 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.05 0.00 0.00 1.1341 0.0000 1607764.38 1607764.38 0.00 127884.54 127884.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 81.51% 121437.12 113382 151460 121454.96 113382 131183 1093459 1093459 0.00
crit 2.04 18.49% 251749.39 233567 312007 224719.92 0 312007 514306 514306 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 10609 10.6% 41.4 10.89sec 115733 95673 96700 200347 115733 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.41 41.41 0.00 0.00 1.2097 0.0000 4792923.16 4792923.16 0.00 95672.86 95672.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.81 81.64% 96699.59 89919 127351 96725.11 92736 100826 3269263 3269263 0.00
crit 7.61 18.36% 200347.19 185234 262343 200356.26 0 262343 1523660 1523660 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17605 17.6% 121.6 3.65sec 65369 39880 0 0 0 0.0% 0.0% 0.0% 0.0% 256.3 25886 53732 31018 18.4% 0.0% 39.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.60 121.60 256.26 256.26 1.6392 0.7008 7948680.62 7948680.62 0.00 39879.59 39879.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 209.0 81.57% 25886.19 23861 33624 25891.15 25340 26548 5411083 5411083 0.00
crit 47.2 18.43% 53732.43 49154 69266 53745.85 51081 57068 2537598 2537598 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5478 5.5% 80.1 5.48sec 30868 103050 25769 53474 30868 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.13 80.13 0.00 0.00 0.2995 0.0000 2473297.65 2473297.65 0.00 103049.77 103049.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.38 81.60% 25768.55 23861 33624 25771.82 24744 27135 1684714 1684714 0.00
crit 14.75 18.40% 53474.02 49154 69266 53486.05 49154 61997 788584 788584 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 9299 9.3% 36.2 12.02sec 116018 101501 97123 201271 116018 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.17 36.17 0.00 0.00 1.1430 0.0000 4196769.80 4196769.80 0.00 101501.19 101501.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.61 81.86% 97123.35 90707 128900 97141.29 91678 104761 2875913 2875913 0.00
crit 6.56 18.14% 201271.20 186857 265535 200898.12 0 265535 1320856 1320856 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:false
  • if_expr:talent.power_infusion.enabled
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by $s1% and mana cost of spells reduced by $s2%.
  • description:Infuses the Priest with power, increasing spell casting speed by $s1% and reducing the mana cost of all spells by $s2%. Lasts $d.
shadow_word_death 3514 3.5% 13.7 5.57sec 116068 101121 96618 200383 116068 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.70 13.70 0.00 0.00 1.1478 0.0000 1590628.47 1590628.47 0.00 101120.69 101120.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.14 81.26% 96617.69 87318 123950 96747.31 87318 107884 1075875 1075875 0.00
crit 2.57 18.74% 200382.84 179876 255337 188259.01 0 255337 514754 514754 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 11250 11.3% 54.0 8.29sec 94032 83396 0 0 0 0.0% 0.0% 0.0% 0.0% 257.6 15129 31309 19723 28.4% 0.0% 94.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.03 54.03 257.57 257.57 1.1275 1.6616 5080138.29 5080138.29 0.00 10391.00 83395.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.4 71.60% 15128.55 13993 19714 15137.07 14627 15739 2790213 2790213 0.00
crit 73.1 28.40% 31308.77 28826 40611 31326.85 29892 33127 2289925 2289925 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3487 3.5% 80.5 5.54sec 19577 65383 15024 31096 19577 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.45 80.45 0.00 0.00 0.2994 0.0000 1575011.36 1575011.36 0.00 65383.01 65383.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.66 71.67% 15024.18 13993 19714 15028.42 14490 15757 866305 866305 0.00
crit 22.79 28.33% 31096.31 28826 40611 31107.57 29133 34067 708706 708706 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 3.0 181.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 1.0381 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 4014 4.0% 82.9 5.38sec 21869 0 18762 37783 22244 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.92 81.52 0.00 0.00 0.0000 0.0000 1813310.76 1813310.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.60 81.69% 18762.32 17400 24722 18767.17 18055 19448 1249483 1249483 0.00
crit 14.92 18.31% 37782.70 34800 49444 37795.28 34800 43076 563828 563828 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8492 8.5% 22.5 20.15sec 170199 146645 0 0 0 0.0% 0.0% 0.0% 0.0% 185.2 17248 35856 20706 18.6% 0.0% 84.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.53 22.53 185.16 185.16 1.1606 2.0687 3833897.05 3833897.05 0.00 9369.94 146645.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.7 81.42% 17248.10 15675 22432 17252.62 16516 17990 2600101 2600101 0.00
crit 34.4 18.58% 35855.88 32291 46209 35866.38 33229 39036 1233796 1233796 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2581 2.6% 57.9 7.60sec 20135 67218 16832 34898 20135 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.87 57.87 0.00 0.00 0.2996 0.0000 1165283.54 1165283.54 0.00 67217.56 67217.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.29 81.71% 16831.72 15675 22432 16835.49 16059 17770 795962 795962 0.00
crit 10.58 18.29% 34898.12 32291 46209 34910.40 32291 42687 369322 369322 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 69330 / 5465
melee 69330 5.4% 39.9 9.54sec 61148 71668 53487 107984 61148 19.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.91 39.91 0.00 0.00 0.8532 0.0000 2440655.62 2440655.62 0.00 71668.06 71668.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.39 56.11% 53487.13 39609 64095 53504.09 48732 59030 1197783 1197783 0.00
crit 7.94 19.90% 107983.65 79218 128189 108026.25 0 128189 857782 857782 0.00
glance 9.58 23.99% 40212.84 29707 48071 40221.59 29707 48071 385090 385090 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.93 5.93 0.00 0.00 1.0380 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.


Resource Usage Type Count Total Average RPE APR
devouring_plague Shadow Orb 16.8 50.4 3.0 3.0 48619.2
halo_damage Mana 11.1 469716.4 42373.2 42373.2 3.4
mind_blast Mana 41.4 361035.8 8717.8 8717.8 13.3
mind_flay Mana 121.6 351503.3 2890.7 2890.7 22.6
shadow_word_death Mana 13.7 103563.8 7557.1 7557.1 15.4
shadow_word_pain Mana 54.0 696555.8 12893.0 12893.0 7.3
vampiric_touch Mana 22.5 195072.6 8659.9 8659.9 19.7
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1807.28 519168.01 287.27 23014.77 4.24%
dispersion Mana 0.34 6139.70 18000.00 0.00 0.00%
shadowfiend Mana 39.91 259520.21 6502.02 99703.87 27.76%
Shadow Orbs from Mind Blast Shadow Orb 41.41 41.41 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.05 7.05 1.00 0.00 0.00%
Devouring Plague Health Health 171.45 0.00 0.00 2380864.17 100.00%
Vampiric Touch Mana Mana 243.03 1207643.45 4969.13 76915.24 5.99%
Resource RPS-Gain RPS-Loss
Mana 4408.67 4817.96
Shadow Orb 0.11 0.11
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart