close

SimulationCraft 504-7

for World of Warcraft 5.0.4 Live (build level 16016)

Beta Release

Table of Contents

Raid Summary

 

DPS Chart DPS Chart
Raid Event List
0 movement,players_only=1,first=45,cooldown=85,duration=7,last=360
HPS Chart

Death_Knight_Frost_1h_T14H : 113225 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
113224.5 113224.5 50.83 / 0.04% 4274 / 3.8% 15236.9 6.9 6.9 Runic Power 3.85% 59.4 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:139257|86338|75272|58740|46862|16022|8084|4041&chds=0,278514&chco=9482C9,0070DE,0070DE,C79C6E,9482C9,C79C6E,C79C6E,C79C6E&chm=t++139257++soul_reaper,9482C9,0,0,15|t++86338++frost_strike,0070DE,1,0,15|t++75272++howling_blast,0070DE,2,0,15|t++58740++obliterate,C79C6E,3,0,15|t++46862++death_and_decay,9482C9,4,0,15|t++16022++plague_strike,C79C6E,5,0,15|t++8084++melee_main_hand,C79C6E,6,0,15|t++4041++melee_off_hand,C79C6E,7,0,15&chtt=Death_Knight_Frost_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,22,15,7,7,5,4,4,3,3,3,2,2,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,C79C6E,9482C9,0070DE,C79C6E,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,0070DE,C79C6E&chl=frost_strike|howling_blast|frost_strike_offhand|melee_main_hand|soul_reaper|frost_fever|obliterate|melee_off_hand|army_of_the_dead: melee|blood_plague|ghoul: melee|obliterate_offhand|army_of_the_dead: claw|ghoul: claw|plague_strike|death_and_decay|razorice|plague_strike_offhand&chtt=Death_Knight_Frost_1h_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uvxyz012232355686420zxwvtsqonljjihhfdcbbbbaaYYXWWWWWWXXXYabccdeeeefggggfedccbbaaZZZYYYYXXXXXYYYYYYXXXXXXXXXXXXWXXXXXXYZZZYYXWWVVVWWXXXXXYYYXXYZaabccccbbbaaaaaaZZZZZZZYYYZZZZYYYYYYYYYYYYYYZZZZaaaabbbbaaZZZZYYWVUTSSSSSSSSSSTTTTSSTUVVWXXXXYYYYZZaabbcdeeeffffffeeeeedddcccbbaaaaaaaZZZZZZZZZZZZZZYXWVUTUUUVVVVVUUUUVVWXYZabddddccccccccbbbaaaaaaaZaaaaaaabbbbbbbbaaaaaabbbcccdeeffghiijjkkjjiiihhhgggfffeeeddddddeeedddcccbbbbaaaaaabbbbbccddeeeeeeeefeeeeeeeddddcccccccbbbaaaZZZZZZZYYYYYZZZaabbccccddeefgghhhiiiiiiiiihhhggffeeddccbbbbbbaaaaaaabaaaaZZZYYYYXXXWWVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113225|max=242123&chxp=1,1,47,100&chtt=Death_Knight_Frost_1h_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,1,3,2,5,6,18,23,38,58,65,111,149,157,224,244,302,367,421,473,514,534,556,592,642,613,592,536,495,406,383,335,265,212,200,129,97,78,44,32,32,12,9,9,4,4,0,0,2&chds=0,642&chbh=5&chxt=x&chxl=0:|min=103266|avg=113225|max=123111&chxp=0,1,50,100&chtt=Death_Knight_Frost_1h_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.6,30.6,7.2,6.9,5.0,4.1,2.3,2.2,1.4,1.0,3.9&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,9482C9,9482C9,C79C6E,ffffff&chl=frost_strike 160.2s|howling_blast 138.0s|obliterate 32.4s|plague_strike 31.2s|soul_reaper 22.4s|plague_leech 18.3s|horn_of_winter 10.3s|death_and_decay 9.9s|outbreak 6.5s|raise_dead 4.5s|waiting 17.4s&chtt=Death_Knight_Frost_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T14H 113225
blood_fury 0 0.0% 4.2 120.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.21 4.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 2775 2.5% 66.5 12.49sec 18808 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.5 9308 18602 9882 6.2% 0.0% 84.2%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.47 66.47 126.50 126.50 0.0000 3.0000 1250119.68 1250119.68 0.00 3294.04 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.7 93.82% 9308.05 7121 15380 9309.16 8416 10185 1104772 1104772 0.00
crit 7.8 6.18% 18602.10 14243 30760 18594.74 0 29321 145348 145348 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
death_and_decay 1032 0.9% 9.6 43.47sec 48569 46862 0 0 0 6.3% 0.0% 0.0% 0.0% 104.3 4193 8641 4465 6.1% 0.0% 21.0%

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.59 9.59 104.33 104.33 1.0364 0.9081 465811.40 465811.40 0.00 4449.78 46862.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 93.67% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.61 6.33% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.0 93.90% 4193.17 3272 7103 4189.69 3479 5040 410781 410781 0.00
crit 6.4 6.10% 8640.84 6741 14631 8616.87 0 14631 55030 55030 0.00
DPS Timeline Chart

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every sec.$?$w4!=0[ Movement speed reduced by $w4%.][]
  • description:Corrupts the ground targeted by the Death Knight, causing $52212m1 Shadow damage every sec to targets that remain in the area $?s58629[and reducing their movement speed by $58629s1% ][]for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:51.10
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
empower_rune_weapon 0 0.0% 1.9 330.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.93 1.93 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4792 4.2% 139.3 3.23sec 15495 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.3 14931 29854 15843 6.1% 0.0% 90.7%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.32 139.32 136.25 136.25 0.0000 3.0000 2158680.78 2158680.78 0.00 5281.16 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.9 93.89% 14931.26 11423 24726 14935.08 14073 15724 1910030 1910030 0.00
crit 8.3 6.11% 29854.16 22845 49452 29851.28 0 43878 248650 248650 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 30691 27.1% 154.5 2.89sec 89489 86338 58694 120942 89489 49.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.55 154.55 0.00 0.00 1.0365 0.0000 13830142.64 13830142.64 0.00 86338.02 86338.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.09 50.53% 58694.43 50970 78734 58705.34 56279 61944 4583391 4583391 0.00
crit 76.46 49.47% 120941.68 104999 162191 120970.75 115974 126586 9246751 9246751 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>=88
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
frost_strike_offhand 15352 13.6% 154.5 2.89sec 44762 0 29349 60487 44762 49.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.55 154.55 0.00 0.00 0.0000 0.0000 6917726.62 6917726.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.05 50.50% 29348.58 25487 39368 29354.45 28117 31028 2290537 2290537 0.00
crit 76.50 49.50% 60486.62 52502 81099 60500.64 58211 63480 4627190 4627190 0.00
DPS Timeline Chart

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% off-hand weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 11.0 40.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 10.95 0.00 0.00 0.9418 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 23051 20.4% 133.1 3.36sec 78020 75272 73280 150968 78020 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.09 133.09 0.00 0.00 1.0365 0.0000 10383842.63 10383842.63 0.00 75271.96 75271.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.97 93.90% 73279.56 55964 121613 73296.02 68072 77569 9157826 9157826 0.00
crit 8.12 6.10% 150967.81 115286 250523 150950.08 0 217427 1226017 1226017 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 7502 6.6% 253.9 1.77sec 13319 8084 15213 31324 13319 11.1% 18.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 253.87 253.87 0.00 0.00 1.6475 0.0000 3381311.49 3381311.49 0.00 8084.29 8084.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.47 46.67% 15212.60 13152 20628 15216.63 14675 15872 1802279 1802279 0.00
crit 28.26 11.13% 31324.45 27093 42494 31329.96 28954 34067 885104 885104 0.00
glance 60.84 23.96% 11405.95 9864 15471 11408.85 10779 12046 693928 693928 0.00
miss 46.30 18.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3750 3.3% 253.9 1.77sec 6657 4041 7605 15668 6657 11.1% 18.3% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 253.87 253.87 0.00 0.00 1.6475 0.0000 1689958.26 1689958.26 0.00 4040.52 4040.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.28 46.59% 7604.97 6576 10314 7606.92 7347 7906 899544 899544 0.00
crit 28.25 11.13% 15667.63 13547 21247 15671.16 14461 17145 442642 442642 0.00
glance 60.97 24.02% 5704.16 4932 7736 5705.45 5388 6083 347773 347773 0.00
miss 46.36 18.26% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4235 3.7% 31.2 14.02sec 60885 58740 46612 95516 60885 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.24 31.24 0.00 0.00 1.0365 0.0000 1901888.25 1901888.25 0.00 58740.14 58740.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.12 70.81% 46611.55 40067 61891 46659.37 43067 51363 1031068 1031068 0.00
crit 9.12 29.19% 95515.57 82538 127496 95565.32 82538 123579 870820 870820 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react&runic_power<10
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
obliterate_offhand 2116 1.9% 31.2 14.02sec 30425 0 23306 47764 30425 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.24 31.24 0.00 0.00 0.0000 0.0000 950390.35 950390.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.15 70.89% 23306.00 20035 30947 23330.19 21627 25670 516124 516124 0.00
crit 9.09 29.11% 47763.86 41271 63750 47774.58 0 59078 434266 434266 0.00
DPS Timeline Chart

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% off-hand weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
outbreak 0 0.0% 6.2 78.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.23 6.23 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 17.7 26.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.67 17.67 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 1107 1.0% 30.1 14.93sec 16608 16022 14857 30594 16608 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.12 30.12 0.00 0.00 1.0365 0.0000 500235.34 500235.34 0.00 16022.40 16022.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.77 88.87% 14856.68 12998 19899 14855.30 14031 15875 397690 397690 0.00
crit 3.35 11.13% 30593.87 26775 40991 29353.86 0 39753 102546 102546 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 554 0.5% 30.1 14.93sec 8310 0 7428 15297 8310 11.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.12 30.12 0.00 0.00 0.0000 0.0000 250293.90 250293.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.75 88.80% 7428.35 6499 9949 7427.40 6978 7963 198679 198679 0.00
crit 3.37 11.20% 15296.84 13388 20496 14673.28 0 20496 51615 51615 0.00
DPS Timeline Chart

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66216
  • name:Plague Strike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% off-hand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:233.06
  • base_dd_max:233.06
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.3 120.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
razorice 655 0.6% 445.1 1.01sec 663 0 663 0 663 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 445.09 445.09 0.00 0.00 0.0000 0.0000 295170.82 295170.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 445.09 100.00% 663.17 573 898 663.33 648 680 295171 295171 0.00
DPS Timeline Chart

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razor Frost
  • school:frost
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
soul_reaper 6929 6.1% 21.6 7.38sec 144335 139257 15285 31469 17086 11.1% 0.0% 0.0% 0.0% 20.9 117629 242557 131432 11.0% 0.0% 23.2%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.62 21.62 20.93 20.93 1.0365 5.0000 3120332.47 3120332.47 0.00 24558.14 139257.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.21 88.87% 15285.39 13152 20628 15290.85 14232 16361 293683 293683 0.00
crit 2.41 11.13% 31468.55 27093 42494 28827.77 0 42494 75693 75693 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.6 88.95% 117629.14 101663 160938 117652.91 109518 124634 2190013 2190013 0.00
crit 2.3 11.05% 242557.05 209426 331532 220073.88 0 331532 560944 560944 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 7919 / 4206
claw 2823 1.3% 80.5 5.88sec 8380 0 7542 15093 8380 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.46 80.46 0.00 0.00 0.0000 0.0000 674313.02 674313.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.53 88.89% 7541.71 5828 11694 7542.66 7037 8078 539442 539442 0.00
crit 8.94 11.11% 15093.09 11655 23387 15097.48 0 20752 134871 134871 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 5097 2.4% 191.4 2.30sec 6367 5135 6055 12109 6367 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 191.35 191.35 0.00 0.00 1.2398 0.0000 1218239.25 1218239.25 0.00 5135.05 5135.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.10 64.85% 6054.59 4662 9355 6055.49 5586 6517 751375 751375 0.00
crit 21.34 11.15% 12109.43 9324 18710 12112.05 9996 14625 258383 258383 0.00
glance 45.91 23.99% 4540.69 3497 7016 4541.42 3964 5173 208481 208481 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 56800 / 4479
claw 20679 1.4% 120.0 2.58sec 6031 0 5428 10865 6031 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.00 120.00 0.00 0.00 0.0000 0.0000 723771.64 723771.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.68 88.90% 5428.18 3642 6989 5428.08 4888 5792 579102 579102 0.00
crit 13.32 11.10% 10864.59 7285 13978 10865.22 8136 13811 144670 144670 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 36121 2.5% 276.1 0.99sec 4579 4577 4356 8709 4579 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.10 276.10 0.00 0.00 1.0003 0.0000 1264234.17 1264234.17 0.00 4577.47 4577.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.11 64.87% 4355.91 2914 5591 4356.23 3896 4711 780179 780179 0.00
crit 30.70 11.12% 8709.07 5828 11182 8709.38 7131 10388 267364 267364 0.00
glance 66.30 24.01% 3268.51 2185 4193 3268.76 2795 3684 216691 216691 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.2 0.0 120.5sec 120.5sec 13.73% 13.73%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.7%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 23.01%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 7.5 0.0 64.0sec 64.0sec 32.45% 32.45%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.4%
killing_machine 73.3 16.6 6.1sec 5.0sec 23.25% 39.31%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:23.2%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 410.9sec 0.0sec 9.82% 9.82%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:9.8%
pillar_of_frost 7.8 0.0 61.4sec 61.6sec 34.05% 38.42%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:34.1%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 9.8 0.0 48.0sec 48.0sec 32.11% 32.11%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.1%
rime 13.9 0.1 30.7sec 30.7sec 4.01% 4.01%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:4.0%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 11.2 25.5 40.6sec 12.0sec 70.05% 68.81%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:70.0%
synapse_springs_2 7.8 0.0 61.4sec 61.6sec 17.22% 17.22%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_presence

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_1h_T14H
frost_strike Runic Power 154.5 3090.9 20.0 20.0 4474.5
pet - ghoul
claw Energy 80.5 3218.5 40.0 40.0 209.5
pet - army_of_the_dead
claw Energy 120.0 4800.0 40.0 40.0 150.8
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 10.95 105.36 9.62 4.17 3.81%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 7.84 74.71 9.54 3.64 4.65%
rp_soul_reaper Runic Power 21.62 212.53 9.83 3.66 1.69%
rp_howling_blast Runic Power 119.18 1151.30 9.66 40.51 3.40%
rp_plague_strike Runic Power 30.12 290.08 9.63 11.13 3.69%
rp_empower_rune_weapon Runic Power 1.93 30.82 15.99 17.37 36.04%
rp_obliterate Runic Power 31.24 608.71 19.49 16.04 2.57%
rp_death_and_decay Runic Power 9.59 93.42 9.74 2.49 2.59%
frost_presence Runic Power 233.46 525.34 2.25 13.85 2.57%
rune_regen_all None 5681.82 156.56 0.03 8.53 5.16%
rune_regen_unholy None 1935.66 51.06 0.03 4.00 7.26%
rune_regen_blood None 1897.02 51.84 0.03 3.11 5.66%
rune_regen_frost None 1849.14 53.67 0.03 1.42 2.58%
runic_empowerment Rune 69.55 67.84 0.98 1.72 2.47%
runic_empowerment_blood Blood Rune 27.34 27.34 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 29.89 29.89 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 10.60 10.60 1.00 0.00 0.00%
empower_rune_weapon Rune 1.93 7.46 3.87 4.11 35.54%
plague_leech Rune 16.77 16.77 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 955.92 2918.66 3.05 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 6.93 6.86
Combat End Resource Mean Min Max
Health 459541.00 459541.00 459541.00
Runic Power 31.37 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 2.6%
bloodworms-Runic Power Cap 2.6%
gargoyle-Runic Power Cap 2.6%
army_of_the_dead-Runic Power Cap 2.6%
army_of_the_dead-Runic Power Cap 2.6%
army_of_the_dead-Runic Power Cap 2.6%
army_of_the_dead-Runic Power Cap 2.6%

Procs

Count Interval
hat_donor 205.1 3.4sec
runic_empowerment 67.8 6.5sec
runic_empowerment_wasted 1.7 119.0sec
oblit_killing_machine 6.3 60.9sec
frost_strike_killing_machine 66.7 6.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 113224.51
Minimum 103266.44
Maximum 123111.36
Spread ( max - min ) 19844.92
Range [ ( max - min ) / 2 * 100% ] 8.76%
Standard Deviation 2593.0731
5th Percentile 108910.81
95th Percentile 117458.58
( 95th Percentile - 5th Percentile ) 8547.77
Mean Distribution
Standard Deviation 25.9359
95.00% Confidence Intervall ( 113173.67 - 113275.34 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2014
0.1 Scale Factor Error with Delta=300 57400
0.05 Scale Factor Error with Delta=300 229600
0.01 Scale Factor Error with Delta=300 5740017
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 113224.51

Damage

Sample Data
Count 9996
Mean 47095904.63

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 446.19
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 4.21 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
9 5.00 auto_attack
A 7.83 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 7.84 pillar_of_frost
C 4.32 raise_dead
D 6.23 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 21.62 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 12.50 howling_blast,if=!dot.frost_fever.ticking
H 12.38 plague_strike,if=!dot.blood_plague.ticking
I 17.67 plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
J 11.63 howling_blast,if=buff.rime.react
K 17.51 frost_strike,if=runic_power>=88
L 0.31 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 48.29 frost_strike,if=buff.killing_machine.react
N 1.93 obliterate,if=buff.killing_machine.react&runic_power<10
O 29.30 obliterate,if=(unholy=2|frost=2|death=2)
P 108.96 howling_blast
Q 88.74 frost_strike
R 9.59 death_and_decay
S 17.74 plague_strike
T 0.00 blood_tap,if=talent.blood_tap.enabled
U 9.95 horn_of_winter
V 1.62 empower_rune_weapon

Sample Sequence

9ABCDIGHMOKOK7PPMQMOJMPPMPOQQPQIGHMPPQOJPPQQMOJPPRUVPPPP9KQMQOIGABHMPQQQSPMPSQSMPSPQRMUPQIDOPPQPQPQPMPSQOJMPMPSQUPIGHPQPQPMPACBMQPQRPMPQ7PUPP9QQOIGHOPQQQPQPQPPQPQRSQOPQPQIDPQPPQPMPSMSPAPMBQPQSQPPQNIGMHPPQPQQRQPPMSUQPPPQQIGPP9HQPQMPSPPQPQPQPMOPACMBIDMOJOPQ7QPMRQPPQSMUPPQQPIGHMPPQPQSQPPQSQRUQPEQPQIGEHPPU9ABEKQQQOQQEPQRIDEMPMNJQUSEPQQSEMPPQPIEHGMPMEQPQPPEMCQPQREPQABQQ7IEHMGPQSQUSEMPPQMVEOJOKPQEIDMOJEKOKPPKQQMREQPQPQSUQEIGHMPQSAB8MQESQSEMPQUREI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21648 19252 18124
Agility 218 208 80
Stamina 22367 20334 20143
Intellect 121 115 80
Spirit 151 151 80
Health 459541 431079 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.79% 15.79% 2800
Spell Crit 9.13% 4.12% 2468
Spell Haste 15.72% 10.21% 4338
Mana Per 5 0 0 0
Attack Power 47901 38754 0
Melee Hit 8.24% 8.24% 2800
Melee Crit 14.14% 9.13% 2468
Melee Haste 10.21% 10.21% 4338
Swing Speed 45.47% 32.25% 4338
Expertise 7.55% / 7.55% 7.55% / 7.55% 2567
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.19% 5.56% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 46.44% 36.44% 6133

Gear

Average Item Level: 507.81
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_mastery
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=crit_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160mastery_80str_160mastery_120crit,enchant=80all,reforge=crit_mastery
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160mastery_80str_160hit_160str_120haste
Legs greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit
Feet impaling_treads,id=86979,gems=160str,enchant=175haste,reforge=hit_exp
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str,reforge=haste_mastery
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_mastery
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
Main Hand kilrak_jaws_of_terror,id=87173,gems=500str,enchant=rune_of_razorice,reforge=hit_haste
Off Hand kilrak_jaws_of_terror,id=87173,enchant=rune_of_the_fallen_crusader,reforge=hit_haste
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_1h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
actions+=/howling_blast,if=buff.rime.react
actions+=/frost_strike,if=runic_power>=88
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react&runic_power<10
actions+=/obliterate,if=(unholy=2|frost=2|death=2)
actions+=/howling_blast
actions+=/frost_strike
actions+=/death_and_decay
actions+=/plague_strike
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_mastery
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160mastery_80str_160mastery_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160mastery_80str_160hit_160str_120haste
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit
feet=impaling_treads,id=86979,gems=160str,enchant=175haste,reforge=hit_exp
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str,reforge=haste_mastery
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=rune_of_razorice,reforge=hit_haste
off_hand=kilrak_jaws_of_terror,id=87173,enchant=rune_of_the_fallen_crusader,reforge=hit_haste

# Gear Summary
# gear_strength=18124
# gear_agility=80
# gear_stamina=20143
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2567
# gear_hit_rating=2800
# gear_crit_rating=2468
# gear_haste_rating=4338
# gear_mastery_rating=6133
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_razorice
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_2h_T14H : 111409 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
111408.9 111408.9 57.37 / 0.05% 4783 / 4.3% 14275.2 7.1 7.2 Runic Power 13.36% 53.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://5.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:170493|149048|77738|68195|27627|13472&chds=0,340985&chco=9482C9,C79C6E,0070DE,0070DE,C79C6E,C79C6E&chm=t++170493++soul_reaper,9482C9,0,0,15|t++149048++obliterate,C79C6E,1,0,15|t++77738++frost_strike,0070DE,2,0,15|t++68195++howling_blast,0070DE,3,0,15|t++27627++plague_strike,C79C6E,4,0,15|t++13472++melee_main_hand,C79C6E,5,0,15&chtt=Death_Knight_Frost_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:36,28,12,8,7,5,3,3,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,0070DE,C79C6E,9482C9,0070DE,0070DE,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|melee_main_hand|soul_reaper|howling_blast|frost_fever|blood_plague|army_of_the_dead: melee|ghoul: melee|army_of_the_dead: claw|ghoul: claw|plague_strike&chtt=Death_Knight_Frost_2h_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:012234555656777765431zyxwutrpommlkjhfdcaYXWWWVVVVVTSSTTTVWYZacddeddddddefedddcccbaaZZZZYYYXXXXXXXWWWWWWWWWWWWWVUUVVVWWXXXWVUTSRTTUUVWXXWXWWWWXXYZbcdcccbbbbaaaaaZaZZZZZZZZYXWWXXXXYYXXXYYYYYYYYYZaaaZZZYYYYYYWVUTSRQQQQQRRRRRRRSSSTUVWXXYXYYYYYYZZZaaaabbbcddeeeeeddddccbbbbaaaZZZZZZZZZZZZZZZZZZZZYXVUTSSSTTTVUVVVVWWWXYZbcdefeeedccbbbaZZZZZZZZZZaaaabbbccccdccbbbcccddeeefffggghhiijkkjjjiihhgfffeedddcccccccccbbbcccccccbbaaaabbbbccccccccddddeeeeeeeddcccbbbbaaaaaZZZZZZZZZZZZZZZZZZZYYYYZZabbccddeeffghhijjjjjiiihhgfffeeddcccbbaaaaaaaaaaaaaaaZZYYXXXWWWWVVVUUUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=111409|max=240646&chxp=1,1,46,100&chtt=Death_Knight_Frost_2h_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,6,7,9,11,26,42,51,82,97,113,174,227,283,313,392,475,510,507,558,568,583,589,577,521,518,458,396,385,291,253,208,186,143,122,80,61,51,32,24,20,10,12,9,5,0,2,3,2&chds=0,589&chbh=5&chxt=x&chxl=0:|min=101435|avg=111409|max=123040&chxp=0,1,46,100&chtt=Death_Knight_Frost_2h_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:37.0,24.3,10.9,5.0,3.4,1.8,1.7,1.6,1.0,13.4&chds=0,100&chdls=ffffff&chco=0070DE,C79C6E,0070DE,9482C9,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,ffffff&chl=frost_strike 166.6s|obliterate 109.6s|howling_blast 49.1s|soul_reaper 22.7s|horn_of_winter 15.3s|outbreak 8.2s|plague_strike 7.8s|plague_leech 7.0s|raise_dead 4.5s|waiting 60.2s&chtt=Death_Knight_Frost_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T14H 111409
blood_fury 0 0.0% 4.2 120.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.21 4.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 3288 3.0% 15.4 30.15sec 96036 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.5 9694 19412 10612 9.4% 0.0% 92.9%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.42 15.42 139.52 139.52 0.0000 3.0000 1480573.38 1480573.38 0.00 3537.33 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.3 90.56% 9694.26 7106 15358 9701.68 8341 10632 1224812 1224812 0.00
crit 13.2 9.44% 19412.23 14212 30715 19422.63 15245 25825 255761 255761 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 309.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 1.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4596 4.1% 55.3 8.14sec 37440 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.7 13254 26511 14510 9.5% 0.0% 95.0%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.29 55.29 142.66 142.66 0.0000 3.0000 2069925.37 2069925.37 0.00 4836.66 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.1 90.53% 13254.35 9661 20928 13259.25 11911 14483 1711723 1711723 0.00
crit 13.5 9.47% 26511.31 19322 41856 26525.23 20732 33040 358202 358202 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 28763 25.8% 160.8 2.78sec 80575 77738 60506 124681 80575 31.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 160.78 160.78 0.00 0.00 1.0365 0.0000 12955018.00 12955018.00 0.00 77738.35 77738.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.50 68.73% 60506.34 53152 77400 60516.97 58695 62206 6686169 6686169 0.00
crit 50.28 31.27% 124680.73 109492 159443 124704.86 118946 132758 6268849 6268849 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 15.7 28.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.75 15.75 0.00 0.00 0.9707 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 7441 6.7% 47.4 9.38sec 70685 68195 64199 132066 70685 9.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.40 47.40 0.00 0.00 1.0365 0.0000 3350301.78 3350301.78 0.00 68195.36 68195.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.87 90.44% 64198.58 47333 102933 64227.23 57983 70334 2752029 2752029 0.00
crit 4.53 9.56% 132065.76 97507 212041 130404.70 0 202056 598273 598273 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 12486 11.2% 190.7 2.36sec 29516 13472 27002 55614 29516 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.67 190.67 0.00 0.00 2.1910 0.0000 5627750.27 5627750.27 0.00 13471.61 13471.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.35 61.55% 27001.68 23655 35032 27007.86 26272 27783 3168616 3168616 0.00
crit 27.55 14.45% 55614.11 48729 72166 55626.73 52179 60197 1532086 1532086 0.00
glance 45.77 24.01% 20254.26 17741 26274 20259.00 19257 21434 927048 927048 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 36278 32.6% 105.7 4.25sec 154488 149048 114270 235066 154488 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.73 105.73 0.00 0.00 1.0365 0.0000 16334726.50 16334726.50 0.00 149047.63 149047.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.53 66.71% 114269.75 100376 146169 114290.78 111020 118160 8059618 8059618 0.00
crit 35.20 33.29% 235065.72 206775 301107 235111.43 222919 250795 8275108 8275108 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power<=76
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.22
outbreak 0 0.0% 7.9 60.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.89 7.89 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 60.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 7.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 6.7 61.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.74 6.74 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 478 0.4% 7.5 59.62sec 28633 27627 24879 51290 28633 14.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 7.53 0.00 0.00 1.0364 0.0000 215549.67 215549.67 0.00 27627.49 27627.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.46 85.79% 24878.56 23221 32741 24874.38 23656 28285 160668 160668 0.00
crit 1.07 14.21% 51290.13 47836 69319 34970.58 0 64921 54882 54882 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.3 120.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
soul_reaper 8602 7.7% 21.9 7.26sec 176709 170493 27139 55899 31290 14.4% 0.0% 0.0% 0.0% 21.2 130955 269928 150107 14.4% 0.6% 23.5%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.90 21.90 21.22 21.22 1.0365 5.0000 3870182.23 3870182.23 0.00 30051.03 170492.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.74 85.57% 27139.25 23655 35032 27148.51 25493 28841 508606 508606 0.00
crit 3.16 14.43% 55898.80 48729 72166 53956.67 0 72166 176689 176689 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.0 85.04% 130954.87 111708 176856 130978.77 121260 140247 2362978 2362978 0.00
crit 3.0 14.35% 269928.37 230119 364322 258868.94 0 364322 821910 821910 0.00
dodge 0.1 0.60% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 8649 / 4592
claw 3088 1.5% 84.4 5.59sec 8739 0 7639 15276 8739 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.35 84.35 0.00 0.00 0.0000 0.0000 737193.68 737193.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.20 85.59% 7639.01 5817 11678 7640.87 7122 8128 551533 551533 0.00
crit 12.15 14.41% 15275.76 11634 23356 15281.96 12734 21599 185661 185661 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 5562 2.7% 199.6 2.20sec 6657 5604 6143 12279 6657 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.60 199.60 0.00 0.00 1.1880 0.0000 1328808.84 1328808.84 0.00 5603.93 5603.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.95 61.60% 6142.51 4653 9342 6143.85 5771 6582 755237 755237 0.00
crit 28.73 14.39% 12279.42 9307 18684 12281.60 10840 14107 352761 352761 0.00
glance 47.92 24.01% 4607.50 3490 7007 4608.65 4167 5221 220811 220811 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 61942 / 4885
claw 22749 1.6% 127.8 2.49sec 6228 0 5438 10881 6228 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.84 127.84 0.00 0.00 0.0000 0.0000 796230.19 796230.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.29 85.49% 5438.48 3636 6979 5438.35 4844 5741 594355 594355 0.00
crit 18.55 14.51% 10881.01 7271 13958 10882.17 7850 13303 201876 201876 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 39192 2.7% 287.6 0.95sec 4769 4957 4397 8790 4769 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 287.63 287.63 0.00 0.00 0.9620 0.0000 1371730.03 1371730.03 0.00 4957.36 4957.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.84 61.48% 4397.37 2908 5583 4397.28 3903 4685 777610 777610 0.00
crit 41.64 14.48% 8789.74 5817 11167 8789.67 7510 10041 366024 366024 0.00
glance 69.15 24.04% 3298.40 2181 4187 3298.42 2771 3647 228097 228097 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.2 0.0 120.5sec 120.5sec 13.73% 13.73%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.7%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 23.87%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 7.2 0.0 66.3sec 66.3sec 31.33% 31.33%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.3%
killing_machine 55.1 2.1 8.1sec 7.8sec 13.86% 20.61%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:13.9%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 409.1sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
pillar_of_frost 7.9 0.0 60.9sec 60.9sec 34.34% 41.35%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:34.3%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 9.5 0.0 49.8sec 49.8sec 30.98% 30.98%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.0%
rime 47.1 0.5 9.5sec 9.5sec 14.15% 14.15%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:14.2%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 8.8 49.7 51.4sec 7.6sec 85.03% 82.24%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:85.0%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.37% 17.37%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_presence

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_2h_T14H
frost_strike Runic Power 160.8 3215.7 20.0 20.0 4028.7
pet - ghoul
claw Energy 84.4 3374.1 40.0 40.0 218.5
pet - army_of_the_dead
claw Energy 127.8 5113.6 40.0 40.0 155.7
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 15.75 156.76 9.95 0.72 0.45%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 7.90 76.94 9.74 2.07 2.62%
rp_soul_reaper Runic Power 21.90 216.47 9.88 2.54 1.16%
rp_howling_blast Runic Power 0.45 4.52 9.96 0.02 0.38%
rp_plague_strike Runic Power 7.53 74.07 9.84 1.22 1.61%
rp_obliterate Runic Power 105.73 2098.10 19.84 16.60 0.79%
rp_empower_rune_weapon Runic Power 1.98 44.38 22.37 5.21 10.50%
frost_presence Runic Power 162.25 544.20 3.35 1.72 0.31%
rune_regen_all None 5709.36 163.30 0.03 9.17 5.32%
rune_regen_unholy None 1896.95 54.74 0.03 2.79 4.85%
rune_regen_blood None 1928.82 53.43 0.03 3.98 6.93%
rune_regen_frost None 1883.59 55.13 0.03 2.40 4.18%
runic_empowerment Rune 72.31 70.96 0.98 1.35 1.86%
runic_empowerment_blood Blood Rune 21.41 21.41 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 25.89 25.89 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 23.66 23.66 1.00 0.00 0.00%
empower_rune_weapon Rune 1.98 6.20 3.12 5.71 47.95%
plague_leech Rune 6.26 6.26 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 955.61 3046.29 3.19 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.51 3.96 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 7.20 7.14
Combat End Resource Mean Min Max
Health 464119.00 464119.00 464119.00
Runic Power 29.29 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.3%
bloodworms-Runic Power Cap 1.3%
gargoyle-Runic Power Cap 1.3%
army_of_the_dead-Runic Power Cap 1.3%
army_of_the_dead-Runic Power Cap 1.3%
army_of_the_dead-Runic Power Cap 1.3%
army_of_the_dead-Runic Power Cap 1.3%

Procs

Count Interval
hat_donor 119.4 3.8sec
runic_empowerment 71.0 6.3sec
runic_empowerment_wasted 1.3 47.6sec
oblit_killing_machine 23.3 18.7sec
frost_strike_killing_machine 31.7 14.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 111408.87
Minimum 101434.71
Maximum 123039.67
Spread ( max - min ) 21604.95
Range [ ( max - min ) / 2 * 100% ] 9.70%
Standard Deviation 2926.2622
5th Percentile 106801.12
95th Percentile 116367.53
( 95th Percentile - 5th Percentile ) 9566.41
Mean Distribution
Standard Deviation 29.2685
95.00% Confidence Intervall ( 111351.50 - 111466.23 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2650
0.1 Scale Factor Error with Delta=300 73098
0.05 Scale Factor Error with Delta=300 292395
0.01 Scale Factor Error with Delta=300 7309878
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 111408.87

Damage

Sample Data
Count 9996
Mean 45904027.20

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 405.04
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 4.21 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
9 5.00 auto_attack
A 7.90 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 7.90 pillar_of_frost
C 4.32 raise_dead
D 7.89 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 21.90 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 1.84 howling_blast,if=!dot.frost_fever.ticking
H 7.53 plague_strike,if=!dot.blood_plague.ticking
I 6.74 plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
J 45.56 howling_blast,if=buff.rime.react
K 104.23 obliterate,if=runic_power<=76
L 0.09 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 142.02 frost_strike,if=!buff.killing_machine.react
N 1.50 obliterate,if=buff.killing_machine.react
O 0.00 blood_tap,if=talent.blood_tap.enabled
P 18.77 frost_strike
Q 14.75 horn_of_winter
R 1.89 empower_rune_weapon

Sample Sequence

9ABCDKJNMMMMK7KJMKMMKJKMMKKMJPMKJPHPKKJPMMQKKPMMR9KKMKMKMMIABDKJNJMMMMKJKMPMQKKMMMKKPMHKJPMKMQJKMMKKMMMKCABDMQMKM79KKMKMMMQKJKMMMKIGHKJMMKMKMMQMKMKJMKJMKMIABDPKMQMKJPKMKMKJMMKMKMKJPQKMHMM9KKJPMKMJQPKMKJMKJPCIABDKMKJMKJ7MMKKJPPKMMQKJMMKMJKMIGHKJPKKJMMMKMKMKJMMEKMMQPEIABD9EMKKJMEMKMKMEKMMPKEMKMKJMEPMHKMMQPEMKKMPREKKJMMEMMKKMCIABDEMMKJMM7EKJMMKJMEMQMKMEMKMKJMEHPKMMJQEPKJMEPKJKM8EMIABDKMEMKMKMEJKJMMEKMKMMEPKMK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21600 19206 18080
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 12.44% 7.44% 4458
Spell Haste 21.27% 15.49% 6585
Mana Per 5 0 0 0
Attack Power 47795 38662 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 17.45% 12.45% 4458
Melee Haste 15.49% 15.49% 6585
Swing Speed 52.45% 38.59% 6585
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.18% 5.55% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 36.54% 26.54% 3163

Gear

Average Item Level: 507.73
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_haste
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=mastery_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160haste_80str_160haste_120crit,enchant=80all
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160haste_80str_160hit_160str_120haste,reforge=mastery_crit
Legs greaves_of_the_lost_catacomb,id=86916,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
Feet impaling_treads,id=86979,gems=80str_160haste_60hit,enchant=175haste,reforge=hit_crit
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader,reforge=mastery_haste
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_2h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
actions+=/howling_blast,if=buff.rime.react
actions+=/obliterate,if=runic_power<=76
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=!buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/frost_strike
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160haste_80str_160haste_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160haste_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=80str_160haste_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader,reforge=mastery_haste

# Gear Summary
# gear_strength=18080
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=4458
# gear_haste_rating=6585
# gear_mastery_rating=3163
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_T14H : 110917 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
110916.7 110916.7 47.13 / 0.04% 3974 / 3.6% 13522.9 6.2 6.3 Runic Power 14.13% 58.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

Charts

http://9.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:228790|71480|59180|56410|13133&chds=0,457581&chco=9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++228790++soul_reaper,9482C9,0,0,15|t++71480++scourge_strike,C79C6E,1,0,15|t++59180++death_coil,9482C9,2,0,15|t++56410++festering_strike,C79C6E,3,0,15|t++13133++melee_main_hand,C79C6E,4,0,15&chtt=Death_Knight_Unholy_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,19,14,14,12,10,7,6,5,5,5,3,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,0070DE,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,0070DE&chl=scourge_strike|death_coil|melee_main_hand|soul_reaper|ghoul: melee|blood_plague|frost_fever|ghoul: sweeping_claws|festering_strike|gargoyle: gargoyle_strike|army_of_the_dead: melee|army_of_the_dead: claw|ghoul: claw|plague_strike|icy_touch&chtt=Death_Knight_Unholy_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vwy002223224457786654321zywusqponmkjhfecaYXVVTTTTSRRRRRRRRSTTUVVVUUUUUVWWWWVVVVVUVVUUUUUUUUUUUUTTTTTTTSTSSSSSSRRRRRSSSTSSSRRQQQQQQRSSSSSSRSRSSSTUUVVVVVVVUUUUUUUTTTTTTTSSSRRQQQRRRRSSTTUUVVWWXYZaabccccdddddccbaZYXWWVVVUUUUTTSSSRRSSTTTUUUUUUUUUUUUUUVVVVVWWXWWWWWWVWVVVVVVVVVVUVVVVVVVVVVVVVVVVVVUTTSRRQQQQRSSSSSSTTUUVVXXYZZZZZZYYYYYYYXYYYYYYYYYYYYZZZZZZZZZZYYYYYZaaabbcddeeefgghiijjkjjjjjjiihhhggfffeeddcccbbaaaaZZZZYYYYYYYYYYYZYZZZZZZZZaaaaaaaaaZaZZZZZZZZZZZYZYZZZZZZYZZZZZZZYYYXYYYYZZZZZaaabbbbbccddddcccccbbbbaaaaaaaaaaaaaZZZZZZZYYYYXXWWVVVVUUUTTTSSSSR&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110917|max=266016&chxp=1,1,42,100&chtt=Death_Knight_Unholy_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,0,1,2,1,10,13,12,32,45,62,94,146,151,185,266,320,343,437,471,505,540,531,556,552,578,515,512,484,420,359,353,304,242,229,170,135,115,79,79,45,37,16,17,14,5,4,6,1&chds=0,578&chbh=5&chxt=x&chxl=0:|min=101977|avg=110917|max=119390&chxp=0,1,51,100&chtt=Death_Knight_Unholy_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.2,26.7,8.1,5.0,3.8,2.0,1.8,1.6,0.7,14.1&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=scourge_strike 163.2s|death_coil 120.2s|festering_strike 36.6s|soul_reaper 22.6s|horn_of_winter 17.1s|dark_transformation 9.2s|outbreak 8.2s|plague_leech 7.2s|summon_gargoyle 3.1s|waiting 63.6s&chtt=Death_Knight_Unholy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Unholy_T14H 110917
blood_fury 0 0.0% 4.3 120.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=2
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 8386 7.6% 7.9 60.60sec 475742 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.3 23541 47090 26557 12.8% 0.0% 94.7%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 142.25 142.25 0.0000 3.0000 3777757.23 3777757.23 0.00 8852.27 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.0 87.19% 23540.72 19324 33635 23544.32 22010 25003 2919843 2919843 0.00
crit 18.2 12.81% 47090.29 38647 67270 47095.09 41469 53752 857914 857914 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 45.8 9.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.78 45.78 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 45.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.blood_tap.enabled
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:(null)
  • description:Each damaging Death Coil, Frost Strike, or Rune Strike generates 2 Blood Charges, up to a maximum of $114851u charges. Blood Tap consumes $114851s1 Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 8.9 51.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.90 8.90 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 15785 14.3% 115.9 3.85sec 61339 59180 53944 111122 61339 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.93 115.93 0.00 0.00 1.0365 0.0000 7111341.34 7111341.34 0.00 59179.81 59179.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.94 87.07% 53943.67 44204 76353 53957.81 51517 56180 5445018 5445018 0.00
crit 15.00 12.93% 111121.55 91061 157286 111153.99 96440 127959 1666323 1666323 0.00
DPS Timeline Chart

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>90
Spelldata
  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $<damage> Shadow damage to an enemy target or healing $<healing> damage on a friendly Undead target$?s58677[. Refunds $58677s1 Runic Power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.496000
  • base_dd_min:1132.89
  • base_dd_max:1132.89
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 2.0 308.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 4588 4.1% 35.3 12.83sec 58466 56410 49154 101276 58466 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.31 35.31 0.00 0.00 1.0365 0.0000 2064420.94 2064420.94 0.00 56409.57 56409.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.00 82.13% 49154.37 44846 58807 49160.20 47494 50800 1425541 1425541 0.00
crit 6.31 17.87% 101275.77 92383 121143 101157.98 0 121143 638880 638880 0.00
DPS Timeline Chart

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:blood=2&frost=2&runic_power<90
Spelldata
  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.65
  • base_dd_max:539.65
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
frost_fever 5684 5.1% 7.9 60.60sec 322430 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.2 15941 31888 17999 12.9% 0.0% 94.7%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 142.25 142.25 0.0000 3.0000 2560342.26 2560342.26 0.00 5999.70 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.9 87.09% 15940.72 13077 22797 15942.98 14950 17025 1974873 1974873 0.00
crit 18.4 12.91% 31888.22 26153 45594 31893.15 28050 36374 585469 585469 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
horn_of_winter 0 0.0% 17.5 25.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.47 17.47 0.00 0.00 0.9771 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 17.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
icy_touch 0 0.0% 0.0 1.#Rsec 21003 0 21003 0 21003 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 6.30 6.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 100.00% 21003.12 19157 21926 6.30 0 21926 6 6 0.00
DPS Timeline Chart

Action details: icy_touch

Static Values
  • id:45477
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:45477
  • name:Icy Touch
  • school:frost
  • tooltip:(null)
  • description:Chills the target for ${(($m1+$M1)/2)+($AP*0.319)} Frost damage$?s58631[, dispels $s3 beneficial Magic effect,][] and infects them with Frost Fever, a disease that deals periodic frost damage for $55095d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.319000
  • base_dd_min:559.06
  • base_dd_max:607.47
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 12173 11.0% 192.4 2.33sec 28496 13133 25231 51984 28496 17.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.43 192.43 0.00 0.00 2.1699 0.0000 5483430.85 5483430.85 0.00 13132.74 13132.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.74 58.07% 25230.82 22880 30495 25236.55 24606 25882 2819176 2819176 0.00
crit 34.40 17.88% 51983.66 47132 62819 51995.23 49782 54563 1788173 1788173 0.00
glance 46.29 24.06% 18925.32 17160 22871 18929.44 18358 19795 876082 876082 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 7.9 60.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_leech 0 0.0% 7.0 60.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.96 6.96 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 0 0.0% 0.0 1.#Rsec 23288 0 23288 0 23288 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 6.99 6.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 100.00% 23288.33 22371 23747 6.99 0 23747 7 7 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
scourge_strike 25903 23.4% 157.4 2.85sec 74090 71480 33576 72364 37045 8.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.41 314.83 0.00 0.00 1.0365 0.0000 11662779.47 11662779.47 0.00 71480.19 71480.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.68 91.06% 33576.45 24822 67027 33590.13 32012 36074 9625621 9625621 0.00
crit 28.15 8.94% 72363.97 66154 86717 72373.08 69314 77493 2037159 2037159 0.00
DPS Timeline Chart

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:unholy=2&runic_power<90
Spelldata
  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:588.25
  • base_dd_max:588.25
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
soul_reaper 11473 10.4% 21.8 7.30sec 237141 228790 25255 52005 30037 17.9% 0.0% 0.0% 0.0% 21.1 181053 372899 213825 17.7% 0.6% 23.4%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.79 21.79 21.10 21.10 1.0365 5.0000 5167001.65 5167001.65 0.00 40334.43 228790.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.89 82.12% 25254.63 22880 30495 25257.87 24218 26292 451900 451900 0.00
crit 3.89 17.88% 52005.06 47132 62819 51105.16 0 62819 202558 202558 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.2 81.72% 181052.88 161106 225304 181071.51 171650 190013 3122565 3122565 0.00
crit 3.7 17.66% 372899.48 331878 464126 366396.33 0 464126 1389979 1389979 0.00
dodge 0.1 0.61% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130736
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130736
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
summon_gargoyle 0 0.0% 3.0 181.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
unholy_frenzy 0 0.0% 3.0 180.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unholy_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unholy_frenzy

Static Values
  • id:49016
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Unholy_T14H
  • harmful:false
  • if_expr:time>=4
Spelldata
  • id:49016
  • name:Unholy Frenzy
  • school:physical
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - gargoyle 21432 / 4132
gargoyle_strike 21432 3.7% 34.6 11.11sec 53457 24720 45314 90619 53457 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.56 34.56 0.00 0.00 2.1625 0.0000 1847212.68 1847212.68 0.00 24719.81 24719.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.34 82.03% 45314.31 34953 60918 45339.82 40723 50201 1284409 1284409 0.00
crit 6.21 17.97% 90618.67 69907 121836 90533.10 0 121836 562804 562804 0.00
DPS Timeline Chart

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:51963
  • name:Gargoyle Strike
  • school:nature
  • tooltip:(null)
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.826000
  • base_dd_min:623.15
  • base_dd_max:623.15
pet - ghoul 16386 / 16386
claw 1958 1.8% 74.3 6.13sec 11836 0 10047 20087 11836 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.33 74.33 0.00 0.00 0.0000 0.0000 879827.88 879827.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.09 82.18% 10047.38 6596 20555 10052.20 9106 10994 613806 613806 0.00
crit 13.24 17.82% 20086.86 13192 33784 20095.61 15555 26512 266022 266022 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 9732 8.8% 371.5 1.21sec 11791 9738 10538 21079 11791 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 371.53 371.53 0.00 0.00 1.2109 0.0000 4380621.17 4380621.17 0.00 9737.57 9737.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 215.97 58.13% 10538.04 5277 17458 10538.87 9827 11245 2275934 2275934 0.00
crit 66.44 17.88% 21079.20 10554 34916 21080.93 18587 23725 1400544 1400544 0.00
glance 89.11 23.99% 7901.72 3958 13094 7902.20 7126 8722 704144 704144 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
sweeping_claws 4696 4.2% 96.7 4.41sec 21864 21094 18547 37082 21864 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.73 96.73 0.00 0.00 1.0365 0.0000 2114858.79 2114858.79 0.00 21094.38 21094.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.41 82.10% 18546.93 15831 26187 18546.09 17363 19884 1472894 1472894 0.00
crit 17.31 17.90% 37082.00 31662 52374 37074.00 33776 41877 641964 641964 0.00
DPS Timeline Chart

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91778
  • name:Sweeping Claws
  • school:physical
  • tooltip:(null)
  • description:Rakes an enemy with deformed claws, dealing $91778s1% of normal damage to the target and up to ${$91778x1-1} additional targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
pet - army_of_the_dead 81257 / 6408
claw 32330 2.3% 175.8 1.70sec 6437 0 5461 10921 6437 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.79 175.79 0.00 0.00 0.0000 0.0000 1131543.83 1131543.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.35 82.12% 5460.51 4123 6820 5460.50 4913 5697 788237 788237 0.00
crit 31.44 17.88% 10920.91 8245 13639 10919.95 9347 12549 343307 343307 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 48927 3.4% 345.9 0.78sec 4951 6207 4424 8850 4951 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 345.90 345.90 0.00 0.00 0.7976 0.0000 1712435.55 1712435.55 0.00 6207.29 6207.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 200.80 58.05% 4423.95 3298 5456 4424.03 3909 4720 888351 888351 0.00
crit 61.94 17.91% 8850.40 6596 10911 8850.58 7727 9644 548156 548156 0.00
glance 83.16 24.04% 3318.04 2474 4092 3318.24 2921 3633 275929 275929 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_charge 21.6 94.4 21.1sec 3.8sec 85.38% 85.38%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • blood_charge_1:14.1%
  • blood_charge_2:18.2%
  • blood_charge_3:18.0%
  • blood_charge_4:19.6%
  • blood_charge_5:6.9%
  • blood_charge_6:6.8%
  • blood_charge_7:0.8%
  • blood_charge_8:0.6%
  • blood_charge_9:0.2%
  • blood_charge_10:0.1%
  • blood_charge_11:0.1%
  • blood_charge_12:0.1%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:$@spelldesc45529
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:1.01%
blood_fury 4.3 0.0 120.6sec 120.6sec 14.06% 14.06%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 22.64%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_transformation 8.9 0.0 51.1sec 51.1sec 57.29% 57.05%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_transformation_1:57.3%

Spelldata details

  • id:63560
  • name:Dark Transformation
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
darkmist_vortex 7.1 0.0 67.6sec 67.6sec 30.78% 30.78%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:30.8%
mogu_power_potion 2.0 0.0 424.0sec 0.0sec 9.52% 9.52%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:9.5%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 9.3 0.0 50.6sec 50.6sec 30.57% 30.57%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:30.6%
rune_of_the_fallen_crusader 10.1 38.8 45.2sec 9.1sec 80.15% 79.63%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:80.2%
shadow_infusion 9.3 38.7 50.7sec 9.2sec 36.02% 36.45%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_shadow_infusion
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_infusion_1:8.0%
  • shadow_infusion_2:8.1%
  • shadow_infusion_3:8.1%
  • shadow_infusion_4:7.8%
  • shadow_infusion_5:4.0%

Spelldata details

  • id:91342
  • name:Shadow Infusion
  • tooltip:$?$w3>0[Pet damage dealt increased by $s1%.][Damage dealt increased by $s1%.]
  • description:Grants your successful Death Coils a chance to empower your active Ghoul, increasing its damage dealt by $91342s1% for $91342d. Stacks up to 5 times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
sudden_doom 34.2 0.5 13.0sec 13.0sec 6.78% 6.78%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • sudden_doom_1:6.8%

Spelldata details

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil consumes no Runic Power.
  • description:Your autoattacks have a chance to cause your next Death Coil to consume no Runic Power.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 7.9 0.0 60.5sec 60.5sec 17.32% 17.32%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
unholy_frenzy 3.0 0.0 180.6sec 180.6sec 19.28% 100.00%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_frenzy
  • max_stacks:1
  • duration:30.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unholy_frenzy_1:19.3%

Spelldata details

  • id:49016
  • name:Unholy Frenzy
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
unholy_presence

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • unholy_presence_1:100.0%

Spelldata details

  • id:48265
  • name:Unholy Presence
  • tooltip:Attack speed and rune regeneration increased by $w1%. Movement speed increased by $s2%.
  • description:You are infused with unholy fury, increasing attack speed and rune regeneration by $s1%, and movement speed by $s2%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Unholy_T14H
death_coil Runic Power 115.9 2619.1 22.6 22.6 2715.2
summon_gargoyle Runic Power 3.0 178.1 60.0 60.0 0.0
pet - ghoul
claw Energy 74.3 2973.4 40.0 40.0 295.9
sweeping_claws Energy 96.7 3869.1 40.0 40.0 546.6
pet - army_of_the_dead
claw Energy 175.8 7031.5 40.0 40.0 160.9
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 17.47 174.67 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_soul_reaper Runic Power 21.79 216.08 9.92 1.80 0.83%
rp_icy_touch Runic Power 0.00 0.00 10.00 0.00 0.00%
rp_plague_strike Runic Power 0.00 0.00 10.00 0.00 0.00%
rp_dark_transformation Runic Power 8.90 87.88 9.88 1.10 1.24%
rp_empower_rune_weapon Runic Power 2.00 49.97 24.98 0.03 0.06%
rp_scourge_strike Runic Power 157.41 1574.15 10.00 0.00 0.00%
rp_festering_strike Runic Power 35.31 698.08 19.77 8.11 1.15%
rune_regen_all None 5717.49 196.02 0.03 12.49 5.99%
rune_regen_unholy None 1868.47 67.23 0.04 2.37 3.40%
rune_regen_blood None 1957.55 62.74 0.03 6.64 9.57%
rune_regen_frost None 1891.46 66.05 0.03 3.48 5.00%
empower_rune_weapon Rune 2.00 5.94 2.97 6.06 50.48%
blood_tap Rune 45.77 45.77 1.00 0.00 0.00%
blood_tap_blood Rune 9.29 9.29 1.00 0.00 0.00%
blood_tap_frost Rune 11.05 11.05 1.00 0.00 0.00%
blood_tap_unholy Rune 25.43 25.43 1.00 0.00 0.00%
plague_leech Rune 6.70 6.70 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 1801.50 6763.51 3.75 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.30 5.71 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 6.28 6.21
Combat End Resource Mean Min Max
Health 464119.00 464119.00 464119.00
Runic Power 33.85 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.5%
bloodworms-Runic Power Cap 0.5%
gargoyle-Runic Power Cap 0.5%
army_of_the_dead-Runic Power Cap 0.5%
army_of_the_dead-Runic Power Cap 0.5%
army_of_the_dead-Runic Power Cap 0.5%
army_of_the_dead-Runic Power Cap 0.5%

Procs

Count Interval
hat_donor 72.4 6.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 110916.71
Minimum 101976.68
Maximum 119390.44
Spread ( max - min ) 17413.76
Range [ ( max - min ) / 2 * 100% ] 7.85%
Standard Deviation 2404.1392
5th Percentile 107056.66
95th Percentile 115004.29
( 95th Percentile - 5th Percentile ) 7947.63
Mean Distribution
Standard Deviation 24.0462
95.00% Confidence Intervall ( 110869.58 - 110963.84 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1804
0.1 Scale Factor Error with Delta=300 49340
0.05 Scale Factor Error with Delta=300 197361
0.01 Scale Factor Error with Delta=300 4934042
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 110916.71

Damage

Sample Data
Count 9996
Mean 37827087.02

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 442.61
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=unholy
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 raise_dead
7 0.00 mogu_power_potion
Default action list
# count action,conditions
8 4.30 blood_fury,if=time>=2
9 1.00 mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
A 5.00 auto_attack
B 2.97 unholy_frenzy,if=time>=4
C 7.88 use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
D 7.94 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 21.79 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 0.00 icy_touch,if=!dot.frost_fever.ticking
H 0.00 plague_strike,if=!dot.blood_plague.ticking
I 6.96 plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
J 2.97 summon_gargoyle
K 8.90 dark_transformation
L 0.08 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 3.53 scourge_strike,if=unholy=2&runic_power<90
N 5.36 festering_strike,if=blood=2&frost=2&runic_power<90
O 12.48 death_coil,if=runic_power>90
P 22.15 death_coil,if=buff.sudden_doom.react
Q 45.78 blood_tap,if=talent.blood_tap.enabled
R 153.88 scourge_strike
S 29.95 festering_strike
T 81.31 death_coil,if=cooldown.summon_gargoyle.remains>8
U 16.47 horn_of_winter
V 1.92 empower_rune_weapon

Sample Sequence

ADR8SJBCRSTVMNRPRPQRORNOKQRRRORRPROQRPRPNORQRPROQRRRORPQTTUAMNRSTQRTIDMPRCQRRORRROKTQRTSRTQRTUTSRTQRRRRTRRPQRRTURSTSRTQRTTQKRRIDP8RRCRRRTTQUARRSTRTQRSTRRPTQRURPRRTQKRTRSTRTQRUSPRRIDRRJBCRRRTQRRTSTRUSTRQRRTRRPQKRRTRTUARSSTRQROTQRRPRRTRRTQRIDR8RSCRTTPQRSTKUTQRRRTRTQRRRTRTSTRQRUTPQRPRSTTQRRRTERRETQRTIDKUCAESTRSTQEVMNRORETPQRRPETQRPRRTQETURSTESPQRRTTQEKRRTUERIDR8JBTCESTPQRRESTQRRRTUERRTRSTQETTRQRPESTKRPQETUTQRRETRTR9SPQETTRIDEQRSCRPREOTQRRRTEPQRTTKPQEPSTR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25042 22280 18240
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 15.89% 10.88% 6524
Spell Haste 14.46% 9.01% 3831
Mana Per 5 0 0 0
Attack Power 55367 44810 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 20.90% 15.89% 6524
Melee Haste 30.82% 9.01% 3831
Swing Speed 43.90% 9.01% 3831
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 7.07% 6.36% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.23% 34.73% 3531

Gear

Average Item Level: 507.73
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_crit
Neck shackle_of_eversparks,id=90508,reforge=hit_crit
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=mastery_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160crit_80str_160crit_120crit,enchant=80all
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160crit_80str_160hit_160str_120haste,reforge=mastery_crit
Legs greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit,reforge=mastery_crit
Feet impaling_treads,id=86979,gems=80str_160crit_60hit,enchant=175haste,reforge=hit_crit
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=haste_crit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Unholy_T14H"
origin="unknown"
level=90
race=orc
spec=unholy
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=unholy
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=2
actions+=/mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
actions+=/auto_attack
actions+=/unholy_frenzy,if=time>=4
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/icy_touch,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
actions+=/summon_gargoyle
actions+=/dark_transformation
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/scourge_strike,if=unholy=2&runic_power<90
actions+=/festering_strike,if=blood=2&frost=2&runic_power<90
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil,if=cooldown.summon_gargoyle.remains>8
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=haste_crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160crit_80str_160crit_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160crit_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit,reforge=mastery_crit
feet=impaling_treads,id=86979,gems=80str_160crit_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_strength=18240
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=6524
# gear_haste_rating=3831
# gear_mastery_rating=3531
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T14H : 99073 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99072.6 99072.6 50.78 / 0.05% 4221 / 4.3% 23.4 4235.8 4174.7 Mana 0.00% 44.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
Glyphs
  • moonbeast

Charts

http://9.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:313792|147508|75920|49501&chds=0,627584&chco=69CCF0,8AD0B1,69CCF0,ABD473&chm=t++313792++starfall,69CCF0,0,0,15|t++147508++starsurge,8AD0B1,1,0,15|t++75920++starfire,69CCF0,2,0,15|t++49501++wrath,ABD473,3,0,15&chtt=Druid_Balance_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:28,18,15,13,13,12,1&chds=0,100&chdls=ffffff&chco=69CCF0,8AD0B1,ABD473,69CCF0,ABD473,69CCF0,ABD473&chl=starfire|starsurge|wrath|moonfire|sunfire|starfall|wild_mushroom_detonate&chtt=Druid_Balance_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:mmpqrtuvwxx0134568310yxuspnljhedcbaYWUTSRQPPPPQQQQQQQQQRRRRRSSSTTTTTTTSSSRRRRRRRSSSSTTTTTTSSSSSSRRRQQQPPPPPPPPPPQQQRRSSSSSSRRQQPPPPPPOOOONNNNNNOOOPPQQQQQQRRRRSSSSTTTTTTTTTSSSSRRRRRSSSTTUVWXYabdefgijkklllmllkjigfecbaZYXWVUTSRQQQQQQQQQQQQQPPPPPPPQQQQQQRRRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSRRQPPOONNNNMMMMMMMMMMMNOPPQRRSSSTTTTTUUUUUUUTTTSSSRRRQQQQQQQQQQQQQRRSTTUVVWWXXYZZabcdeeffgghhhhhggffedcbbaZYXWVUTTSSSSSSSSSSSSRRRRRRRRQQQQQQQQQQQQRRRRRSSSSSSSTTSSSSSSSRRRRRRRRRRRRRRRRRSSSSSSSSSSSSSRRRRQQQQQQQPQQQQQQQRRRRRSSSSSSSSSSSSSSRRRRRRQQQQQQQQQQQQQQQQQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=99073|max=280057&chxp=1,1,35,100&chtt=Druid_Balance_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,2,5,9,17,24,49,83,99,156,220,278,347,389,463,525,577,594,624,632,626,574,585,489,440,437,343,303,258,224,151,113,92,69,62,44,32,17,13,8,11,4,2,0,2,1,0,0,1&chds=0,632&chbh=5&chxt=x&chxl=0:|min=90389|avg=99073|max=110954&chxp=0,1,42,100&chtt=Druid_Balance_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.2,29.0,12.1,6.8,6.1,4.7,3.8,0.7&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,ABD473,69CCF0,C79C6E&chl=starfire 162.9s|wrath 130.8s|starsurge 54.3s|moonfire 30.8s|sunfire 27.6s|wild_mushroom 21.0s|starfall 17.3s|incarnation 3.1s&chtt=Druid_Balance_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Balance_T14H 99073
berserking 0 0.0% 3.0 180.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
moonfire 13351 13.5% 27.9 16.26sec 214903 195258 15397 32105 19183 22.7% 0.0% 0.0% 0.0% 317.1 13865 28850 17247 22.6% 0.0% 95.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.94 27.94 317.11 317.11 1.1006 1.3574 6005357.40 6005357.40 0.00 13020.73 195258.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.61 77.34% 15397.34 9490 39441 15413.96 12690 18564 332783 332783 0.00
crit 6.33 22.66% 32105.30 19549 72767 32138.53 0 56034 203273 203273 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 245.5 77.43% 13864.53 9072 26274 13879.76 12783 15233 3404165 3404165 0.00
crit 71.6 22.57% 28849.97 18688 54124 28889.65 24616 34520 2065137 2065137 0.00
DPS Timeline Chart

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional $o1 Arcane damage over $d.$?s79577[ Your Starfire and Starsurge critical strikes on the target will extend your Moonfire's duration by $8921t1 sec.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 12069 12.2% 15.7 30.93sec 345402 313792 0 0 0 0.0% 0.0% 0.0% 0.0% 155.2 28009 58377 34945 22.8% 0.0% 34.4%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.70 15.70 155.17 155.17 1.1007 1.0000 5422326.24 5422326.24 0.00 31443.62 313792.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.7 77.16% 28009.31 15267 44014 28042.35 25696 30248 3353456 3353456 0.00
crit 35.4 22.84% 58376.91 31450 90668 58454.60 50635 68565 2068870 2068870 0.00
DPS Timeline Chart

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:19560.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.starfall.up
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:(null)
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.330000
  • base_dd_min:533.66
  • base_dd_max:620.20
starfire 27489 27.7% 88.1 5.01sec 140343 75920 112504 235140 140343 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.14 88.14 0.00 0.00 1.8486 0.0000 12369774.26 12369774.26 0.00 75920.32 75920.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.13 77.30% 112503.88 68839 197774 112675.51 99987 124593 7665087 7665087 0.00
crit 20.01 22.70% 235140.28 141808 407415 235544.58 173246 350105 4704688 4704688 0.00
DPS Timeline Chart

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse>=60&eclipse_dir>=0
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.759000
  • base_dd_min:3466.63
  • base_dd_max:4457.10
starsurge 17816 18.0% 46.8 9.55sec 171204 147508 138069 286938 171750 22.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.82 46.68 0.00 0.00 1.1606 0.0000 8016443.07 8016443.07 0.00 147507.51 147507.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.12 77.38% 138069.05 83054 238890 138202.08 115759 162013 4986398 4986398 0.00
crit 10.56 22.62% 286938.19 171091 492113 287192.62 198395 467635 3030046 3030046 0.00
DPS Timeline Chart

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.133000
  • base_dd_min:3731.12
  • base_dd_max:5147.21
sunfire 13004 13.1% 27.7 16.34sec 211077 212372 15403 32146 19191 22.6% 0.0% 0.0% 0.0% 312.9 13685 28363 17000 22.6% 0.0% 94.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.72 27.72 312.89 312.89 0.9939 1.3619 5851286.67 5851286.67 0.00 12897.84 212372.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.45 77.37% 15402.57 9490 34454 15419.07 12894 18346 330356 330356 0.00
crit 6.27 22.63% 32145.54 19549 70976 32164.98 0 56034 201649 201649 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.2 77.41% 13685.26 9072 26274 13696.22 12094 15037 3314862 3314862 0.00
crit 70.7 22.59% 28363.18 18688 54124 28382.66 23708 33578 2004420 2004420 0.00
DPS Timeline Chart

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5400.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $s1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional $o1 Nature damage over $d. Your Wrath and Starsurge critical strikes on the target will extend your Sunfire's duration by $93402t1 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom 0 0.0% 20.2 13.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.23 20.23 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: wild_mushroom

Static Values
  • id:88747
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.wild_mushroom.stack<5
Spelldata
  • id:88747
  • name:Wild Mushroom
  • school:nature
  • tooltip:(null)
  • description:Grow magical mushrooms with $88747s1 health at the target location. After $88747s3 sec, the mushrooms will become invisible. Other Wild Mushroom abilities can target these mushrooms for additional effects. Only $88747s2 mushrooms can be placed at one time.
wild_mushroom_detonate 994 1.0% 5.0 74.70sec 88308 0 17695 37638 22306 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 19.79 0.00 0.00 0.0000 0.0000 441444.98 441444.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.21 76.88% 17695.24 0 38054 17689.59 10787 23981 269224 269224 0.00
crit 4.58 23.12% 37637.93 0 78392 37433.11 0 78392 172221 172221 0.00
DPS Timeline Chart

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:6120.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.wild_mushroom.stack>0&buff.solar_eclipse.up
Spelldata
  • id:88751
  • name:Wild Mushroom: Detonate
  • school:nature
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards, and creating a Fungal Growth in each mushroom's wake covering an area within 8 yards, slowing all enemy targets by $81281s1%, and lasting $81283d.
wrath 14350 14.5% 92.2 4.82sec 70190 49501 56919 117462 70438 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.23 91.90 0.00 0.00 1.4179 0.0000 6473268.15 6473268.15 0.00 49501.17 49501.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.38 77.67% 56919.33 40117 115304 56932.47 52258 63331 4062922 4062922 0.00
crit 20.52 22.33% 117462.08 82640 237527 117478.61 95579 149996 2410346 2410346 0.00
DPS Timeline Chart

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse<=-70&eclipse_dir<=0
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.027000
  • base_dd_min:1966.56
  • base_dd_max:2528.44

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.9sec 180.9sec 6.63% 7.60%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.85%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.9 0.0 184.6sec 184.6sec 9.37% 9.37%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • celestial_alignment_1:9.4%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Damage done by your Nature and Arcane spells increased by $w1%. Cannot gain Lunar or Solar Energy.
  • description:Grants you the simultaneous damage benefit of both your Lunar Eclipse and Solar Eclipse, increasing damage done by your Nature and Arcane spells by $s1%. In addition, casting Moonfire also applies the the periodic damage effect of Sunfire to your target. Activating this ability consumes all Lunar and Solar Energy and prevents gaining more during its duration. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
chosen_of_elune 3.0 0.0 181.3sec 181.3sec 19.29% 26.31%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chosen_of_elune_1:19.3%

Spelldata details

  • id:122114
  • name:Chosen of Elune
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 63.1sec 63.1sec 32.90% 32.90%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
jade_serpent_potion 2.0 0.0 197.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.5sec 54.5sec 22.78% 23.54%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
lunar_eclipse 13.6 0.0 34.2sec 34.2sec 42.19% 79.82%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_eclipse_1:42.2%

Spelldata details

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Damage done by your Arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Arcane spells by $s1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
lunar_shower 40.9 12.0 11.0sec 8.5sec 31.12% 21.10%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_shower
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_shower_1:23.2%
  • lunar_shower_2:8.0%
  • lunar_shower_3:0.0%

Spelldata details

  • id:81192
  • name:Lunar Shower
  • tooltip:Direct damage of your Moonfire and Sunfire increased by $s1%, and mana cost reduced by $s2%.
  • description:When you cast Moonfire or Sunfire, you gain Lunar Shower. Lunar Shower increases the direct damage done by your Moonfire and Sunfire spells by $81192s1%, and reduces the mana cost by $81192s2%. This effect stacks up to 3 times and lasts $81192d.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:1.01%
natures_grace 21.0 5.0 21.9sec 17.6sec 82.48% 82.48%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_grace_1:82.5%

Spelldata details

  • id:16886
  • name:Nature's Grace
  • tooltip:Spell casting speed increased by $s1%.
  • description:You gain $s1% spell haste each time you trigger an Eclipse.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
natures_vigil 3.0 0.0 181.3sec 181.3sec 19.24% 26.36%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_vigil_1:19.2%

Spelldata details

  • id:124974
  • name:Nature's Vigil
  • tooltip:Damage and healing done increased by $s1%. $s3% of single-target damage done heals a nearby target and $s3% of single-target healing done damages a nearby target.
  • description:Increases all damage and healing done by $s1% for $d. While active, all single-target healing spells also damage a nearby enemy target for $s3% of the healing done, and all single-target damage spells and abilities also heal a nearby friendly target for $s3% of the damage done.
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.0 0.0 52.3sec 52.3sec 29.62% 29.62%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shooting_stars 37.7 5.1 11.7sec 10.3sec 15.19% 77.48%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_shooting_stars
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • shooting_stars_1:15.2%

Spelldata details

  • id:93400
  • name:Shooting Stars
  • tooltip:Your next Starsurge spell is instant cast.
  • description:You have a $93399h% chance when you deal critical periodic damage with your Moonfire or Sunfire to instantly reset the cooldown of your Starsurge and cause its next cast within $93400d to be instant.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
solar_eclipse 13.7 0.0 33.1sec 33.1sec 37.66% 57.60%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_solar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • solar_eclipse_1:37.7%

Spelldata details

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Damage done by your Nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Nature spells by $s1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
starfall 15.7 0.0 29.6sec 30.9sec 34.53% 34.53%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • starfall_1:34.5%

Spelldata details

  • id:48505
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
  • max_stacks:
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
moonkin_form

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • moonkin_form_1:100.0%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by $24905s3%. Immune to Polymorph effects. All damage taken reduced by $24905s1%.
  • description:Shapeshift into $?s114301[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by $24905s3% and reducing all damage you take by $24905s1%.$?s116209[][ The Druid cannot cast healing spells while shapeshifted.] While in this form, you increase the spell haste of all party and raid members within $24907a1 yards by $24907s1%. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Balance_T14H
moonfire Mana 27.9 132442.9 4739.5 4739.5 45.3
starfall Mana 15.7 307064.2 19560.0 19560.0 17.7
starfire Mana 88.1 544703.7 6180.0 6180.0 22.7
starsurge Mana 46.8 289372.5 6180.0 6180.0 27.7
sunfire Mana 27.7 139230.8 5022.6 5022.6 42.0
wild_mushroom_detonate Mana 5.0 30593.3 6120.0 6120.0 14.4
wrath Mana 92.2 464816.0 5040.0 5040.0 13.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 670187.64 372.02 5375.31 0.80%
eclipse Mana 26.03 1210504.42 46506.15 1522531.30 55.71%
Resource RPS-Gain RPS-Loss
Mana 4174.70 4235.81
Combat End Resource Mean Min Max
Health 462677.00 462677.00 462677.00
Mana 272602.57 231285.00 300000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%

Procs

Count Interval
hat_donor 142.3 3.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 99072.61
Minimum 90389.05
Maximum 110954.34
Spread ( max - min ) 20565.29
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 2590.4932
5th Percentile 95033.37
95th Percentile 103474.38
( 95th Percentile - 5th Percentile ) 8441.01
Mean Distribution
Standard Deviation 25.9101
95.00% Confidence Intervall ( 99021.83 - 99123.40 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2626
0.1 Scale Factor Error with Delta=300 57286
0.05 Scale Factor Error with Delta=300 229144
0.01 Scale Factor Error with Delta=300 5728601
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 99072.61

Damage

Sample Data
Count 9996
Mean 44579900.77

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 337.28
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 moonkin_form
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
8 15.70 starfall,if=!buff.starfall.up
9 0.00 treants,if=talent.force_of_nature.enabled
A 2.99 berserking
B 5.00 wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
C 0.00 natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
D 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
E 2.97 incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
F 2.85 celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
G 2.96 natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
H 11.28 wrath,if=eclipse<=-70&eclipse_dir<=0
I 11.39 starfire,if=eclipse>=60&eclipse_dir>=0
J 14.80 moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
K 11.31 sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
L 13.14 moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
M 13.63 sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
N 46.95 starsurge
O 17.21 starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
P 0.48 wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
Q 61.60 starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
R 81.78 wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
S 0.00 moonfire,moving=1,if=!dot.sunfire.ticking
T 0.00 sunfire,moving=1,if=!dot.moonfire.ticking
U 20.23 wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
V 0.00 starsurge,moving=1,if=buff.shooting_stars.react
W 0.00 moonfire,moving=1,if=buff.lunar_eclipse.up
X 0.00 sunfire,moving=1

Sample Sequence

8AHEGJMNQJQQ8QFBJONOOOO8OOONQMLQIKNRNRRRRRUUULUURRH8JMNQQNQQNIBKRLRRRNRRNRRH8JQQQQMNQQIKLNRRRRRRNRN8JQMNUUNUUUQQQQIBKLNRRRRRRRRH8JNQMQQQQQIAEGKLNRRNRRRF78JNOOOOOOPRRN8JNMUUUUQQQQQNIBKLRRRRRRRNRH8JMQQQQQQNIKNRLRRRRRRRH8JNQMNQNQUUUUUNUQIBKLRRRRRNRRRH8JQQQQMNQNIKRRRRRLNRNRRH8AEGJMQQQNQF8JNONOOOOOQQIKLNRNRRRNRNH8JQMQQQQNQIKRLRRNRRRRRH8JQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 186 177 80
Stamina 22591 20537 20418
Intellect 20858 18565 18400
Spirit 4511 4511 4322
Health 462677 433921 0
Mana 300000 300000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 31630 26462 7907
Spell Hit 15.17% 15.17% 835
Spell Crit 24.85% 18.95% 5862
Spell Haste 16.79% 11.23% 4771
Mana Per 5 7500 7500 0
Attack Power 499 445 0
Melee Hit 15.17% 15.17% 835
Melee Crit 22.40% 17.39% 5862
Melee Haste 11.23% 11.23% 4771
Swing Speed 22.35% 11.23% 4771
Expertise 0.00% 0.00% 0
Armor 18619 18619 18619
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.20% 0.19% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.81% 23.44% 2698

Gear

Average Item Level: 507.81
Head eternal_blossom_cover,id=86934,gems=burning_primal_80int_160spi_180int
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
Shoulders eternal_blossom_mantle,id=86932,gems=80int_160spi_60int,enchant=200int_100crit
Shirt empty
Chest eternal_blossom_vestment,id=86936,gems=80int_160crit_80int_160crit_180haste,enchant=80all,reforge=haste_mastery
Waist stonebound_cinch,id=87019,gems=160int_160int,reforge=haste_crit
Legs eternal_blossom_leggings,id=86935,gems=160int_60int,enchant=285int_165spi,reforge=mastery_spi
Feet asanis_uncleansed_sandals,id=90514,gems=160int,enchant=175hit
Wrists pearlescent_butterfly_wristbands,id=86996,enchant=180int,reforge=mastery_crit
Hands eternal_blossom_gloves,id=86933,enchant=170haste,reforge=haste_crit
Finger1 watersoul_signet,id=90511,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_crit
Main Hand kritak_imperial_scepter_of_the_swarm,id=86990,weapon=mace_1.90speed_1620min_3010max,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Balance_T14H"
origin="unknown"
level=90
race=troll
spec=balance
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
glyphs=moonbeast

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
actions+=/starfall,if=!buff.starfall.up
actions+=/treants,if=talent.force_of_nature.enabled
actions+=/berserking
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
actions+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions+=/incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
actions+=/celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
actions+=/natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
actions+=/wrath,if=eclipse<=-70&eclipse_dir<=0
actions+=/starfire,if=eclipse>=60&eclipse_dir>=0
actions+=/moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/starsurge
actions+=/starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
actions+=/wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
actions+=/moonfire,moving=1,if=!dot.sunfire.ticking
actions+=/sunfire,moving=1,if=!dot.moonfire.ticking
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
actions+=/starsurge,moving=1,if=buff.shooting_stars.react
actions+=/moonfire,moving=1,if=buff.lunar_eclipse.up
actions+=/sunfire,moving=1

head=eternal_blossom_cover,id=86934,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=eternal_blossom_mantle,id=86932,gems=80int_160spi_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_crit
chest=eternal_blossom_vestment,id=86936,gems=80int_160crit_80int_160crit_180haste,enchant=80all,reforge=haste_mastery
wrists=pearlescent_butterfly_wristbands,id=86996,enchant=180int,reforge=mastery_crit
hands=eternal_blossom_gloves,id=86933,enchant=170haste,reforge=haste_crit
waist=stonebound_cinch,id=87019,gems=160int_160int,reforge=haste_crit
legs=eternal_blossom_leggings,id=86935,gems=160int_60int,enchant=285int_165spi,reforge=mastery_spi
feet=asanis_uncleansed_sandals,id=90514,gems=160int,enchant=175hit
finger1=watersoul_signet,id=90511,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,weapon=mace_1.90speed_1620min_3010max,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20418
# gear_intellect=18400
# gear_spirit=4322
# gear_spell_power=7907
# gear_hit_rating=835
# gear_crit_rating=5862
# gear_haste_rating=4771
# gear_mastery_rating=2698
# gear_armor=18619
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_1.90speed_1620min_3010max,enchant=jade_spirit

Druid_Feral_T14H : 117755 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
117755.4 117755.4 52.96 / 0.04% 4436 / 3.8% 8163.0 2238.3 2238.3 1.99 / 0.09% 166 / 7.4% 157.3 14.2 14.1 Energy 38.59% 39.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
Glyphs
  • savagery

Charts

http://8.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:341723|176480|63106|27279&chds=0,683447&chco=C55D54,C79C6E,C79C6E,C79C6E&chm=t++341723++rake,C55D54,0,0,15|t++176480++ferocious_bite,C79C6E,1,0,15|t++63106++shred,C79C6E,2,0,15|t++27279++cat_melee,C79C6E,3,0,15&chtt=Druid_Feral_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:35,23,22,13,7,1,1&chds=0,100&chdls=ffffff&chco=C55D54,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=rake|rip|cat_melee|shred|ferocious_bite|symbiosis_wolf: melee|symbiosis_wolf: spirit_bite&chtt=Druid_Feral_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uv010334553566687665321zxwutsrqqpoonlkjihggfeeeccbaaaZZZZbccegggghhhiiijjjkkkkkjjihgggfggggggfgfeeeeeeeeeffeeddcccbbccddccbaaZYZZaaabbccccccbcdefghhhiijjjjiiiiiiiiiiihhhggfeeedeeeeffghiijkklmnoopppppqppoonlkihfedcccbbbbbbbbbbbbcdeefgffffeeddddddddeefffgggghhhhiiiijjjjjjiiiiihhhhiiiiiihihhhgfeedcbccbbaZZZZZZZaabcdefghghhhhiiiijjjiiihhhhhhhhhiiiiiihhhhiiiiiiiiiiihhhhhhhiijjkllmnoopqrsttuuvvvvvuutssrrqqppooonnmmllllkkkkjjjiihhgggggghhhiiiiiiijjjjjjjjjjjjiiiihhhhhhiiiijiiiiiiiiihiihhhhggggggggghiiijjjkklllllmmmmnnnmmmmlllllllllllkkkkkjjiihhhhhgggfee&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117755|max=203707&chxp=1,1,58,100&chtt=Druid_Feral_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,6,5,7,18,27,42,56,61,116,139,171,205,292,331,377,438,594,560,576,654,550,603,591,510,480,439,379,372,290,265,194,168,112,95,81,51,33,30,28,14,12,10,3,5,0,0,1,0,1&chds=0,654&chbh=5&chxt=x&chxl=0:|min=108849|avg=117755|max=129280&chxp=0,1,44,100&chtt=Druid_Feral_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:24.8,12.8,11.8,4.6,3.7,2.7,1.2,38.6&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C55D54,C79C6E,C79C6E,C55D54,ABD473,ffffff&chl=shred 111.7s|healing_touch 57.8s|rake 53.0s|ferocious_bite 20.5s|savage_roar 16.5s|rip 12.3s|feral_spirit 5.3s|waiting 173.8s&chtt=Druid_Feral_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Feral_T14H 117755
berserk 0 0.0% 2.9 188.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:(null)
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to $50334s1 targets and lasts $50334d. When used in Cat Form, reduces the cost of all Cat Form abilities by $106951s1% and lasts $106951d.
berserking 0 0.0% 3.0 180.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
cat_melee 25444 21.6% 497.4 0.91sec 23049 27279 16595 34615 23049 41.3% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 497.39 497.39 0.00 0.00 0.8449 0.0000 11464205.10 11464205.10 0.00 27278.64 27278.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.53 34.69% 16594.88 11981 21789 16597.24 16218 17061 2863134 2863134 0.00
crit 205.30 41.28% 34614.62 24681 44884 34622.56 33899 35560 7106267 7106267 0.00
glance 119.29 23.98% 12531.10 8986 16341 12533.73 12210 12981 1494804 1494804 0.00
dodge 0.20 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.07 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
feral_spirit 0 0.0% 3.9 124.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.92 3.92 0.00 0.00 1.3385 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:110807
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:110807
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Druid, lasting $d.
ferocious_bite 8048 6.8% 19.8 23.10sec 182917 176480 103168 220150 182917 68.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.79 19.79 0.00 0.00 1.0365 0.0000 3620317.02 3620317.02 0.00 176480.31 176480.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.28 31.74% 103168.04 9833 202391 103104.72 0 166933 648051 648051 0.00
crit 13.50 68.21% 220149.88 20301 416925 220450.03 159863 287124 2972266 2972266 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&dot.rip.ticking&target.health.pct<=25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.] When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target. Critical strike chance increased by $s2% against bleeding targets. 1 point : ${$m1+$b1*1+0.196*$AP}-${$M1+$b1*1+0.196*$AP} damage 2 points: ${$m1+$b1*2+0.196*2*$AP}-${$M1+$b1*2+0.196*2*$AP} damage 3 points: ${$m1+$b1*3+0.196*3*$AP}-${$M1+$b1*3+0.196*3*$AP} damage 4 points: ${$m1+$b1*4+0.196*4*$AP}-${$M1+$b1*4+0.196*4*$AP} damage 5 points: ${$m1+$b1*5+0.196*5*$AP}-${$M1+$b1*5+0.196*5*$AP} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.980000
  • base_dd_min:315.19
  • base_dd_max:685.41
healing_touch 2238 100.0% 43.1 10.62sec 23417 17445 0 0 23417 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 43.06 43.06 0.00 0.00 1.3423 0.0000 1008350.82 1008350.82 0.00 17444.91 17444.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 43.06 100.00% 23416.73 21668 32502 23422.09 22894 23966 1008351 1008351 0.00
HPS Timeline Chart

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17340.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:false
  • if_expr:!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:(null)
  • description:Heals a friendly target for $s1$?s54825[ and reduces your remaining cooldown on Swiftmend by $54825m1 sec][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.860000
  • base_dd_min:18459.28
  • base_dd_max:21800.87
natures_swiftness 0 0.0% 7.0 68.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: natures_swiftness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: natures_swiftness

Static Values
  • id:132158
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
Spelldata
  • id:132158
  • name:Nature's Swiftness
  • school:physical
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
rake 40217 34.2% 51.1 8.76sec 354194 341723 61425 129154 89234 41.1% 0.1% 0.0% 0.0% 148.8 62476 131819 91058 41.2% 0.0% 99.1%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.14 51.14 148.80 148.80 1.0365 3.0000 18113051.17 18113051.17 0.00 36268.54 341723.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.09 58.83% 61425.50 42958 94507 61438.18 55743 68545 1848062 1848062 0.00
crit 21.02 41.11% 129154.07 88493 194684 129214.76 109639 151873 2715285 2715285 0.00
dodge 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.5 58.78% 62475.55 42958 94507 62485.43 58269 66601 5464711 5464711 0.00
crit 61.3 41.22% 131819.47 88493 194684 131876.05 120750 144956 8084993 8084993 0.00
DPS Timeline Chart

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for $s1 Bleed damage and an additional $o2 Bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.368000
  • base_dd_min:118.23
  • base_dd_max:118.23
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.368000
  • base_td:118.23
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rip 26794 22.8% 11.9 30.32sec 1016688 980857 0 0 0 0.0% 0.1% 0.0% 0.0% 209.6 39501 83839 57573 40.8% 0.0% 93.0%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.87 11.87 209.59 209.59 1.0365 2.0000 12066503.12 12066503.12 0.00 27965.84 980857.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.86 99.95% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.2 59.24% 39501.02 32185 67806 39540.80 33435 50232 4904374 4904374 0.00
crit 85.4 40.76% 83838.81 66301 139680 83867.63 69693 107350 7162129 7162129 0.00
DPS Timeline Chart

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over time. Damage increases per combo point: 1 point : ${$floor($m1+$b1*1*$<mastery>+0.0484*$AP*$<mastery>)*8} damage over $d. 2 points: ${$floor($m1+$b1*2*$<mastery>+0.0484*2*$AP*$<mastery>)*8} damage over $d. 3 points: ${$floor($m1+$b1*3*$<mastery>+0.0484*3*$AP*$<mastery>)*8} damage over $d. 4 points: ${$floor($m1+$b1*4*$<mastery>+0.0484*4*$AP*$<mastery>)*8} damage over $d. 5 points: ${$floor($m1+$b1*5*$<mastery>+0.0484*5*$AP*$<mastery>)*8} damage over $d. Each time you Shred, Ravage, or Mangle the target while in Cat Form the duration of your Rip on that target is extended by $s2 sec, up to a maximum of $s3 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.242000
  • base_td:112.76
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
savage_roar 0 0.0% 17.0 28.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 0.00 0.00 0.9753 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 16.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
shred 15667 13.3% 107.8 4.20sec 65409 63106 45123 93869 65409 41.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.80 107.80 0.00 0.00 1.0365 0.0000 7050836.12 7050836.12 0.00 63106.02 63106.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.82 58.28% 45122.86 30413 69046 45125.41 42699 48170 2834664 2834664 0.00
crit 44.92 41.67% 93868.62 62650 142236 93872.27 86494 101169 4216172 4216172 0.00
dodge 0.04 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<=4
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus $m1 to the target$?s48484[ and reducing the target's movement speed by $58180s1% for $58180d][]. Must be behind the target. Awards $s2 combo $lpoint:points;. Deals $62078s2% additional damage against bleeding targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:62.40
  • base_dd_max:62.40
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.00
tigers_fury 0 0.0% 14.7 31.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.68 14.68 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35&!buff.omen_of_clarity.react
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d and instantly restores $s2 Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
pet - symbiosis_wolf 6314 / 1585
melee 3359 0.7% 177.6 4.39sec 2139 1733 1581 3195 2139 40.4% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 177.61 177.61 0.00 0.00 1.2344 0.0000 379908.66 379908.66 0.00 1732.92 1732.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.24 35.61% 1581.16 1516 2119 1580.82 1516 1736 100000 100000 0.00
crit 71.72 40.38% 3195.33 3032 4237 3191.59 3032 3538 229175 229175 0.00
glance 42.54 23.95% 1192.53 1137 1589 1191.69 1137 1332 50733 50733 0.00
dodge 0.05 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 2956 0.6% 37.8 10.93sec 8855 5742 6226 12606 8855 41.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.79 37.79 0.00 0.00 1.5421 0.0000 334620.21 334620.21 0.00 5742.38 5742.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.17 58.68% 6225.53 5871 8381 6221.87 5871 6878 138030 138030 0.00
crit 15.59 41.27% 12606.00 11742 16762 12596.38 11742 14391 196590 196590 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.9 0.0 188.8sec 188.8sec 9.56% 9.56%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserk_1:9.6%
berserking 3.0 0.0 180.4sec 180.4sec 6.67% 6.07%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.59%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 8.5 2.9 50.7sec 36.6sec 25.88% 26.03%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:25.9%
dream_of_cenarius_damage 42.9 0.2 10.5sec 10.6sec 34.66% 41.74%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dream_of_cenarius_damage
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dream_of_cenarius_damage_1:17.1%
  • dream_of_cenarius_damage_2:17.6%

Spelldata details

  • id:108381
  • name:Dream of Cenarius
  • tooltip:Moonfire and Sunfire damage increased by $s3%, and melee ability damage increased by $s1%.
  • description:Nourish, Healing Touch, and Regrowth increase the damage done by your next $n Moonfire or Sunfire casts by $108381s3% or by your next $n melee abilities by $108381s1%.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
natures_swiftness 7.0 0.0 69.0sec 69.0sec 0.00% 16.53%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_natures_swiftness
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

Spelldata details

  • id:132158
  • name:Nature's Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:60.00
  • default_chance:0.00%
omen_of_clarity 19.6 0.2 22.1sec 21.8sec 2.86% 6.19%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:4.00%
  • default_value:-1.00

Stack Uptimes

  • omen_of_clarity_1:2.9%

Spelldata details

  • id:16870
  • name:Clearcasting
  • tooltip:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%.
  • description:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%. Does not affect Nourish.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
predatory_swiftness 36.4 4.5 12.4sec 11.0sec 33.80% 100.00%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • predatory_swiftness_1:33.8%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth will be instant, free, and castable in all forms.
  • description:Your finishing moves have a chance per combo point to make your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth become instant, free, and castable in all forms.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.5 0.0 63.4sec 63.4sec 24.65% 24.65%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.6%
synapse_springs_2 7.6 0.0 63.0sec 63.0sec 16.67% 16.67%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.7%
terror_in_the_mists 7.4 0.0 64.6sec 64.6sec 32.29% 32.29%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.3%
tigers_fury 14.7 0.0 31.5sec 31.5sec 19.44% 18.69%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:19.4%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d and instantly restores $s2 Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 388.2sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
cat_form

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • cat_form_1:100.0%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Causes Agility to increase attack power, increases autoattack damage by $s3%, and increases movement speed by $113636s1%.$?$w2=100[ Additionally, all healing done to you is increased by $47180s1%][]
  • description:Shapeshift into Cat Form, causing Agility to increase attack power, increasing autoattack damage by $s3%, and increasing movement speed by $113636s1%.$?s47180[ Additionally, all healing done to you is increased by $47180s1%.][] Also protects the caster from Polymorph effects and allows the use of various cat abilities. Energy regeneration continues while not in Cat Form. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
savage_roar

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • savage_roar_1:100.0%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
symbiosis

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_symbiosis
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • symbiosis_1:100.0%

Spelldata details

  • id:110309
  • name:Symbiosis
  • tooltip:Grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death.
  • description:Creates a symbiotic link which grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death. Cannot be cast on other Druids. Effect cancelled if Druid and target become too far apart.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Feral_T14H
ferocious_bite Energy 39.6 731.1 18.5 36.9 4951.7
rake Energy 51.1 1615.4 31.6 31.6 11212.4
rip Energy 11.9 311.5 26.2 26.2 38737.8
savage_roar Energy 17.0 374.9 22.1 22.1 0.0
shred Energy 107.8 3375.8 31.3 31.3 2088.7
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.50 4636.02 2.57 198.33 4.10%
energy_refund Energy 0.37 2.49 6.65 0.00 0.00%
lotp_health Health 60.94 0.00 0.00 1131014.48 100.00%
lotp_mana Mana 60.94 0.00 0.00 292525.81 100.00%
omen_of_clarity Mana 1.84 31973.88 17340.00 0.00 0.00%
omen_of_clarity Energy 17.76 674.11 37.96 0.00 0.00%
soul_of_the_forest Energy 47.09 813.29 17.27 5.87 0.72%
tigers_fury Energy 14.68 880.86 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 14.06 14.23
Combat End Resource Mean Min Max
Health 463965.00 463965.00 463965.00
Mana 60000.00 60000.00 60000.00
Rage 0.00 0.00 0.00
Energy 24.38 0.19 99.13
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 4.0%
treant-Energy Cap 4.0%
treant-Energy Cap 4.0%
symbiosis_wolf-Energy Cap 4.0%
symbiosis_wolf-Energy Cap 4.0%

Procs

Count Interval
hat_donor 226.2 2.0sec
primal_fury 65.9 6.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 117755.36
Minimum 108849.22
Maximum 129279.98
Spread ( max - min ) 20430.77
Range [ ( max - min ) / 2 * 100% ] 8.68%
Standard Deviation 2701.6738
5th Percentile 113391.20
95th Percentile 122262.87
( 95th Percentile - 5th Percentile ) 8871.67
Mean Distribution
Standard Deviation 27.0221
95.00% Confidence Intervall ( 117702.40 - 117808.32 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2022
0.1 Scale Factor Error with Delta=300 62308
0.05 Scale Factor Error with Delta=300 249235
0.01 Scale Factor Error with Delta=300 6230881
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 117755.36

Damage

Sample Data
Count 9996
Mean 52314912.54

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 2238.29
Minimum 1807.26
Maximum 2624.97
Spread ( max - min ) 817.71
Range [ ( max - min ) / 2 * 100% ] 18.27%
Standard Deviation 101.3400
5th Percentile 2071.77
95th Percentile 2404.24
( 95th Percentile - 5th Percentile ) 332.47
Mean Distribution
Standard Deviation 1.0136
95.00% Confidence Intervall ( 2236.30 - 2240.27 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7874
0.1 Scale Factor Error with Delta=300 87
0.05 Scale Factor Error with Delta=300 350
0.01 Scale Factor Error with Delta=300 8766
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 2238.29

Heal

Sample Data
Count 9996
Mean 1008350.82

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 293.68
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 symbiosis,class=shaman
5 0.00 cat_form
6 0.00 savage_roar
7 0.00 snapshot_stats
8 0.00 virmens_bite_potion
Default action list
# count action,conditions
9 1.00 virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
A 5.00 auto_attack
B 0.00 skull_bash_cat
C 8.77 healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
D 6.95 healing_touch,if=prev.natures_swiftness
E 7.58 use_item,name=eternal_blossom_grips,sync=tigers_fury
F 14.68 tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
G 2.92 berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
H 0.00 natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
I 0.00 incarnation,if=buff.berserk.up&talent.incarnation.enabled
J 3.01 berserking
K 12.35 savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
L 0.00 faerie_fire,if=debuff.weakened_armor.stack<3
M 0.75 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
N 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
O 7.53 ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
P 0.31 ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
Q 0.00 ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
R 2.73 shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
S 2.79 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
T 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
U 11.87 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
V 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
W 4.01 ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
X 3.61 savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
Y 2.95 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
Z 0.46 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
a 19.61 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
b 6.73 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
c 38.43 rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
d 0.00 rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
e 12.71 rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
f 0.00 ravage,if=buff.omen_of_clarity.react
g 9.30 shred,if=buff.omen_of_clarity.react
h 0.38 ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
i 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
j 7.57 ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
k 0.00 ravage,if=(buff.tigers_fury.up|buff.berserk.up)
l 0.00 ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
m 0.00 ravage,if=cooldown.tigers_fury.remains<=3.0
n 0.00 ravage,if=target.time_to_die<=8.5
o 0.00 ravage,if=energy.time_to_max<=1.0
p 37.00 shred,if=(buff.tigers_fury.up|buff.berserk.up)
q 16.15 shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
r 18.72 shred,if=cooldown.tigers_fury.remains<=3.0
s 1.54 shred,if=target.time_to_die<=8.5
t 22.36 shred,if=energy.time_to_max<=1.0
u 3.92 feral_spirit

Sample Sequence

AJcqqEFGpSDUcKpppWppppWptubecXtgtrCcFUacppjatAettqUrEFaKcpYDctXttbecUrrCcFpjactteUqKCcrEFppYDXAccuCccUgtCccjrFacppXaqqeqJUrrCcEFGYDcWacpppWpppppXqqeCAcUrrFacgjacttXbecqUgrrEFacjacugttZDeUtKrrFppjacKAeqqCcgUrEFacppKatetqPgrrCFcYDcOacJgtKtetrOrEFG9acpOacpppOppppOubeKcrrFYDcpOacKgCttegOrrEFpKpp

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 21662 19265 18252
Stamina 22683 20621 20502
Intellect 257 245 80
Spirit 269 269 80
Health 463965 435097 0
Mana 60000 60000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 271 235 0
Spell Hit 14.95% 14.95% 2545
Spell Crit 15.49% 10.49% 5124
Spell Haste 8.34% 3.18% 1351
Mana Per 5 1500 1500 0
Attack Power 48134 445 0
Melee Hit 7.49% 7.49% 2545
Melee Crit 38.22% 31.32% 5124
Melee Haste 3.18% 3.18% 1351
Swing Speed 13.50% 3.18% 1351
Expertise 7.46% 7.46% 2537
Armor 18644 18644 18644
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 19.55% 17.71% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 78.19% 62.54% 7188

Gear

Average Item Level: 507.73
Head eternal_blossom_headpiece,id=86925,gems=agile_primal_80agi_160hit_180agi,reforge=exp_crit
Neck choker_of_the_unleashed_storm,id=86953
Shoulders eternal_blossom_spaulders,id=86927,gems=80agi_160hit_60agi,enchant=520agi_100crit,reforge=haste_mastery
Shirt empty
Chest eternal_blossom_raiment,id=86923,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=160agi_160agi,reforge=crit_mastery
Legs legguards_of_failing_purification,id=90504,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=hit_exp
Feet boots_of_the_still_breath,id=86943,gems=160agi,enchant=140mastery,reforge=haste_mastery
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_mastery
Hands eternal_blossom_grips,id=86924,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=hit_mastery
Finger1 regails_band_of_the_endless,id=90503,reforge=haste_mastery
Finger2 painful_thorned_ring,id=86974,reforge=exp_crit
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180hit,reforge=crit_exp
Main Hand gaorei_staff_of_the_legendary_protector,id=87156,gems=500agi,enchant=dancing_steel,reforge=exp_hit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Feral_T14H"
origin="unknown"
level=90
race=troll
spec=feral
role=attack
position=back
professions=engineering=600/inscription=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
glyphs=savagery

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/symbiosis,class=shaman
actions.precombat+=/cat_form
actions.precombat+=/savage_roar
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
actions+=/healing_touch,if=prev.natures_swiftness
actions+=/use_item,name=eternal_blossom_grips,sync=tigers_fury
actions+=/tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
actions+=/berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
actions+=/natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
actions+=/incarnation,if=buff.berserk.up&talent.incarnation.enabled
actions+=/berserking
actions+=/savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
actions+=/faerie_fire,if=debuff.weakened_armor.stack<3
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
actions+=/ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
actions+=/ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
actions+=/savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
actions+=/rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/ravage,if=buff.omen_of_clarity.react
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
actions+=/ravage,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/ravage,if=cooldown.tigers_fury.remains<=3.0
actions+=/ravage,if=target.time_to_die<=8.5
actions+=/ravage,if=energy.time_to_max<=1.0
actions+=/shred,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/shred,if=cooldown.tigers_fury.remains<=3.0
actions+=/shred,if=target.time_to_die<=8.5
actions+=/shred,if=energy.time_to_max<=1.0
actions+=/feral_spirit

head=eternal_blossom_headpiece,id=86925,gems=agile_primal_80agi_160hit_180agi,reforge=exp_crit
neck=choker_of_the_unleashed_storm,id=86953
shoulders=eternal_blossom_spaulders,id=86927,gems=80agi_160hit_60agi,enchant=520agi_100crit,reforge=haste_mastery
back=legbreaker_greatcloak,id=86963,enchant=180hit,reforge=crit_exp
chest=eternal_blossom_raiment,id=86923,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_mastery
hands=eternal_blossom_grips,id=86924,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=hit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=160agi_160agi,reforge=crit_mastery
legs=legguards_of_failing_purification,id=90504,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=hit_exp
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140mastery,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503,reforge=haste_mastery
finger2=painful_thorned_ring,id=86974,reforge=exp_crit
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=gaorei_staff_of_the_legendary_protector,id=87156,gems=500agi,enchant=dancing_steel,reforge=exp_hit

# Gear Summary
# gear_strength=80
# gear_agility=18252
# gear_stamina=20502
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2537
# gear_hit_rating=2545
# gear_crit_rating=5124
# gear_haste_rating=1351
# gear_mastery_rating=7188
# gear_armor=18644
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=eternal_blossom_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=gaorei_staff_of_the_legendary_protector,heroic=1,weapon=staff_3.30speed_13314min_19972max,enchant=dancing_steel

Hunter_BM_T14H : 104616 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
104616.5 104616.5 36.58 / 0.03% 3060 / 2.9% 3951.0 11.3 11.2 Focus 0.00% 55.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:800473|378727|218989|113301|110476|96096|42688|18235|13075&chds=0,1600946&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++800473++stampede,C79C6E,0,0,15|t++378727++lynx_rush,C79C6E,1,0,15|t++218989++dire_beast,C79C6E,2,0,15|t++113301++kill_command,C79C6E,3,0,15|t++110476++kill_shot,C79C6E,4,0,15|t++96096++glaive_toss,C79C6E,5,0,15|t++42688++arcane_shot,69CCF0,6,0,15|t++18235++cobra_shot,ABD473,7,0,15|t++13075++ranged,C79C6E,8,0,15&chtt=Hunter_BM_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:37,33,28,28,26,17,14,14,12,8,7,1,1,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat: kill_command|cat: melee|ranged|arcane_shot|cat: claw|dire_beast: dire_beast_melee|glaive_toss|cobra_shot|cat: lynx_rush|kill_shot|serpent_sting|raptor: melee|hyena: melee|wolf: melee|devilsaur: melee|raptor: claw|devilsaur: claw|wolf: claw|hyena: claw&chtt=Hunter_BM_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:3855444323234431vtpnlkggedcaZYWVUUTTTSTVVWXWWXXXXXXXXXXXYYYXWVVVVVVUUUUUVUUUUUUUUUUUUUUUUUUTTTSSSSSSRSSSSSSSSSSSTTTTUUUVUUTTTSSSSSSTUUUUUUUTTUUVVVVVWWWVVUTTTTTTTTTTTUUUUVVVVWWWXXXXXXXXXWWVVUUTTSSSSSRRRRRRRRRRRRRSSSSSSRRRSTTUUUUVVVVWWWWWXXXXXXWWWWWWWVVVVVVUUUUUUUUTTTTTTTTTTTTTTUTTTTTTTTTTTTSSSTTTTUUVVVWWWXXYYYZabbbbbaaaZZYYYYXXXXXWWWVVVWWXXXYYYYYZZYYYYYYYYYYYXXXXXXXWWWWWWWWWVVVUUUUUUTTTTTTTTTUUUUUVVWWXYZZZZaaaaaaaaaaaaaaaaZZZaabbbccddddddddddcccbbbaaZZZYYYYYYYXXXXXXXXYYYYYYYYYYYXXXXXXXXXXXXXXXXXYYYYZZZZaaaaaabbbbbbbbbaaaaZZZZZYYYXXWVVUTTSSSSRRQQP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=104616|max=268665&chxp=1,1,39,100&chtt=Hunter_BM_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,3,7,7,15,27,37,72,97,132,189,282,367,443,568,632,736,742,743,714,687,634,618,477,417,350,258,202,142,124,90,71,37,24,19,11,7,3,4,3,1,0,0,1,0,0,0,1&chds=0,743&chbh=5&chxt=x&chxl=0:|min=97321|avg=104616|max=114630&chxp=0,1,42,100&chtt=Hunter_BM_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.3,29.0,14.6,6.7,3.5,3.4,2.2,1.5,1.2,0.9,0.9,0.5&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,ABD473,C79C6E&chl=cobra_shot 159.1s|arcane_shot 130.7s|kill_command 65.9s|glaive_toss 30.3s|dire_beast 16.0s|kill_shot 15.5s|focus_fire 10.0s|lynx_rush 6.6s|aspect_of_the_hawk 5.2s|aspect_of_the_fox 4.1s|serpent_sting 4.0s|stampede 2.1s&chtt=Hunter_BM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_BM_T14H 104616
arcane_shot 12384 11.8% 126.1 3.51sec 44246 42688 33560 69484 44325 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.08 125.86 0.00 0.00 1.0365 0.0000 5578587.87 5578587.87 0.00 42687.94 42687.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.14 70.03% 33559.55 30111 40193 33560.79 32676 34487 2957954 2957954 0.00
crit 37.72 29.97% 69483.74 62029 82797 69490.42 66330 73106 2620634 2620634 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
aspect_of_the_fox 0 0.0% 4.0 85.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_fox

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_fox

Static Values
  • id:82661
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82661
  • name:Aspect of the Fox
  • school:nature
  • tooltip:Steady Shot, Cobra Shot, and Barrage can be shot while moving. Melee attacks received instantly generate $ Focus.
  • description:The Hunter takes on the aspects of a fox, allowing $G him:her; to shoot Steady Shot, Cobra Shot, and Barrage while moving and causing $G him:her; to gain $<focus> Focus whenever $G he:she; receives a melee attack. Only one Aspect can be active at a time.
aspect_of_the_hawk 0 0.0% 5.0 85.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_hawk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_hawk

Static Values
  • id:13165
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13165
  • name:Aspect of the Hawk
  • school:nature
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
bestial_wrath 0 0.0% 8.4 56.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.41 8.41 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.beast_within.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
blood_fury 0 0.0% 4.3 120.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 6435 6.2% 106.8 4.02sec 27162 18235 20660 42610 27216 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.79 106.58 0.00 0.00 1.4896 0.0000 2900756.00 2900756.00 0.00 18234.80 18234.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.75 70.13% 20659.97 19298 26177 20659.74 20265 20974 1544341 1544341 0.00
crit 31.83 29.87% 42609.89 39755 53925 42607.82 41194 44139 1356415 1356415 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (7760) 0.0% (7.4%) 15.4 29.50sec 226976 218989 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.41 15.41 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 218989.35 218989.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&focus<=80
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
focus_fire 0 0.0% 9.6 44.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.61 9.61 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
glaive_toss 6469 6.2% 29.3 15.55sec 99604 96096 37894 78573 50077 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.27 58.21 0.00 0.00 1.0365 0.0000 2915065.51 2915065.51 0.00 96095.78 96095.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.78 70.05% 37893.70 31882 54094 37898.10 36207 39646 1545230 1545230 0.00
crit 17.43 29.95% 78572.79 65676 111433 78603.63 71903 86338 1369836 1369836 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_command 0 (16600) 0.0% (15.9%) 63.6 7.05sec 117435 113301 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.62 63.62 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 113301.35 113301.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 63.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:Give the command to kill, causing your pet to instantly inflict $ damage to its target. The pet must be within 25 yards of the target to Kill Command.
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.
kill_shot 3778 3.6% 14.9 5.48sec 114505 110476 87368 180472 115665 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.92 14.77 0.00 0.00 1.0365 0.0000 1708291.91 1708291.91 0.00 110476.10 110476.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.28 69.61% 87368.37 77901 105666 87363.77 80976 95537 898192 898192 0.00
crit 4.49 30.39% 180471.64 160475 217671 179339.74 0 217671 810100 810100 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (5514) 0.0% (5.3%) 6.3 75.29sec 392536 378727 0 0 0 0.0% 0.0% 0.0% 0.0% 56.7 0 0 0 13.1% 0.0% 5.6%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.33 6.33 56.70 56.70 1.0365 0.4442 0.00 0.00 0.00 78262.72 378727.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.2 86.85% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.5 13.15% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 12706 12.2% 206.8 2.17sec 27692 13075 20968 43366 27692 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 206.84 206.84 0.00 0.00 2.1179 0.0000 5727937.52 5727937.52 0.00 13075.18 13075.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.75 69.98% 20968.46 19068 26070 20968.82 20658 21256 3035147 3035147 0.00
crit 62.09 30.02% 43366.39 39280 53705 43369.95 42101 44979 2692790 2692790 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.0 105.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.04 4.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up&!buff.beast_within.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.6 388.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.57 1.57 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 3012 2.9% 3.9 105.41sec 351469 339169 0 0 0 0.0% 0.0% 0.0% 0.0% 147.4 6990 14452 9208 29.7% 0.0% 98.2%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.86 3.85 147.41 147.41 1.0363 3.0000 1357354.85 1357354.85 0.00 3041.74 339169.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.6 70.28% 6989.77 6141 9583 6989.40 6798 7199 724140 724140 0.00
crit 43.8 29.72% 14452.40 12651 19742 14452.41 13772 15079 633215 633215 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (3739) 0.0% (3.5%) 2.0 300.75sec 829290 800473 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 800472.86 800472.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 48333 / 48333
claw 11547 11.0% 130.1 3.48sec 39939 25993 25238 51024 39939 57.2% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.10 130.10 0.00 0.00 1.5365 0.0000 5195902.79 5195902.79 0.00 25993.29 25993.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.33 42.53% 25238.19 14621 82892 25273.18 19128 32846 1396437 1396437 0.00
crit 74.41 57.20% 51024.15 29242 165784 51085.14 40012 62940 3796853 3796853 0.00
block 0.09 0.07% 30398.53 14621 82892 2519.29 0 82892 2612 2612 0.00
parry 0.27 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
kill_command 16600 15.9% 63.6 7.05sec 117435 0 83416 169288 117435 39.9% 0.3% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.62 63.62 0.00 0.00 0.0000 0.0000 7471204.21 7471204.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.96 59.67% 83415.63 63883 180772 83470.55 74167 93315 3166606 3166606 0.00
crit 25.39 39.91% 169288.47 127766 361544 169473.73 144725 204175 4298108 4298108 0.00
block 0.07 0.11% 89726.25 63883 180772 6304.28 0 180772 6490 6490 0.00
parry 0.20 0.31% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc34026
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:697.93
  • base_dd_max:697.93
lynx_rush 5514 5.3% 56.7 7.28sec 43817 0 31393 66098 43817 39.2% 3.7% 0.0% 1.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.70 56.70 0.00 0.00 0.0000 0.0000 2484449.92 2484449.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.59 55.71% 31393.37 23206 64800 31473.76 25013 39688 991658 991658 0.00
crit 22.21 39.17% 66098.48 46413 129600 66362.86 48837 93638 1467874 1467874 0.00
block 0.79 1.40% 31405.53 23206 64800 17275.77 0 64800 24918 24918 0.00
parry 2.11 3.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 14672 14.0% 321.8 1.40sec 20509 14674 15055 30888 20509 40.1% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 321.81 321.81 0.00 0.00 1.3977 0.0000 6599865.74 6599865.74 0.00 14673.64 14673.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.59 35.61% 15055.44 11603 32400 15066.46 13938 16617 1725224 1725224 0.00
crit 129.10 40.12% 30887.93 23206 64800 30924.55 28581 34308 3987707 3987707 0.00
glance 77.33 24.03% 11444.39 8702 24300 11454.41 10378 13190 885004 885004 0.00
block 0.12 0.04% 15460.25 11603 32400 1815.90 0 32400 1930 1930 0.00
parry 0.66 0.20% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 5.8 84.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.83 5.83 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 10362 / 935
claw 4711 0.4% 13.0 26.55sec 14523 9435 10094 20360 14523 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 188453.98 188453.98 0.00 9434.96 9434.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.38 56.85% 10094.04 5991 17269 10110.79 5991 16387 74468 74468 0.00
crit 5.60 43.15% 20359.90 11982 34538 20360.54 0 34538 113986 113986 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5651 0.5% 29.2 11.29sec 7734 5841 5386 11358 7734 44.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.23 29.23 0.00 0.00 1.3240 0.0000 226040.64 226040.64 0.00 5841.15 5841.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.30 31.81% 5385.81 4290 6750 5380.86 4394 6580 50068 50068 0.00
crit 12.92 44.21% 11358.45 8580 13500 11361.03 9458 13159 146786 146786 0.00
glance 7.01 23.98% 4164.31 3217 5062 4161.39 0 5062 29187 29187 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 8.0 45.58sec 0 0 0 0 0 42.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.62 57.72% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.38 42.28% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:5.60
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 300.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 10376 / 936
claw 4716 0.4% 13.0 26.54sec 14539 9445 10100 20345 14539 43.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 188658.37 188658.37 0.00 9445.20 9445.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.35 56.67% 10099.66 5991 17269 10108.01 5991 14919 74270 74270 0.00
crit 5.62 43.33% 20344.52 11982 34538 20329.91 0 34538 114388 114388 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5660 0.5% 29.2 11.28sec 7743 5849 5387 11356 7743 44.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3238 0.0000 226392.93 226392.93 0.00 5848.74 5848.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.29 31.77% 5387.18 4290 6750 5382.90 0 6750 50051 50051 0.00
crit 12.97 44.35% 11355.94 8580 13500 11358.28 9564 13500 147270 147270 0.00
glance 6.98 23.87% 4164.95 3217 5062 4163.95 0 5062 29072 29072 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 10363 / 935
cackling_howl 0 0.0% 2.0 300.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:63.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 4706 0.4% 13.0 26.55sec 14508 9425 10095 20357 14508 43.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 188247.31 188247.31 0.00 9425.09 9425.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.40 57.00% 10095.48 5991 17269 10111.22 5991 16387 74662 74662 0.00
crit 5.58 43.00% 20357.19 11982 34538 20354.29 0 34538 113586 113586 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5657 0.5% 29.2 11.30sec 7742 5846 5386 11353 7742 44.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.23 29.23 0.00 0.00 1.3243 0.0000 226261.71 226261.71 0.00 5845.95 5845.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.26 31.69% 5386.37 4290 6750 5381.37 4290 6750 49883 49883 0.00
crit 12.97 44.37% 11352.84 8580 13500 11353.75 9682 13214 147224 147224 0.00
glance 7.00 23.94% 4167.21 3217 5062 4163.56 0 5062 29155 29155 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 10363 / 935
claw 4707 0.4% 13.0 26.54sec 14507 9425 10077 20403 14507 42.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5392 0.0000 188276.48 188276.48 0.00 9425.13 9425.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.41 57.09% 10077.14 5991 17269 10081.64 6282 15505 74669 74669 0.00
crit 5.57 42.91% 20402.76 11982 34538 20381.06 0 34538 113607 113607 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5656 0.5% 29.2 11.28sec 7737 5845 5386 11354 7737 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3236 0.0000 226248.35 226248.35 0.00 5845.46 5845.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.29 31.76% 5385.68 4290 6750 5381.01 4290 6750 50026 50026 0.00
crit 12.95 44.29% 11354.29 8580 13500 11355.57 9623 13398 147039 147039 0.00
glance 7.00 23.95% 4167.04 3217 5062 4165.54 0 5062 29184 29184 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 16613 / 7760
dire_beast_melee 16613 7.4% 140.8 3.11sec 24841 14933 19835 40340 24841 30.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.77 140.77 0.00 0.00 1.6634 0.0000 3496821.94 3496821.94 0.00 14933.35 14933.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.61 45.90% 19834.54 17436 26183 19837.27 19024 21121 1281514 1281514 0.00
crit 42.38 30.10% 40340.01 34873 52367 40353.45 37864 43165 1709503 1709503 0.00
glance 33.78 24.00% 14972.56 13077 19638 14975.21 14130 16088 505805 505805 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 5.0 0.0 76.9sec 85.0sec 93.54% 93.01%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:93.5%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
beast_within 8.4 0.0 56.8sec 56.8sec 29.29% 29.02%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_beast_within
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • beast_within_1:29.3%

Spelldata details

  • id:34471
  • name:The Beast Within
  • tooltip:Enraged.
  • description:When your pet is under the effects of Bestial Wrath, you also go into a rage causing $34471s2% additional damage and reducing Focus costs of all your shots and abilities by $34471s1% for $19574d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.04% 14.04%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.11%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 14.9 4.0 29.1sec 22.6sec 23.36% 28.67%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • cobra_strikes_1:12.0%
  • cobra_strikes_2:8.2%
  • cobra_strikes_3:2.1%
  • cobra_strikes_4:0.7%
  • cobra_strikes_5:0.2%
  • cobra_strikes_6:0.0%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:$@spelldesc53260
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
focus_fire 9.3 0.3 45.9sec 44.5sec 41.57% 38.72%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • focus_fire_1:41.6%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 11.2 0.0 41.7sec 41.7sec 24.69% 22.91%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.7%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
rapid_fire 4.0 0.0 105.7sec 105.7sec 13.02% 11.51%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:13.0%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 6.8 0.0 69.3sec 69.3sec 22.22% 22.22%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:22.2%
terror_in_the_mists 7.3 0.0 65.5sec 65.5sec 31.64% 31.64%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:31.6%
virmens_bite_potion 2.0 0.0 397.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-bestial_wrath 6.9 0.0 70.4sec 70.4sec 24.07% 24.32%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:16.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bestial_wrath_1:24.1%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
  • max_stacks:
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
cat-frenzy_effect 11.2 40.9 41.5sec 8.6sec 81.63% 83.08%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:20.5%
  • frenzy_effect_2:20.3%
  • frenzy_effect_3:20.0%
  • frenzy_effect_4:19.5%
  • frenzy_effect_5:1.4%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
cat-rabid 3.2 0.0 169.2sec 169.3sec 14.06% 14.49%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:14.1%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-frenzy_effect 1.9 3.3 300.6sec 68.3sec 75.88% 73.68%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.0%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-frenzy_effect 1.9 3.3 300.5sec 68.7sec 75.68% 73.48%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-frenzy_effect 1.9 3.3 300.6sec 68.6sec 76.18% 73.92%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-frenzy_effect 1.9 3.3 300.6sec 68.2sec 76.14% 73.86%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T14H
arcane_shot Focus 126.1 2521.6 20.0 20.0 2212.3
glaive_toss Focus 29.3 369.4 12.6 12.6 7892.4
kill_command Focus 63.6 2148.8 33.8 33.8 3477.0
serpent_sting Focus 3.9 69.8 18.1 18.1 19443.4
pet - cat
claw Focus 130.1 4221.2 32.4 32.4 1230.9
pet - devilsaur
claw Focus 13.0 474.4 36.6 36.6 397.2
pet - raptor
claw Focus 13.0 474.4 36.6 36.6 397.7
pet - hyena
claw Focus 13.0 474.4 36.6 36.6 396.8
pet - wolf
claw Focus 13.0 474.4 36.6 36.6 396.8
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.50 2315.02 1.29 11.74 0.50%
invigoration Focus 27.24 533.12 19.57 11.76 2.16%
cobra_shot Focus 106.58 1490.54 13.98 1.63 0.11%
dire_beast Focus 140.77 702.76 4.99 1.09 0.15%
pet - cat
focus_regen Focus 1801.50 2908.40 1.61 0.05 0.00%
focus_fire Focus 9.61 288.43 30.00 0.00 0.00%
go_for_the_throat Focus 62.09 931.38 15.00 0.03 0.00%
pet - devilsaur
focus_regen Focus 160.00 254.07 1.59 0.20 0.08%
pet - raptor
focus_regen Focus 160.00 254.07 1.59 0.21 0.08%
pet - hyena
focus_regen Focus 160.00 254.07 1.59 0.21 0.08%
pet - wolf
focus_regen Focus 160.00 254.06 1.59 0.21 0.08%
Resource RPS-Gain RPS-Loss
Focus 11.19 11.34
Combat End Resource Mean Min Max
Health 460843.00 460843.00 460843.00
Focus 53.53 1.14 120.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.4%
cat-Focus Cap 0.4%
raptor-Focus Cap 0.4%
wolf-Focus Cap 0.4%
dire_beast-Focus Cap 0.4%

Procs

Count Interval
invigoration 27.2 16.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 104616.46
Minimum 97320.63
Maximum 114630.49
Spread ( max - min ) 17309.87
Range [ ( max - min ) / 2 * 100% ] 8.27%
Standard Deviation 1865.8963
5th Percentile 101668.01
95th Percentile 107787.36
( 95th Percentile - 5th Percentile ) 6119.36
Mean Distribution
Standard Deviation 18.6627
95.00% Confidence Intervall ( 104579.89 - 104653.04 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1221
0.1 Scale Factor Error with Delta=300 29720
0.05 Scale Factor Error with Delta=300 118882
0.01 Scale Factor Error with Delta=300 2972067
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 104616.46

Damage

Sample Data
Count 9996
Mean 20187993.67

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 413.11
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 5.00 aspect_of_the_hawk,moving=0
9 4.00 aspect_of_the_fox,moving=1
A 5.00 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 9.61 focus_fire,five_stacks=1
D 3.86 serpent_sting,if=!ticking
E 4.29 blood_fury
F 0.00 fervor,if=enabled&!ticking&focus<=65
G 8.41 bestial_wrath,if=focus>60&!buff.beast_within.up
H 0.00 multi_shot,if=target.adds>5
I 0.00 cobra_shot,if=target.adds>5
J 14.92 kill_shot
K 0.00 a_murder_of_crows,if=enabled&!ticking
L 2.00 stampede
M 29.27 glaive_toss,if=enabled
N 0.00 barrage,if=enabled
O 0.00 powershot,if=enabled
P 0.00 blink_strike,if=enabled
Q 6.33 lynx_rush,if=enabled&!ticking
R 4.04 rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
S 63.62 kill_command
T 15.41 dire_beast,if=enabled&focus<=80
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 1.57 readiness,wait_for_rapid_fire=1
W 126.08 arcane_shot,if=focus>=69|buff.beast_within.up
X 0.00 focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
Y 108.70 cobra_shot

Sample Sequence

8ADEGLMQSWWWWWSWWTWWDMSWWYWWSYWWYYSCMYWWSYYWWT9ARSVGMQSW8WWTSWWWWDSMRYYYWSYYWCWSYYMWWSYWTWWSYYWWMSYYYSYYWWGSWMWWYYSTCWWEWYYMSYY9AWYSYY8WQSMYYWSTYYWSYYMWSYYCWSYGWWWWMSWWYTWSWYWYCSMYYYSYWWYYSYWMYWSTYYW9ASWWYM8SYYWWGSQWWCWYMSYTWEWWYRSYYYWWSMWYWWSYYYWSYYMWSTYYWSYYWWMSCYYGWWSWWYWWY9AMLSTWW8YSYYWWMSYYQWSYCWYSYMWTWSYYWWYSYCWMWGSWWWWYYSJJWEWMYSTYYJJSWWYWMSYJJCWSY7YWWYJJMSTYWWYSYJJWWGSMQWWWSJCJWWSDYYMRTSJJVJGMQSTWWWWSJJWDW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22364 19934 18773
Stamina 22460 20418 20266
Intellect 191 182 80
Spirit 195 195 80
Health 460843 432255 0
Focus 120 120 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2575
Spell Crit 11.78% 6.78% 4056
Spell Haste 11.77% 6.45% 2741
Mana Per 5 0 0 0
Attack Power 49377 40028 0
Melee Hit 7.57% 7.57% 2575
Melee Crit 27.99% 21.06% 4056
Melee Haste 6.45% 6.45% 2741
Swing Speed 17.09% 6.45% 2741
Expertise 7.52% 7.52% 2556
Armor 25344 25344 25344
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 45.78% 35.78% 5933

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
Shirt empty
Chest zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
Waist fetters_of_death,id=87034,gems=320agi_320agi_160agi
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
Wrists jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
Hands yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
Finger1 painful_thorned_ring,id=86974,enchant=160agi
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_BM_T14H"
origin="unknown"
level=90
race=orc
spec=beast_mastery
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/focus_fire,five_stacks=1
actions+=/serpent_sting,if=!ticking
actions+=/blood_fury
actions+=/fervor,if=enabled&!ticking&focus<=65
actions+=/bestial_wrath,if=focus>60&!buff.beast_within.up
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/kill_shot
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/stampede
actions+=/glaive_toss,if=enabled
actions+=/barrage,if=enabled
actions+=/powershot,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/dire_beast,if=enabled&focus<=80
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=69|buff.beast_within.up
actions+=/focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
hands=yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
waist=fetters_of_death,id=87034,gems=320agi_320agi_160agi
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
finger1=painful_thorned_ring,id=86974,enchant=160agi
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit

# Gear Summary
# gear_strength=80
# gear_agility=18773
# gear_stamina=20266
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2556
# gear_hit_rating=2575
# gear_crit_rating=4056
# gear_haste_rating=2741
# gear_mastery_rating=5933
# gear_armor=25344
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_MM_T14H : 99892 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
99892.5 99892.5 34.09 / 0.03% 2865 / 2.9% 6019.8 11.7 11.6 Focus 0.00% 57.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

Charts

http://6.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:596676|292845|176971|109339|95684|95680|46308|41377|14435|11258&chds=0,1193353&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,C79C6E&chm=t++596676++stampede,C79C6E,0,0,15|t++292845++lynx_rush,C79C6E,1,0,15|t++176971++dire_beast,C79C6E,2,0,15|t++109339++kill_shot,C79C6E,3,0,15|t++95684++glaive_toss,C79C6E,4,0,15|t++95680++chimera_shot,ABD473,5,0,15|t++46308++aimed_shot,C79C6E,6,0,15|t++41377++arcane_shot,69CCF0,7,0,15|t++14435++ranged,C79C6E,8,0,15|t++11258++steady_shot,C79C6E,9,0,15&chtt=Hunter_MM_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,14,14,13,12,9,9,8,7,7,6,6,5,5,4,1,1,1,1,0,0,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=ranged|cat: melee|chimera_shot|arcane_shot|wild_quiver_shot|glaive_toss|dire_beast: dire_beast_melee|cat: claw|aimed_shot|cat: lynx_rush|steady_shot|aimed_shot_mm|piercing_shots|kill_shot|serpent_sting|hyena: melee|devilsaur: melee|wolf: melee|raptor: melee|raptor: claw|wolf: claw|devilsaur: claw|hyena: claw&chtt=Hunter_MM_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:232211432345785431xwvrponmkhggebbZZYXWWWWWWWWWWWVVVVVUUUUVVVWVWWWWWWWXXXXXXYYYYYYXXXXXXXXXXXXXXXWWWWWXXXXXXXXXWVVVVVVVVVVUUUUVVVVVVVVVVWWWWWWXXXXXWXWWWWWVVVVVVVVVVVVVVVVVVVVVVVVVVVWWWWWWWWWWWWWWXXXYXXXXXXXXWWWVVVUUUUTTTTTTTTTTTUVVVWWWXXYYYYYYYYYXXYYYYYXXXXXXXXXXXXXYYYYYYYYYYYYYYYXYXXYXXXXXWVUUUUVVVVVVVVVVVVVWWXYYZZZZZZZZZZaaaaaaaZZZYYYXXXXXXXXXXXXXXXXXXYYYYZabcccdcccccccccccccbbaZZYYYYYZZZZZZZZZZZZabccdcccccccccddeeeeddcbaaaabbbbbbbbaZZZZaaaabbbaaaaaaaaaaaaaZZZZaaaaaaaaaaaabbcccdcccbbbccddddddddcccbbbbbbbccbbaaZZYYYYYYYYYYYYYXXXXXXXXXWWWWWWVVVVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=99892|max=234402&chxp=1,1,43,100&chtt=Hunter_MM_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:5,1,2,4,5,14,22,29,39,51,71,112,139,191,195,286,318,402,432,513,550,594,580,598,611,587,519,510,479,371,354,301,251,216,153,131,96,83,52,39,32,17,15,14,4,2,3,1,1,1&chds=0,611&chbh=5&chxt=x&chxl=0:|min=93655|avg=99892|max=106742&chxp=0,1,48,100&chtt=Hunter_MM_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:38.8,22.1,10.7,10.0,6.9,3.6,3.2,1.6,1.2,0.9,0.5,0.3&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473,C79C6E,ABD473&chl=steady_shot 174.6s|arcane_shot 99.4s|aimed_shot 48.4s|chimera_shot 45.2s|glaive_toss 31.1s|dire_beast 16.4s|kill_shot 14.5s|lynx_rush 7.1s|aspect_of_the_hawk 5.2s|aspect_of_the_fox 4.1s|stampede 2.1s|serpent_sting 1.2s&chtt=Hunter_MM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_MM_T14H 99892
aimed_shot 4974 5.0% 20.0 19.01sec 112150 46308 69048 150947 112288 52.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 19.96 0.00 0.00 2.4218 0.0000 2241578.37 2241578.37 0.00 46307.86 46307.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.42 47.20% 69047.83 68398 76184 69021.33 68398 72231 650629 650629 0.00
crit 10.54 52.80% 150946.63 140899 161611 151297.20 145649 160677 1590950 1590950 0.00
DPS Timeline Chart

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.master_marksman_fire.react
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6602.39
  • base_dd_max:7356.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
aimed_shot_mm 4326 4.3% 20.6 21.01sec 94747 0 69401 143927 94923 34.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.60 20.56 0.00 0.00 0.0000 0.0000 1951436.81 1951436.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.52 65.75% 69401.22 66354 78452 69398.41 67631 71750 938159 938159 0.00
crit 7.04 34.25% 143927.06 136688 161611 143884.20 0 156939 1013278 1013278 0.00
DPS Timeline Chart

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:82928
  • name:Aimed Shot!
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6598.90
  • base_dd_max:7359.64
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
arcane_shot 9121 9.1% 95.9 3.99sec 42888 41377 31798 65685 42977 33.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.86 95.66 0.00 0.00 1.0365 0.0000 4111355.44 4111355.44 0.00 41377.13 41377.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.11 67.01% 31798.31 30077 36501 31799.41 31349 32300 2038445 2038445 0.00
crit 31.56 32.99% 65685.49 61959 75192 65688.89 64334 67790 2072911 2072911 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
aspect_of_the_fox 0 0.0% 4.0 85.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_fox

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_fox

Static Values
  • id:82661
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82661
  • name:Aspect of the Fox
  • school:nature
  • tooltip:Steady Shot, Cobra Shot, and Barrage can be shot while moving. Melee attacks received instantly generate $ Focus.
  • description:The Hunter takes on the aspects of a fox, allowing $G him:her; to shoot Steady Shot, Cobra Shot, and Barrage while moving and causing $G him:her; to gain $<focus> Focus whenever $G he:she; receives a melee attack. Only one Aspect can be active at a time.
aspect_of_the_hawk 0 0.0% 5.0 85.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_hawk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_hawk

Static Values
  • id:13165
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13165
  • name:Aspect of the Hawk
  • school:nature
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
blood_fury 0 0.0% 4.3 120.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
chimera_shot 9609 9.6% 43.7 9.79sec 99170 95680 73818 152509 99395 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.66 43.56 0.00 0.00 1.0365 0.0000 4329332.34 4329332.34 0.00 95680.08 95680.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.40 67.50% 73818.13 69815 85328 73818.38 72403 75356 2170198 2170198 0.00
crit 14.16 32.50% 152508.55 143818 175775 152522.04 147517 158481 2159134 2159134 0.00
DPS Timeline Chart

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:9.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=90
Spelldata
  • id:53209
  • name:Chimera Shot
  • school:nature
  • tooltip:(null)
  • description:An instant shot that causes $s3% ranged weapon Nature damage plus $<damage>, refreshing the duration of your Serpent Sting and healing you for $?s119447[${$53353m1+$119447m1}][$53353m1]% of your total health.$?s53243[ Applies the Hunter's Mark effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.10
dire_beast 0 (6439) 0.0% (6.4%) 15.8 29.24sec 183424 176971 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.78 15.78 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 176970.61 176970.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
glaive_toss 6608 6.6% 30.0 15.23sec 99173 95684 36730 76348 49830 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.01 59.73 0.00 0.00 1.0365 0.0000 2976236.06 2976236.06 0.00 95683.53 95683.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.98 66.93% 36729.75 31790 49074 36735.61 35263 38270 1468385 1468385 0.00
crit 19.75 33.07% 76347.65 65488 101093 76380.48 71504 84056 1507851 1507851 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3517 3.5% 14.0 5.86sec 113325 109339 84327 174439 114600 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.83 0.00 0.00 1.0365 0.0000 1585093.26 1585093.26 0.00 109339.40 109339.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.18 66.41% 84327.07 77805 95953 84371.74 79644 90214 774533 774533 0.00
crit 4.65 33.59% 174439.28 160277 197662 173833.98 0 197662 810560 810560 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4631) 0.0% (4.6%) 6.9 70.32sec 303518 292845 0 0 0 0.0% 0.0% 0.0% 0.0% 61.4 0 0 0 16.1% 0.0% 6.1%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 61.37 61.37 1.0364 0.4442 0.00 0.00 0.00 60534.32 292845.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.5 83.90% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.9 16.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
piercing_shots 3829 3.8% 79.2 5.52sec 21803 0 0 0 0 0.0% 0.0% 0.0% 0.0% 339.9 5078 0 5078 0.0% 0.0% 75.4%

Stats details: piercing_shots

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.16 79.16 339.89 339.89 0.0000 1.0000 1725948.96 1725948.96 0.00 5077.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 339.9 100.00% 5077.94 773 25041 5078.14 3602 6944 1725949 1725949 0.00
DPS Timeline Chart

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:63468
  • name:Piercing Shots
  • school:physical
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed for $53238s1% of the damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:9378.78
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ranged 12785 12.8% 210.1 2.13sec 27430 14435 20295 41996 27430 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 210.08 210.08 0.00 0.00 1.9002 0.0000 5762465.34 5762465.34 0.00 14435.29 14435.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.00 67.12% 20294.75 19043 23673 20296.16 20080 20513 2861623 2861623 0.00
crit 69.07 32.88% 41996.20 39229 48766 42001.61 41269 42961 2900842 2900842 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.3 108.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up|target.time_to_die<=30
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.7 402.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.70 1.70 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 2860 2.9% 1.2 249.30sec 1112312 1073625 0 0 0 0.0% 0.0% 0.0% 0.0% 140.8 6788 14063 9149 32.5% 0.0% 93.8%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.16 1.16 140.82 140.82 1.0360 3.0000 1288349.94 1288349.94 0.00 3040.94 1073624.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.1 67.55% 6787.70 6128 8697 6787.88 6648 6941 645674 645674 0.00
crit 45.7 32.45% 14063.28 12623 17916 14065.05 13553 14746 642676 642676 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.health.pct<=90
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (2788) 0.0% (2.7%) 2.0 301.16sec 618157 596676 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 596676.38 596676.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
steady_shot 4360 4.4% 135.2 3.25sec 14541 11258 10531 22002 14567 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.16 134.92 0.00 0.00 1.2917 0.0000 1965382.02 1965382.02 0.00 11257.71 11257.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.45 64.82% 10530.77 10000 12161 10530.71 10428 10645 920911 920911 0.00
crit 47.47 35.18% 22002.29 20601 25051 22009.75 21649 22555 1044471 1044471 0.00
DPS Timeline Chart

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $m1. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1994.08
  • base_dd_max:1994.08
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
wild_quiver_shot 8632 8.6% 185.6 2.40sec 20954 0 15762 31677 20996 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.64 185.26 0.00 0.00 0.0000 0.0000 3889785.60 3889785.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.33 67.11% 15762.15 14818 18274 15763.23 15561 16019 1959698 1959698 0.00
crit 60.93 32.89% 31677.20 29635 36549 31680.97 31053 32440 1930088 1930088 0.00
DPS Timeline Chart

Action details: wild_quiver_shot

Static Values
  • id:76663
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:45.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76663
  • name:Wild Quiver
  • school:physical
  • tooltip:(null)
  • description:Deals ranged weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
pet - cat 20045 / 20045
claw 5711 5.7% 128.1 3.53sec 20064 13058 13881 28417 20064 42.7% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.11 128.11 0.00 0.00 1.5365 0.0000 2570371.26 2570371.26 0.00 13058.18 13058.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.93 56.93% 13880.98 9999 47281 13891.92 12042 16126 1012382 1012382 0.00
crit 54.75 42.73% 28416.77 19997 94562 28452.26 23437 34218 1555744 1555744 0.00
block 0.11 0.09% 20286.22 9999 47281 2160.34 0 47281 2245 2245 0.00
parry 0.32 0.25% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4631 4.6% 61.4 6.88sec 33893 0 23870 49622 33893 42.4% 3.8% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.37 61.37 0.00 0.00 0.0000 0.0000 2080080.19 2080080.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.26 52.57% 23869.85 15871 36962 23902.06 18221 29667 770118 770118 0.00
crit 26.02 42.40% 49621.81 31742 73924 49696.03 35593 68822 1291180 1291180 0.00
block 0.79 1.28% 23883.61 15871 36962 12944.32 0 36962 18782 18782 0.00
parry 2.30 3.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9702 9.7% 313.0 1.44sec 13951 9709 10028 20531 13951 43.1% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.02 313.02 0.00 0.00 1.4369 0.0000 4366972.71 4366972.71 0.00 9709.30 9709.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.12 32.62% 10027.53 7936 18481 10028.86 9315 10988 1023992 1023992 0.00
crit 134.81 43.07% 20531.11 15871 36962 20543.26 18986 22659 2767851 2767851 0.00
glance 75.25 24.04% 7625.01 5952 13861 7628.50 6893 8424 573769 573769 0.00
block 0.12 0.04% 11694.03 7936 18481 1281.97 0 18481 1362 1362 0.00
parry 0.73 0.23% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7728 / 697
claw 3683 0.3% 13.9 24.77sec 10564 6864 6939 14763 10564 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.94 0.00 0.00 1.5391 0.0000 147308.21 147308.21 0.00 6864.00 6864.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.48 53.66% 6938.85 4097 11820 6925.20 4097 11014 51921 51921 0.00
crit 6.46 46.34% 14763.29 8194 23640 14796.11 8194 23640 95387 95387 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4045 0.4% 30.0 11.00sec 5394 4171 3674 7731 5394 47.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 161809.09 161809.09 0.00 4170.98 4170.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.63 28.77% 3673.82 2934 4620 3670.48 2934 4620 31711 31711 0.00
crit 14.18 47.27% 7731.35 5867 9241 7733.22 6408 9003 109637 109637 0.00
glance 7.19 23.96% 2846.69 2200 3465 2844.90 0 3465 20460 20460 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.84sec 0 0 0 0 0 44.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.31 55.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.69 44.88% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7727 / 697
claw 3687 0.3% 13.9 24.77sec 10575 6871 6930 14781 10575 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.94 0.00 0.00 1.5390 0.0000 147468.23 147468.23 0.00 6871.13 6871.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.47 53.57% 6930.30 4097 11820 6915.14 4097 11820 51776 51776 0.00
crit 6.47 46.43% 14781.00 8194 23640 14813.56 0 23640 95692 95692 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4041 0.4% 30.0 11.00sec 5388 4166 3671 7734 5388 47.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 161625.96 161625.96 0.00 4166.26 4166.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.64 28.79% 3670.98 2934 4620 3666.26 0 4503 31708 31708 0.00
crit 14.14 47.13% 7734.21 5867 9241 7736.69 6437 9045 109345 109345 0.00
glance 7.22 24.08% 2847.57 2200 3465 2846.02 0 3465 20573 20573 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7725 / 697
cackling_howl 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3678 0.3% 13.9 24.77sec 10552 6856 6931 14786 10552 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.94 13.94 0.00 0.00 1.5391 0.0000 147135.47 147135.47 0.00 6855.63 6855.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.52 53.91% 6931.31 4097 11820 6916.56 4097 10914 52103 52103 0.00
crit 6.43 46.09% 14785.53 8194 23640 14814.61 0 23640 95032 95032 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4047 0.4% 30.0 11.00sec 5396 4173 3672 7736 5396 47.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 161873.15 161873.15 0.00 4172.63 4172.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.59 28.64% 3671.94 2934 4620 3668.43 3029 4620 31551 31551 0.00
crit 14.19 47.31% 7736.40 5867 9241 7738.34 6755 8892 109804 109804 0.00
glance 7.21 24.05% 2844.06 2200 3465 2842.11 0 3465 20518 20518 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7727 / 697
claw 3683 0.3% 13.9 24.77sec 10564 6864 6929 14787 10564 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.95 13.95 0.00 0.00 1.5391 0.0000 147318.44 147318.44 0.00 6863.51 6863.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.49 53.74% 6928.95 4097 11820 6915.28 0 11820 51932 51932 0.00
crit 6.45 46.26% 14787.07 8194 23640 14818.14 0 23640 95387 95387 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4044 0.4% 30.0 11.00sec 5392 4170 3672 7736 5392 47.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 161774.92 161774.92 0.00 4170.10 4170.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.61 28.71% 3671.55 2934 4620 3667.62 0 4620 31626 31626 0.00
crit 14.17 47.23% 7735.95 5867 9241 7739.01 6691 9082 109617 109617 0.00
glance 7.22 24.05% 2845.21 2200 3465 2844.55 0 3465 20532 20532 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13324 / 6439
dire_beast_melee 13324 6.4% 161.3 2.76sec 17951 11531 13771 28259 17951 34.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.29 161.29 0.00 0.00 1.5568 0.0000 2895239.25 2895239.25 0.00 11530.73 11530.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.14 41.62% 13770.57 11929 17925 13774.94 13112 14633 924497 924497 0.00
crit 55.41 34.35% 28259.25 23858 35851 28270.97 26440 30190 1565725 1565725 0.00
glance 38.75 24.02% 10452.42 8947 13444 10457.23 9844 11334 405017 405017 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 5.0 0.0 76.9sec 85.1sec 93.60% 94.58%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:93.6%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.09% 14.09%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 14.95%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 11.3 0.0 41.4sec 41.4sec 24.87% 23.16%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.9%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
master_marksman 21.4 41.7 20.7sec 6.9sec 56.25% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_1:28.3%
  • master_marksman_2:27.9%

Spelldata details

  • id:82925
  • name:Ready, Set, Aim...
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
master_marksman_fire 20.7 0.0 20.9sec 20.9sec 7.86% 6.56%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman_fire
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_fire_1:7.9%

Spelldata details

  • id:82926
  • name:Fire!
  • tooltip:Aimed Shot cast time and Focus cost reduced by $s1%.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
rapid_fire 4.3 0.0 108.1sec 108.1sec 14.00% 18.14%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:14.0%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 7.2 0.0 65.9sec 65.9sec 23.49% 23.49%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.5%
steady_focus 17.8 32.3 25.3sec 8.8sec 88.99% 86.05%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • steady_focus_1:89.0%

Spelldata details

  • id:53220
  • name:Steady Focus
  • tooltip:Ranged attack speed increased by $w1%. Steady Shot Focus generation increased by $w2.
  • description:$@spelldesc53224
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
terror_in_the_mists 7.4 0.0 64.6sec 64.6sec 32.05% 32.05%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.1%
virmens_bite_potion 2.0 0.0 397.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-rabid 4.3 0.0 120.6sec 120.7sec 18.72% 22.12%

Buff details

  • buff initial source:Hunter_MM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:18.7%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T14H
aimed_shot Focus 20.0 926.1 46.3 46.3 2420.3
arcane_shot Focus 95.9 1917.3 20.0 20.0 2144.4
chimera_shot Focus 43.7 1964.5 45.0 45.0 2203.8
glaive_toss Focus 30.0 450.2 15.0 15.0 6611.5
serpent_sting Focus 1.2 29.0 25.0 25.0 44492.5
pet - cat
claw Focus 128.1 3429.6 26.8 26.8 749.5
pet - devilsaur
claw Focus 13.9 520.3 37.3 37.3 283.1
pet - raptor
claw Focus 13.9 520.3 37.3 37.3 283.4
pet - hyena
claw Focus 13.9 520.3 37.3 37.3 282.8
pet - wolf
claw Focus 13.9 520.4 37.3 37.3 283.1
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.50 2578.55 1.43 99.46 3.71%
rapid_recuperation Focus 254.60 60.41 0.24 10.88 15.26%
steady_shot Focus 134.92 1832.28 13.58 56.61 3.00%
dire_beast Focus 161.29 762.99 4.73 43.46 5.39%
pet - cat
focus_regen Focus 1801.50 3347.52 1.86 0.00 0.00%
pet - devilsaur
focus_regen Focus 160.00 345.17 2.16 0.25 0.07%
pet - raptor
focus_regen Focus 160.00 345.17 2.16 0.25 0.07%
pet - hyena
focus_regen Focus 160.00 345.17 2.16 0.25 0.07%
pet - wolf
focus_regen Focus 160.00 345.17 2.16 0.25 0.07%
Resource RPS-Gain RPS-Loss
Focus 11.62 11.74
Combat End Resource Mean Min Max
Health 461207.00 461207.00 461207.00
Focus 47.18 1.42 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 1.8%
cat-Focus Cap 1.8%
raptor-Focus Cap 1.8%
wolf-Focus Cap 1.8%
dire_beast-Focus Cap 1.8%

Procs

Count Interval
wild_quiver 185.6 2.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 99892.48
Minimum 93654.84
Maximum 106742.39
Spread ( max - min ) 13087.55
Range [ ( max - min ) / 2 * 100% ] 6.55%
Standard Deviation 1739.2122
5th Percentile 97065.76
95th Percentile 102795.12
( 95th Percentile - 5th Percentile ) 5729.37
Mean Distribution
Standard Deviation 17.3956
95.00% Confidence Intervall ( 99858.38 - 99926.57 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1164
0.1 Scale Factor Error with Delta=300 25821
0.05 Scale Factor Error with Delta=300 103287
0.01 Scale Factor Error with Delta=300 2582193
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 99892.48

Damage

Sample Data
Count 9996
Mean 31826964.16

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 432.70
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 5.00 aspect_of_the_hawk,moving=0
9 4.00 aspect_of_the_fox,moving=1
A 24.94 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 4.30 blood_fury
D 30.01 glaive_toss,if=enabled
E 0.00 powershot,if=enabled
F 0.00 barrage,if=enabled
G 0.00 blink_strike,if=enabled
H 6.85 lynx_rush,if=enabled&!ticking
I 0.00 multi_shot,if=target.adds>5
J 0.00 steady_shot,if=target.adds>5
K 1.16 serpent_sting,if=!ticking&target.health.pct<=90
L 43.66 chimera_shot,if=target.health.pct<=90
M 15.78 dire_beast,if=enabled
N 2.00 stampede
O 4.32 rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
P 1.70 readiness,wait_for_rapid_fire=1
Q 30.52 steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
R 13.99 kill_shot
S 17.85 aimed_shot,if=buff.master_marksman_fire.react
T 0.00 a_murder_of_crows,if=enabled&!ticking
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 23.15 aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
W 95.86 arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
X 0.00 fervor,if=enabled&focus<=50
Y 106.60 steady_shot

Sample Sequence

8ACDHMNOPDHMVAVAYQVAVAYYVAVAYDVVAYQYVAYVAYYVAYDVMVAYQVAV9AKLOYYYD8SVAVAYQLYYVAYYDYLMSWYQWWWLWWDYQYSLWWWYQYYDHLMSWYQWWWLWWYDYQSLWWCWYYYYLD9AMSWYQW8LWWWYDYQLWWWYYYSLWDWMYQYLWWWYYWYDLWWWYQYYLWHWYDMSYLWWWYQYWLDWWYQYY9ALSWWY8DMYLWOYQVAVAYYLYYDVAYCVAYYLWWYYYSDLMWWYQYWLSWWYDYQLWWWHYYYLWDWMYQSWLWWYYY9ADWLNWY8QYWLWYWDMYQLSWWYYWWYDLWWYQYYWLSWWYDMYQLWSWYYRRWCLDWWYQHWRLRWYQYDMLSRRWYQ7WWLWWDRRYQYLWWWYROPDHLMRSYQVAVAYYLRDORVAYYVASLVAYRRVAYDYMLWYQR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.56% 22.56% 1965

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
Shirt empty
Chest sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
Waist rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
Wrists stonemaw_armguards,id=87014,enchant=180agi
Hands yaungol_slayers_gloves,id=87003,enchant=170haste
Finger1 painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_MM_T14H"
origin="unknown"
level=90
race=orc
spec=marksmanship
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/blood_fury
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health.pct<=90
actions+=/chimera_shot,if=target.health.pct<=90
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
actions+=/fervor,if=enabled&focus<=50
actions+=/steady_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_SV_T14H : 101591 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
101591.5 101591.5 26.72 / 0.03% 2250 / 2.2% 7328.2 10.0 9.9 Focus 0.00% 54.4 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

Charts

http://6.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:565909|295643|190197|176807|109046|95641|71399|48232|19963|12364&chds=0,1131817&chco=C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++565909++stampede,C79C6E,0,0,15|t++295643++lynx_rush,C79C6E,1,0,15|t++190197++black_arrow,9482C9,2,0,15|t++176807++dire_beast,C79C6E,3,0,15|t++109046++kill_shot,C79C6E,4,0,15|t++95641++glaive_toss,C79C6E,5,0,15|t++71399++explosive_shot,C41F3B,6,0,15|t++48232++arcane_shot,69CCF0,7,0,15|t++19963++cobra_shot,ABD473,8,0,15|t++12364++ranged,C79C6E,9,0,15&chtt=Hunter_SV_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,16,13,13,11,10,9,9,8,7,6,5,0,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,C79C6E,C79C6E,69CCF0,9482C9,ABD473,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=explosive_shot|ranged|cat: melee|arcane_shot|black_arrow|serpent_sting|glaive_toss|dire_beast: dire_beast_melee|cobra_shot|cat: lynx_rush|cat: claw|kill_shot|raptor: melee|hyena: melee|wolf: melee|devilsaur: melee|raptor: claw|wolf: claw|hyena: claw|devilsaur: claw|serpent_sting_burst&chtt=Hunter_SV_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uxz2435555567875564420wvroolkihffedcbaZZZZYYXXWWWWVWWVVUUVVVVVVWWXXXXWXXWXXXYXYZZZZaZZZZZZaaaaaaZZZZYYYXXYXYXYYYYYYYYYYZYXXWXXXXXXXXXXXWWXXXXYZZaZZZZYZYYYYYXXXXXXXXWXWWWWWWWWWXWXXXXXYYYYYZZZZZZZZZZZYZZZZZZZZYZZZZZZZZZZZYYYXXWWWWWWWWVWWWXXYYZZZZZZZZZZZZZZYYYYYYXXYXXYYYZZZaaaabbabaaaaaaaaaaZZYYYXWWWVVVWWWWXXXXYYYZZaabbccccccbbabbbbbbbbbbbbbbabaabaaaaaZZYZZYZZZZabcdefggggggggffffffffffeeedeeefffghghhhhhggggfffeeeeeeddddccccbbbbbbbbbbbbbbbbbbbbbbbbaaaaaabbbbbbccccdddeeeeeeeeffgggghhhhhhhhihhhhhhgffeeddcccbbbbabaaaaaaaaaaaaabbbabbaaaaaZZZYYXXXXXWWWVU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=101591|max=220437&chxp=1,1,46,100&chtt=Hunter_SV_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,3,4,7,17,17,34,50,51,90,120,172,196,243,280,394,447,455,515,547,545,556,606,549,541,499,452,445,375,312,275,261,216,167,139,112,87,59,52,30,23,16,11,6,13,2,1,1,0,1&chds=0,606&chbh=5&chxt=x&chxl=0:|min=97114|avg=101591|max=107005&chxp=0,1,45,100&chtt=Hunter_SV_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.9,28.6,19.0,6.9,4.1,3.5,3.1,1.6,1.2,0.9,0.5,0.5&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,69CCF0,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,ABD473,ABD473,ABD473,C79C6E&chl=explosive_shot 134.6s|cobra_shot 129.0s|arcane_shot 85.8s|glaive_toss 31.0s|black_arrow 18.7s|dire_beast 16.0s|kill_shot 13.9s|lynx_rush 7.3s|aspect_of_the_hawk 5.2s|aspect_of_the_fox 4.1s|serpent_sting 2.3s|stampede 2.1s&chtt=Hunter_SV_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_SV_T14H 101591
arcane_shot 9185 9.0% 82.8 5.27sec 49992 48232 37011 76634 50120 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.79 82.58 0.00 0.00 1.0365 0.0000 4139053.35 4139053.35 0.00 48231.72 48231.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.26 66.92% 37011.43 34974 42444 37012.54 36447 37619 2045307 2045307 0.00
crit 27.32 33.08% 76633.85 72047 87434 76641.28 74577 79168 2093746 2093746 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus>=67
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
aspect_of_the_fox 0 0.0% 4.0 84.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_fox

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_fox

Static Values
  • id:82661
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82661
  • name:Aspect of the Fox
  • school:nature
  • tooltip:Steady Shot, Cobra Shot, and Barrage can be shot while moving. Melee attacks received instantly generate $ Focus.
  • description:The Hunter takes on the aspects of a fox, allowing $G him:her; to shoot Steady Shot, Cobra Shot, and Barrage while moving and causing $G him:her; to gain $<focus> Focus whenever $G he:she; receives a melee attack. Only one Aspect can be active at a time.
aspect_of_the_hawk 0 0.0% 5.0 85.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aspect_of_the_hawk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: aspect_of_the_hawk

Static Values
  • id:13165
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:13165
  • name:Aspect of the Hawk
  • school:nature
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
black_arrow 7877 7.8% 18.0 25.03sec 197128 190197 0 0 0 0.0% 0.0% 0.0% 0.0% 177.8 14691 30631 19953 33.0% 0.0% 78.9%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.00 18.00 177.83 177.83 1.0364 2.0000 3548310.26 3548310.26 0.00 9479.25 190196.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.1 66.99% 14690.64 12617 19899 14695.82 14111 15413 1750073 1750073 0.00
crit 58.7 33.01% 30631.45 25991 40993 30646.39 28999 32789 1798237 1798237 0.00
DPS Timeline Chart

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.time_to_die>=8
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over $3674d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:186.94
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
blood_fury 0 0.0% 4.3 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 5708 5.6% 81.0 5.30sec 31796 19963 23711 48988 31851 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.98 80.84 0.00 0.00 1.5928 0.0000 2574771.50 2574771.50 0.00 19963.03 19963.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.81 67.80% 23711.26 22412 27641 23711.36 23380 24055 1299536 1299536 0.00
crit 26.03 32.20% 48988.13 46170 56941 48989.94 47917 50451 1275235 1275235 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (6271) 0.0% (6.2%) 15.4 29.78sec 183259 176807 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.40 15.40 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 176807.46 176807.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
explosive_shot 21325 21.0% 129.8 3.44sec 74005 71399 18439 38434 25037 33.0% 0.0% 0.0% 0.0% 222.9 21354 43153 28552 33.0% 0.0% 49.5%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.82 129.57 222.87 222.87 1.0365 1.0000 9607344.07 9607344.07 0.00 26879.33 71399.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.82 67.00% 18438.89 15898 25074 18441.92 17874 19049 1600785 1600785 0.00
crit 42.76 33.00% 38434.10 32749 51652 38448.33 36455 41684 1643323 1643323 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.3 66.98% 21353.98 15898 46707 21355.54 19989 22879 3187769 3187769 0.00
crit 73.6 33.02% 43153.47 31796 93414 43162.48 39129 48576 3175467 3175467 0.00
DPS Timeline Chart

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(remains<2.0)
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.234000
  • base_dd_min:145.82
  • base_dd_max:437.45

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:false
  • direct_power_mod:0.234000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:23263.90
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
glaive_toss 6586 6.5% 29.9 15.23sec 99129 95641 36788 76517 49801 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.92 59.55 0.00 0.00 1.0365 0.0000 2965718.04 2965718.04 0.00 95640.56 95640.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.05 67.25% 36788.25 31790 49074 36796.71 35258 38352 1473186 1473186 0.00
crit 19.51 32.75% 76516.93 65488 101093 76553.02 71169 86141 1492532 1492532 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3370 3.3% 13.4 6.06sec 113022 109046 84286 174426 114458 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.45 13.28 0.00 0.00 1.0365 0.0000 1520102.00 1520102.00 0.00 109046.05 109046.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.84 66.53% 84286.11 77805 95953 84329.20 79338 89791 744713 744713 0.00
crit 4.45 33.47% 174425.91 160277 197662 173581.37 0 197662 775389 775389 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4816) 0.0% (4.7%) 7.1 67.64sec 306422 295643 0 0 0 0.0% 0.0% 0.0% 0.0% 63.3 0 0 0 16.3% 0.0% 6.2%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 63.30 63.30 1.0365 0.4442 0.00 0.00 0.00 61102.23 295643.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.0 83.71% 0.00 0 0 0.00 0 0 0 0 0.00
crit 10.3 16.29% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 12036 11.9% 196.4 2.28sec 27614 12364 20360 42211 27614 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 196.35 196.35 0.00 0.00 2.2334 0.0000 5422087.22 5422087.22 0.00 12363.89 12363.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.17 66.80% 20359.86 19043 23673 20362.21 20156 20616 2670614 2670614 0.00
crit 65.18 33.20% 42211.01 39229 48766 42219.07 41195 43176 2751473 2751473 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.5 102.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.51 4.51 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.51 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.8 381.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.81 1.81 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 7061 (7308) 7.0% (7.2%) 2.2 115.60sec 1486364 1434390 0 0 0 0.0% 0.0% 0.0% 0.0% 147.6 15923 33073 21550 32.8% 0.0% 98.3%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.21 2.21 147.60 147.60 1.0362 3.0000 3180828.63 3180828.63 0.00 7392.68 1434389.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.2 67.19% 15923.22 14250 20226 15925.63 15584 16346 1579183 1579183 0.00
crit 48.4 32.81% 33072.94 29355 41665 33082.21 31931 34528 1601646 1601646 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:2
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
serpent_sting_burst 247 0.2% 2.2 115.60sec 49536 0 34863 72270 49536 39.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.21 2.21 0.00 0.00 0.0000 0.0000 109661.63 109661.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.35 60.78% 34863.23 27403 38894 29502.77 0 38894 46906 46906 0.00
crit 0.87 39.22% 72269.83 60450 80122 47203.34 0 80122 62755 62755 0.00
DPS Timeline Chart

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
stampede 0 (2647) 0.0% (2.6%) 2.0 303.63sec 586564 565909 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 565908.66 565908.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 19278 / 19278
claw 4766 4.7% 108.7 4.17sec 19719 12834 13604 27894 19719 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.71 108.71 0.00 0.00 1.5365 0.0000 2143617.19 2143617.19 0.00 12833.65 12833.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.64 56.70% 13603.73 9999 47281 13621.34 11669 15658 838545 838545 0.00
crit 46.72 42.98% 27894.35 19997 94562 27942.48 23240 34244 1303349 1303349 0.00
block 0.09 0.09% 18334.42 10982 47281 1633.80 0 47281 1722 1722 0.00
parry 0.25 0.23% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4816 4.7% 63.3 6.65sec 34210 0 24044 50104 34210 42.5% 3.7% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.30 63.30 0.00 0.00 0.0000 0.0000 2165585.32 2165585.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.22 52.48% 24044.26 17391 36962 24047.24 19917 28310 798846 798846 0.00
crit 26.88 42.46% 50103.58 34782 73924 50177.06 39856 63927 1346647 1346647 0.00
block 0.84 1.32% 24053.12 17391 36962 13647.88 0 36962 20092 20092 0.00
parry 2.37 3.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9696 9.5% 313.0 1.44sec 13941 9703 10026 20517 13941 43.0% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.02 313.02 0.00 0.00 1.4369 0.0000 4363949.94 4363949.94 0.00 9702.67 9702.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.28 32.67% 10025.87 7936 18481 10027.03 9212 10949 1025430 1025430 0.00
crit 134.74 43.05% 20516.81 15871 36962 20528.87 19192 22193 2764482 2764482 0.00
glance 75.12 24.00% 7622.51 5952 13861 7626.07 6938 8636 572586 572586 0.00
block 0.12 0.04% 12067.35 8695 18481 1359.88 0 18481 1451 1451 0.00
parry 0.76 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7324 / 661
claw 3347 0.3% 13.0 26.85sec 10298 6690 6828 14324 10298 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 133879.32 133879.32 0.00 6690.29 6690.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.98 53.70% 6827.65 4097 11820 6817.03 4097 11820 47663 47663 0.00
crit 6.02 46.30% 14323.76 8194 23640 14340.95 0 23640 86216 86216 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3977 0.3% 30.0 11.09sec 5302 4137 3621 7581 5302 47.5% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159063.66 159063.66 0.00 4136.57 4136.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.54 28.46% 3620.70 3219 4620 3620.99 3219 4620 30912 30912 0.00
crit 14.24 47.48% 7581.26 6437 9241 7582.38 6515 8659 107986 107986 0.00
glance 7.22 24.06% 2793.56 2414 3465 2793.03 0 3465 20166 20166 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 64.05sec 0 0 0 0 0 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.24 53.94% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.76 46.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 303.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7339 / 662
claw 3355 0.3% 13.0 26.85sec 10324 6707 6797 14393 10324 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5392 0.0000 134209.28 134209.28 0.00 6707.11 6707.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 53.57% 6796.78 4097 11820 6784.27 0 11820 47331 47331 0.00
crit 6.04 46.43% 14392.79 8194 23640 14417.78 0 23640 86878 86878 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3983 0.3% 30.0 11.09sec 5311 4144 3623 7577 5311 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159330.79 159330.79 0.00 4143.52 4143.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.53 28.43% 3622.80 3219 4620 3623.36 3219 4462 30902 30902 0.00
crit 14.31 47.70% 7576.64 6437 9241 7576.98 6628 8703 108417 108417 0.00
glance 7.16 23.87% 2794.61 2414 3465 2793.76 0 3465 20011 20011 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7333 / 662
cackling_howl 0 0.0% 2.0 303.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3351 0.3% 13.0 26.85sec 10309 6698 6819 14341 10309 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5392 0.0000 134020.92 134020.92 0.00 6697.70 6697.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.97 53.60% 6819.39 4097 11820 6810.03 0 11820 47521 47521 0.00
crit 6.03 46.40% 14341.36 8194 23640 14370.92 0 23640 86500 86500 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3982 0.3% 30.0 11.09sec 5310 4143 3622 7575 5310 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159297.91 159297.91 0.00 4142.67 4142.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.51 28.35% 3622.31 3219 4620 3622.11 3219 4409 30810 30810 0.00
crit 14.31 47.70% 7574.56 6437 9241 7574.33 6550 8732 108402 108402 0.00
glance 7.18 23.94% 2796.31 2414 3465 2795.40 0 3465 20086 20086 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7333 / 662
claw 3352 0.3% 13.0 26.85sec 10313 6700 6809 14367 10313 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 134064.97 134064.97 0.00 6699.56 6699.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.97 53.64% 6808.51 4097 11820 6797.13 4097 11820 47476 47476 0.00
crit 6.03 46.36% 14367.00 8194 23640 14394.50 0 23640 86589 86589 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3982 0.3% 30.0 11.09sec 5309 4142 3623 7575 5309 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159261.81 159261.81 0.00 4141.73 4141.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.53 28.45% 3622.71 3219 4620 3622.25 3219 4620 30914 30914 0.00
crit 14.30 47.66% 7574.95 6437 9241 7575.24 6593 8716 108302 108302 0.00
glance 7.17 23.90% 2796.05 2414 3465 2795.38 0 3465 20045 20045 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13532 / 6271
dire_beast_melee 13532 6.2% 157.5 2.81sec 17914 11496 13752 28123 17914 34.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.49 157.49 0.00 0.00 1.5583 0.0000 2821316.68 2821316.68 0.00 11495.82 11495.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.24 41.43% 13751.86 11929 17925 13756.17 13135 14573 897207 897207 0.00
crit 54.39 34.53% 28122.73 23858 35851 28137.87 26521 29898 1529521 1529521 0.00
glance 37.87 24.04% 10420.93 8947 13444 10424.98 9761 11299 394589 394589 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 5.0 0.0 76.9sec 85.0sec 93.60% 95.48%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:93.6%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.13% 14.13%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 15.51%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lock_and_load 30.5 0.0 14.6sec 14.6sec 12.64% 46.93%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:12.00
  • cooldown:10.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • lock_and_load_1:7.7%
  • lock_and_load_2:4.9%

Spelldata details

  • id:56453
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown and costs no Focus.
  • description:$@spelldesc56343
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
lord_blastingtons_scope_of_doom 11.3 0.0 41.4sec 41.4sec 24.81% 23.05%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.8%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
rapid_fire 4.5 0.0 102.5sec 102.5sec 14.64% 19.95%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:14.6%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 7.0 0.0 67.0sec 67.0sec 23.03% 23.03%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.0%
terror_in_the_mists 7.3 0.0 65.0sec 65.0sec 31.93% 31.93%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:31.9%
virmens_bite_potion 2.0 0.0 397.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-rabid 4.3 0.0 120.7sec 120.5sec 18.70% 22.53%

Buff details

  • buff initial source:Hunter_SV_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:18.7%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 303.7sec 303.7sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 303.7sec 303.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 303.7sec 303.7sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 303.7sec 303.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 303.7sec 303.7sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 303.7sec 303.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 303.7sec 303.7sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 303.7sec 303.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T14H
arcane_shot Focus 82.8 1655.9 20.0 20.0 2499.6
black_arrow Focus 18.0 630.0 35.0 35.0 5632.2
explosive_shot Focus 129.8 1722.4 13.3 13.3 5577.7
glaive_toss Focus 29.9 448.8 15.0 15.0 6608.6
serpent_sting Focus 2.2 55.3 25.0 25.0 59454.5
pet - cat
claw Focus 108.7 2842.8 26.1 26.1 754.1
pet - devilsaur
claw Focus 13.0 475.0 36.5 36.5 281.9
pet - raptor
claw Focus 13.0 475.0 36.5 36.5 282.5
pet - hyena
claw Focus 13.0 475.0 36.5 36.5 282.1
pet - wolf
claw Focus 13.0 475.0 36.5 36.5 282.2
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.50 2159.76 1.20 47.03 2.13%
cobra_shot Focus 80.84 1112.37 13.76 19.36 1.71%
dire_beast Focus 157.49 771.07 4.90 16.40 2.08%
viper_venom Focus 147.60 435.74 2.95 7.06 1.60%
pet - cat
focus_regen Focus 1801.50 2758.48 1.53 0.00 0.00%
pet - devilsaur
focus_regen Focus 159.98 305.76 1.91 0.21 0.07%
pet - raptor
focus_regen Focus 159.98 305.76 1.91 0.21 0.07%
pet - hyena
focus_regen Focus 159.98 305.76 1.91 0.22 0.07%
pet - wolf
focus_regen Focus 159.98 305.77 1.91 0.21 0.07%
Resource RPS-Gain RPS-Loss
Focus 9.94 10.02
Combat End Resource Mean Min Max
Health 461207.00 461207.00 461207.00
Focus 65.98 15.87 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
lock_and_load 30.5 14.6sec
explosive_shot_focus_starved 0.2 107.3sec
black_arrow_focus_starved 0.4 86.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 101591.48
Minimum 97114.06
Maximum 107004.66
Spread ( max - min ) 9890.60
Range [ ( max - min ) / 2 * 100% ] 4.87%
Standard Deviation 1363.2357
5th Percentile 99406.05
95th Percentile 103906.13
( 95th Percentile - 5th Percentile ) 4500.08
Mean Distribution
Standard Deviation 13.6351
95.00% Confidence Intervall ( 101564.75 - 101618.20 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 6
0.1% Error 691
0.1 Scale Factor Error with Delta=300 15864
0.05 Scale Factor Error with Delta=300 63457
0.01 Scale Factor Error with Delta=300 1586446
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 101591.48

Damage

Sample Data
Count 9996
Mean 33067876.69

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 408.62
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 4.31 blood_fury
9 5.00 aspect_of_the_hawk,moving=0
A 4.00 aspect_of_the_fox,moving=1
B 5.00 auto_shot
C 0.00 explosive_trap,if=target.adds>0
D 0.00 a_murder_of_crows,if=enabled&!ticking
E 0.00 blink_strike,if=enabled
F 7.07 lynx_rush,if=enabled&!ticking
G 29.92 glaive_toss,if=enabled
H 0.00 powershot,if=enabled
I 0.00 barrage,if=enabled
J 0.00 multi_shot,if=target.adds>2
K 0.00 cobra_shot,if=target.adds>2
L 2.21 serpent_sting,if=!ticking&target.time_to_die>=10
M 129.82 explosive_shot,if=(remains<2.0)
N 13.45 kill_shot
O 18.00 black_arrow,if=!ticking&target.time_to_die>=8
P 15.40 dire_beast,if=enabled
Q 2.00 stampede
R 4.51 rapid_fire
S 1.81 readiness,wait_for_rapid_fire=1
T 82.79 arcane_shot,if=focus>=67
U 0.00 fervor,if=enabled&focus<=50
V 82.34 cobra_shot

Sample Sequence

89BFGLMOPQMMMRSFGMPTTTVLMMMTTTOGMRVVMMMTTVVTMTTGMABMMPVO9TMVVGMMMTTVTVMTVMGMMOVPTVMVMMMGTVTTMVVMMFMOGVVMPMMMTTVTT8GMVVTTMOVABVVMG9MMMPVTTMMMVTGOVMMMMVVTTMMGMMVPTVMTOVVMGTMMMVVTFMMMMTGVVMOPVMMMRTTVGABMTTMMM9TVTTMOVGVMPMMMV8VTTMVGMMMTVOVMVTTVGMPVTTVMTMMMTVGOVFMMMTVTVMMGMMPVABTTMVO9QMGMMVTVTMVVMMMGTVPOMVMMMTTVGTMVVTTMMMVTOGVMN8MMMNPVVMMGMFMNNTTOMVMMMGNN7VRSFGMMMNNPTTMOVVTRTGMNNTTMMMVVTTNMGNVOPMVVMMMNNGTTMMMMVV

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.28% 11.28% 1965

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
Shirt empty
Chest sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
Waist rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
Wrists stonemaw_armguards,id=87014,enchant=180agi
Hands yaungol_slayers_gloves,id=87003,enchant=170haste
Finger1 painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_SV_T14H"
origin="unknown"
level=90
race=orc
spec=survival
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/blood_fury
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking&target.time_to_die>=10
actions+=/explosive_shot,if=(remains<2.0)
actions+=/kill_shot
actions+=/black_arrow,if=!ticking&target.time_to_die>=8
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=67
actions+=/fervor,if=enabled&focus<=50
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Mage_Arcane_T14H : 121979 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
121979.2 121979.2 71.08 / 0.06% 5979 / 4.9% 16.5 7250.9 7096.8 Mana 0.02% 42.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
Glyphs
  • evocation
  • mana_gem
  • slow
  • mirror_image

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:246335|183286|169540|153216|93484|54690|17254&chds=0,492670&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,C41F3B,0070DE&chm=t++246335++mirror_image,69CCF0,0,0,15|t++183286++nether_tempest,69CCF0,1,0,15|t++169540++arcane_barrage,69CCF0,2,0,15|t++153216++arcane_missiles,69CCF0,3,0,15|t++93484++arcane_blast,69CCF0,4,0,15|t++54690++fire_blast,C41F3B,5,0,15|t++17254++ice_lance,0070DE,6,0,15&chtt=Mage_Arcane_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:37,34,15,13,2,0,0&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,C41F3B,0070DE&chl=arcane_blast|arcane_missiles|nether_tempest|arcane_barrage|mirror_image: arcane_blast|fire_blast|ice_lance&chtt=Mage_Arcane_T14H Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:adgjklmoqrtw02478776531zywvurpmjhfdbaZYXWVUTSSRRQQQQQQQQRQQQRRSTUVVVVWWWWWWWWWWWXXXWWVVVVWWWWXXXXXXXYZZZaabbbbaaaaZZZZYYXWWVUTSSRQQQPPPPPPPPQRRRSTTTUUVVVVVWWWWWVVUUUUUUUUVVUUUUTTTTTTTUUUUUUVVVWXYYZabccdeeffghgffedcbbaZYXWWVUUTTRRRSSSSTTTTTTTTSSSSSSSSSSSSSSSTTTTUUUVVVVVWWWXXXXXXXXXXXXXWWWXWWWWWVUUUTSSSSRRRQQQQQRQQRSSSTUUUUVVVWWWWWWWWWWWWWWWWWWVVVVVUUUUUTTTTSSSTTTTUUUUUVVVVWWXXXYYYZZZZZZaabbccdddeeeeeeeeeeddcbbaZZYXXWWVVUUUTTTTTTTTTTTTTTTTTTUUUUUUUUUUUUUUUUUUUUVVVVVVVVWWWWWXXXXYYYYYYYYYYYYYYYYYXXXXWWWVVVVVVVUUUUUUUUUVVVVVWWWWWWWWWVVVVVUUUUUTTTTSSR&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=121979|max=310700&chxp=1,1,39,100&chtt=Mage_Arcane_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,5,0,11,10,18,25,32,61,75,112,127,176,234,260,327,438,473,529,569,653,724,708,648,654,585,536,454,393,337,221,183,120,118,60,49,32,19,4,5,5,0,1,0,0,0,0,0,1&chds=0,724&chbh=5&chxt=x&chxl=0:|min=107726|avg=121979|max=138613&chxp=0,1,46,100&chtt=Mage_Arcane_T14H DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.9,26.5,9.6,9.3,2.5,1.8,1.1,0.9,0.0&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,0070DE,69CCF0,C41F3B,69CCF0,ffffff&chl=arcane_blast 216.0s|arcane_missiles 119.4s|nether_tempest 43.1s|arcane_barrage 42.0s|ice_lance 11.3s|rune_of_power 7.9s|fire_blast 4.8s|mirror_image 3.9s|waiting 0.1s&chtt=Mage_Arcane_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Arcane_T14H 121979
alter_time_activate 0 0.0% 2.6 200.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.64 2.64 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
arcane_barrage 15809 13.0% 34.9 11.98sec 204324 169540 174726 366528 204324 15.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.85 34.85 0.00 0.00 1.2052 0.0000 7120853.91 7120853.91 0.00 169540.10 169540.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.41 84.39% 174726.46 53258 326373 174964.75 130318 201326 5139048 5139048 0.00
crit 5.41 15.51% 366528.41 119688 672329 365424.61 0 669594 1981805 1981805 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1500.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage. Consumes all Arcane Charges. Arcane Barrage's damage is increased by $36032s1% per Arcane Charge, and it hits $36032s3 additional nearby $Ltarget:targets; per Arcane Charge for $44425s2% damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.235000
  • base_dd_min:1482.80
  • base_dd_max:1812.31
arcane_blast 44835 36.8% 137.5 3.27sec 146786 93484 125476 262618 146786 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.55 137.55 0.00 0.00 1.5702 0.0000 20190124.60 20190124.60 0.00 93483.62 93483.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.94 84.29% 125476.01 44000 280352 125629.39 112810 139074 14548024 14548024 0.00
crit 21.48 15.62% 262617.56 94950 577525 262979.90 185233 364710 5642100 5642100 0.00
miss 0.12 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.$?s86209[ Also applies the Slow spell to any target it damages if no target is currently affected by your Slow.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.045000
  • base_dd_min:672.94
  • base_dd_max:782.07
arcane_missiles 40596 33.3% 67.7 6.53sec 270124 153216 0 0 0 0.0% 0.0% 0.0% 0.0% 334.8 46839 98255 54866 15.7% 0.1% 22.6%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.70 67.70 334.79 333.29 1.7630 0.3041 18286507.23 18286507.23 0.00 153216.20 153216.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 280.7 84.21% 46838.58 16568 85838 46836.59 37645 52899 13146656 13146656 0.00
crit 52.3 15.70% 98254.67 34233 176826 98260.44 75493 116658 5139851 5139851 0.00
miss 0.3 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up|buff.arcane_missiles.stack=2
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:Launches five waves of Arcane Missiles at the enemy over $5143d, causing $7268s1 Arcane damage per wave. Generates an Arcane Charge. Arcane Missiles' damage is increased by $36032s1% per Arcane Charge. Arcane Missiles has a chance to be activated after each of your damaging spell casts. Limit $79683s1 charges.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:$@spelldesc5143
Direct Damage
  • may_crit:true
  • direct_power_mod:0.295000
  • base_dd_min:392.37
  • base_dd_max:392.37
arcane_power 0 0.0% 5.2 95.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.21 5.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
berserking 0 0.0% 2.9 186.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
fire_blast 586 0.5% 4.0 85.07sec 65002 54690 56000 115716 65002 15.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.1886 0.0000 260269.18 260269.18 0.00 54689.89 54689.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.39 84.72% 56000.16 34549 82943 55957.39 0 82943 189967 189967 0.00
crit 0.61 15.17% 115715.66 74167 170862 55859.01 0 170862 70302 70302 0.00
miss 0.00 0.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:2136
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2136
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Blasts the enemy for $s1 Fire damage. $?s89926&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards.][]$?s89926&s44457[Also spreads your Living Bomb effect to up to 2 nearby enemy targets within $119717A1 yards.][]$?s89926&s112948[Also instantly triggers your Frost Bomb effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.789000
  • base_dd_min:963.74
  • base_dd_max:1142.80
ice_lance 440 0.4% 9.6 29.88sec 20283 17254 17470 36291 20283 15.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.62 9.62 0.00 0.00 1.1755 0.0000 195044.50 195044.50 0.00 17254.47 17254.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.16 84.89% 17470.22 11146 25955 17459.50 14148 22360 142619 142619 0.00
crit 1.44 15.02% 36291.02 22891 53468 28553.95 0 53468 52425 52425 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:Deals $?a44544[${$m1*1.25} to ${$M1*1.25}][$s1] Frost damage to an enemy target$?s56377&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]$?s56377&a44544[, and ${$m1*1.25*$56377m2/100} to ${$M1*1.25*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is quadrupled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
mirror_image 0 (2171) 0.0% (1.8%) 3.0 181.12sec 323494 246335 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.3132 0.0000 0.00 0.00 0.00 246335.19 246335.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 17543 14.4% 35.1 13.00sec 225081 183286 0 0 0 0.0% 0.1% 0.0% 0.0% 534.3 12635 26368 14778 15.6% 0.0% 91.1%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.08 35.08 534.26 534.26 1.2280 0.7684 7895246.21 7895246.21 0.00 17405.67 183286.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.05 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 450.9 84.40% 12635.20 7246 20397 12638.85 11766 13390 5697280 5697280 0.00
crit 83.4 15.60% 26368.19 14927 42019 26379.48 23904 29104 2197967 2197967 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 5.4 91.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
rune_of_power 0 0.0% 7.4 64.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.41 7.41 0.00 0.00 1.0702 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:(null)
  • description:Places a Rune of Power on the ground, which lasts for $116011d. While standing in your own Rune of Power, your mana regeneration is increased by $116014s1% and your spell damage is increased by $116014s2%. Only $116011s1 Runes of Power can be placed at one time.$?s56380[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.
pet - mirror_image 11174 / 2171
arcane_blast 11174 1.8% 147.2 2.69sec 6587 3826 5635 11464 6587 16.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.20 147.20 0.00 0.00 1.7215 0.0000 969575.31 969575.31 0.00 3826.11 3826.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.90 83.49% 5634.74 2517 7286 5634.54 5265 6017 692527 692527 0.00
crit 24.17 16.42% 11463.99 5033 14571 11465.30 9139 13588 277049 277049 0.00
miss 0.13 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88084
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:866.45
  • base_dd_max:1006.95

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.6 0.0 200.0sec 200.0sec 3.51% 3.51%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.5%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_charge 31.2 176.7 13.9sec 2.2sec 78.44% 95.48%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:14.5%
  • arcane_charge_2:10.1%
  • arcane_charge_3:10.0%
  • arcane_charge_4:7.6%
  • arcane_charge_5:8.3%
  • arcane_charge_6:28.0%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_missiles 32.9 36.0 13.8sec 6.5sec 57.53% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_missiles
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_missiles_1:51.6%
  • arcane_missiles_2:5.9%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to $79683s1 charges and lasts $79683d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
arcane_power 5.6 2.3 88.4sec 59.5sec 20.31% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_power_1:20.3%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
  • max_stacks:
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
berserking 3.6 1.0 137.0sec 98.6sec 8.39% 12.77%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:8.4%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 12.0sec 10.30% 13.94%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.3%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.8 1.7 60.5sec 48.4sec 35.20% 35.20%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.2%
jade_serpent_potion 2.2 0.8 82.7sec 77.6sec 11.39% 11.39%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.4%
jade_spirit 9.1 0.6 51.6sec 48.3sec 23.76% 24.52%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.8%
lightweave_embroidery_3 7.6 1.3 62.3sec 52.4sec 25.78% 25.78%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.8%
presence_of_mind 5.4 0.0 91.1sec 91.1sec 1.22% 1.65%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.2%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
raid_movement 4.0 0.0 84.9sec 84.9sec 6.31% 6.31%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.3 0.8 50.6sec 46.4sec 30.74% 30.74%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.7%
rune_of_power 7.4 2.6 65.2sec 50.1sec 95.68% 95.66%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_power_1:95.7%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Mana regeneration increased by $w1%. Spell damage increased by $w2%.$?$w3=0[][ Health restored by $w3% per second.]
  • description:$@spelldesc116011
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.1 181.2sec 8.0sec 92.55% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.1%
  • arcane_charge_6:11.6%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.1 181.2sec 8.0sec 92.55% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.1%
  • arcane_charge_6:11.6%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.1 181.2sec 8.0sec 92.55% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.1%
  • arcane_charge_6:11.6%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mage_armor

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:3000.20

    Stack Uptimes

    • mage_armor_1:100.0%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by $6117s1. The duration of all harmful Magic effects used against you is reduced by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T14H
alter_time_activate Mana 2.6 8712.2 3300.0 3300.0 0.0
arcane_barrage Mana 34.9 53502.7 1535.2 1535.2 133.1
arcane_blast Mana 137.5 2970396.2 21595.4 21595.4 6.8
fire_blast Mana 4.0 24791.7 6191.7 6191.7 10.5
ice_lance Mana 9.6 29601.5 3078.3 3078.3 6.6
mirror_image Mana 3.0 17983.2 6000.0 6000.0 53.9
nether_tempest Mana 35.1 161012.8 4590.2 4590.2 49.0
time_warp Mana 0.0 517.4 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 1554177.13 862.71 208117.14 11.81%
mana_gem Mana 3.32 186947.90 56324.41 34190.29 15.46%
rune_of_power Mana 1723.31 1455952.80 844.86 230855.05 13.69%
Resource RPS-Gain RPS-Loss
Mana 7096.77 7250.87
Combat End Resource Mean Min Max
Health 458253.00 458253.00 458253.00
Mana 162452.44 11597.83 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
arcane_charge_0 14.5%
arcane_charge_1 12.2%
arcane_charge_2 11.5%
arcane_charge_3 10.6%
arcane_charge_4 10.3%
arcane_charge_5 8.9%
arcane_charge_6 31.9%
dps_rotation 100.0%
water_elemental-arcane_charge_0 14.5%
water_elemental-arcane_charge_1 12.2%
water_elemental-arcane_charge_2 11.5%
water_elemental-arcane_charge_3 10.6%
water_elemental-arcane_charge_4 10.3%
water_elemental-arcane_charge_5 8.9%
water_elemental-arcane_charge_6 31.9%
water_elemental-dps_rotation 100.0%
Uptimes %
Mana Cap 12.7%
water_elemental-Mana Cap 12.7%
mirror_image-Mana Cap 12.7%

Procs

Count Interval
hat_donor 83.4 5.3sec
mana_gem 3.3 158.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 121979.22
Minimum 107725.64
Maximum 138612.64
Spread ( max - min ) 30887.00
Range [ ( max - min ) / 2 * 100% ] 12.66%
Standard Deviation 3625.6478
5th Percentile 115854.92
95th Percentile 127812.75
( 95th Percentile - 5th Percentile ) 11957.83
Mean Distribution
Standard Deviation 36.2637
95.00% Confidence Intervall ( 121908.15 - 122050.30 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3393
0.1 Scale Factor Error with Delta=300 112216
0.05 Scale Factor Error with Delta=300 448864
0.01 Scale Factor Error with Delta=300 11221603
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 121979.22

Damage

Sample Data
Count 9996
Mean 53948045.63

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 321.42
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 mage_armor
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.04 time_warp,if=target.health.pct<25|time>5
A 0.23 arcane_power,if=target.time_to_die<18
B 0.12 berserking,if=target.time_to_die<18
C 2.64 alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
D 0.00 arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
E 39.14 arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
F 6.85 rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
G 1.00 jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
H 3.32 mana_gem,if=mana.pct<84&buff.alter_time.down
I 3.00 mirror_image
J 4.98 arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
K 2.79 berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
L 5.43 presence_of_mind,if=buff.alter_time.down
M 35.08 nether_tempest,if=!ticking
N 109.65 arcane_blast,if=mana.pct>92
O 28.56 arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
P 17.33 arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Q 11.32 arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
R 30.12 arcane_blast
S 6.20 arcane_barrage,moving=1
T 4.00 fire_blast,moving=1
U 9.62 ice_lance,moving=1

Sample Sequence

ILMNNJNKNCEENQREEMENONHNREOPRMNNNENONPMRPNTSUUUSUEMNNNONPNFMENNONPNNMNNONPOLNMJGNNQNNNNEMENOPNNNEMENFPTUSUUFMNNNNNRHNMENEONPMONNNONMPNNINLNPNMNNENPNNFJMNKNRCEENEQEMSTUSUUENNEMNONPONNMNNPRNNNMONQRNNNFMNQRLNNENEMENOQNNEJMNNSTUSUEMNNENONQMRNNEFNOMNQRRNENMNOQNNENMINLONQRRMNRONQRRMNNEFJKNCEENMEENOQNNNEMNONQRNNEMNENORHNMONRRREO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 21602 19208 18083
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 32448 27105 7907
Spell Hit 14.91% 14.91% 5070
Spell Crit 17.57% 11.62% 1879
Spell Haste 17.31% 11.72% 4983
Mana Per 5 17597 16759 0
Attack Power 117 100 0
Melee Hit 14.91% 14.91% 5070
Melee Crit 11.76% 6.75% 1879
Melee Haste 11.72% 11.72% 4983
Swing Speed 22.90% 11.72% 4983
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 58.98% 38.98% 6892

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=crit_hit
Neck amulet_of_seven_curses,id=87028,reforge=crit_mastery
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit
Shirt empty
Chest robes_of_the_unknown_fear,id=87169,gems=160int_320mastery_120int,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=320mastery_80int_160hit_160int_120haste,reforge=hit_mastery
Legs leggings_of_the_burning_scroll,id=87009,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=320mastery_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
Hands gloves_of_the_burning_scroll,id=87007,enchant=170haste
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Arcane_T14H"
origin="unknown"
level=90
race=troll
spec=arcane
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
glyphs=evocation/mana_gem/slow/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/mage_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/arcane_power,if=target.time_to_die<18
actions+=/berserking,if=target.time_to_die<18
actions+=/alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
actions+=/arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
actions+=/rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/mirror_image
actions+=/arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
actions+=/berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/arcane_blast,if=mana.pct>92
actions+=/arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
actions+=/arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
actions+=/arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
actions+=/arcane_blast
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=crit_hit
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3
chest=robes_of_the_unknown_fear,id=87169,gems=160int_320mastery_120int,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=320mastery_80int_160hit_160int_120haste,reforge=hit_mastery
legs=leggings_of_the_burning_scroll,id=87009,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=320mastery_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18083
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5070
# gear_crit_rating=1879
# gear_haste_rating=4983
# gear_mastery_rating=6892
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Fire_T14H : 125901 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
125901.0 125901.0 97.56 / 0.08% 8196 / 6.5% 22.2 5541.5 5131.5 Mana 0.00% 41.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
Glyphs
  • evocation
  • fire_blast
  • counterspell
  • mirror_image

Charts

http://7.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:438913|294698|136654|64988|52464|11913&chds=0,877826&chco=69CCF0,C41F3B,69CCF0,C41F3B,C41F3B,0070DE&chm=t++438913++mirror_image,69CCF0,0,0,15|t++294698++pyroblast,C41F3B,1,0,15|t++136654++nether_tempest,69CCF0,2,0,15|t++64988++fireball,C41F3B,3,0,15|t++52464++inferno_blast,C41F3B,4,0,15|t++11913++ice_lance,0070DE,5,0,15&chtt=Mage_Fire_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,29,14,13,10,3,2,0&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,C41F3B,69CCF0,C41F3B,C41F3B,0070DE&chl=pyroblast|fireball|combustion|ignite|nether_tempest|inferno_blast|mirror_image: fireball|ice_lance&chtt=Mage_Fire_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:RUXaegjlnoqtwy13468776521yxusqolkigfeccbbaaZZYYXWVVUUTTTTSSSSSSSSSTTUVVWXXYYZZaabbbccddddccbaZYXXWVUUTSSRRQPQQQRSTUVVWXYYZZZZYYYXWWWWWWVUTSRRQPPPPPQQRSSSSTTTUVWWXXXYYYYYYYYYYXXXXXWWVVUTTSSTTTUUVWXYYYZaabcdeffffeddbaZYYXXWWVVVVUUUUVVVVWVVVUUUTTTTSSSSRRRRRRRSSTUUVWXXYZabccddeeeeeeddcbaZYXWVUTTSRQQPOONOOPPQQQRRSSSSTTTUVVWXXYYXXWWVVVVVUUUUUUVVVVVVVWWXXXYYYYYXXXXXXXXXXXXWWWVVUUUVVWWWXYYZaabbbcddefffggfffeddcbbaaaZZZZZZZZYYYYXXWWVVVVUUUUTTTTTTTTTUUVVWWXYZZaaabbbbbccccccbaZYYXWVVVUUUTTTTTTTTUVVWXXYYZZZZZZaaaaaaaaaaZYYXWWVVVVVVVVVVVVVVVVVWWWXXXXXXXXWWVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=125901|max=310312&chxp=1,1,41,100&chtt=Mage_Fire_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,5,8,5,14,3,13,25,42,55,80,112,164,165,217,279,311,404,418,494,524,566,551,632,618,591,550,538,462,403,347,293,260,222,150,117,99,82,49,38,37,7,10,10,11,4,4,2,1,2&chds=0,632&chbh=5&chxt=x&chxl=0:|min=108079|avg=125901|max=145449&chxp=0,1,48,100&chtt=Mage_Fire_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.4,13.0,10.9,8.8,7.6,4.1,0.6&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,69CCF0,69CCF0,C41F3B,0070DE,69CCF0&chl=fireball 244.9s|pyroblast 58.7s|evocation 49.2s|nether_tempest 39.6s|inferno_blast 34.4s|ice_lance 18.3s|mirror_image 2.6s&chtt=Mage_Fire_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Fire_T14H 125901
alter_time_activate 0 0.0% 2.8 189.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.83 2.83 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
berserking 0 0.0% 2.9 189.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
combustion 17382 13.8% 12.1 37.93sec 648165 0 46504 96603 61089 29.1% 0.0% 0.0% 0.0% 163.1 32898 68770 43404 29.3% 0.0% 26.7%

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.06 12.06 163.09 163.09 0.0000 0.7363 7815591.40 7815591.40 0.00 65081.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.54 70.83% 46504.49 34298 60186 46521.23 40336 53539 397177 397177 0.00
crit 3.51 29.14% 96603.45 70654 123983 94901.75 0 123983 339436 339436 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.3 70.71% 32898.18 0 89135 32940.26 24395 43662 3794020 3794020 0.00
crit 47.8 29.29% 68770.31 0 183617 68857.99 48886 96050 3284959 3284959 0.00
DPS Timeline Chart

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die<12
Spelldata
  • id:11129
  • name:Combustion
  • school:fire
  • tooltip:(null)
  • description:Instantly deals $s2 Fire damage and stuns the target for $118271d. Burns the target for additional damage over $83853d based on the Pyroblast and Ignite effects already on the target. When cast, resets the cooldown of your Inferno Blast ability.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:952.31
  • base_dd_max:1129.24
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:29590.56
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
evocation 0 0.0% 10.0 46.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 39.7 0 0 0 28.7% 0.0% 10.4%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.98 9.98 39.71 39.71 4.9317 1.1831 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.3 71.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 11.4 28.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
fireball 35323 28.1% 140.9 3.17sec 112967 64988 77038 159940 113344 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.89 140.42 0.00 0.00 1.7383 0.0000 15915779.17 15915779.17 0.00 64988.36 64988.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.86 56.16% 77038.46 56592 99306 77086.92 74204 81166 6075002 6075002 0.00
crit 61.53 43.82% 159940.05 116579 204571 160054.41 154197 167560 9840777 9840777 0.00
miss 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
ice_lance 491 0.4% 15.4 18.03sec 14134 11913 10844 22413 14134 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.42 15.42 0.00 0.00 1.1865 0.0000 217900.11 217900.11 0.00 11912.97 11912.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.02 71.50% 10843.78 8528 13381 10841.33 9238 12293 119522 119522 0.00
crit 4.39 28.47% 22412.79 17567 27566 22245.69 0 27566 98378 98378 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:Deals $?a44544[${$m1*1.25} to ${$M1*1.25}][$s1] Frost damage to an enemy target$?s56377&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]$?s56377&a44544[, and ${$m1*1.25*$56377m2/100} to ${$M1*1.25*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is quadrupled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
ignite 15634 12.4% 217.4 2.05sec 32388 0 0 0 0 0.0% 0.0% 0.0% 0.0% 207.3 33974 0 33974 0.0% 0.0% 92.0%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 217.42 217.42 207.27 207.27 0.0000 2.0000 7041855.75 7041855.75 0.00 16987.07 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.3 100.00% 33974.13 0 151930 34004.29 27389 40820 7041856 7041856 0.00
DPS Timeline Chart

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:$@spelldesc12846
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:28989.39
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
inferno_blast 4013 3.2% 28.4 15.65sec 63388 52464 0 63403 63388 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inferno_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.45 28.45 0.00 0.00 1.2082 0.0000 1803307.33 1803307.33 0.00 52464.43 52464.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 28.44 99.98% 63403.02 46630 81827 63427.50 59764 66898 1803307 1803307 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inferno_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.react&buff.pyroblast.down
Spelldata
  • id:108853
  • name:Inferno Blast
  • school:fire
  • tooltip:(null)
  • description:Blasts the enemy for $s1 Fire damage, and is guaranteed to critical strike. Upon impact, it spreads any $?s89926&s44457[Living Bomb, ][]Pyroblast, Ignite, and Combustion effects to up to 2 nearby enemy targets within $118280A1 yards. $?s89926&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards. ][]$?s89926&s112948[Also instantly triggers your Frost Bomb effect. ][]Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:571.39
  • base_dd_max:677.55
mirror_image 0 (2592) 0.0% (2.0%) 3.0 181.49sec 387501 438913 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.8829 0.0000 0.00 0.00 0.00 438912.78 438912.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 12019 9.5% 32.7 13.90sec 165616 136654 0 0 0 0.0% 0.0% 0.0% 0.0% 504.0 8183 16951 10732 29.1% 0.0% 84.6%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.66 32.66 504.04 504.04 1.2119 0.7565 5409442.80 5409442.80 0.00 12852.94 136653.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.65 99.98% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 357.5 70.93% 8183.47 6021 10539 8186.28 7972 8394 2925757 2925757 0.00
crit 146.5 29.07% 16951.34 12404 21711 16958.29 16425 17639 2483686 2483686 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 5.4 91.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.39 5.39 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pyroblast 38447 30.5% 48.9 9.05sec 353881 294698 150786 313358 222134 43.9% 0.0% 0.0% 0.0% 179.4 24549 51005 36136 43.8% 0.0% 90.2%

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.90 48.72 179.40 179.40 1.2008 2.2638 17305271.95 17305271.95 0.00 37227.57 294698.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.31 56.06% 150785.74 101866 196627 150883.15 140048 161641 4118158 4118158 0.00
crit 21.39 43.91% 313357.82 209843 405052 313612.58 280658 361364 6704121 6704121 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.8 56.20% 24549.42 16669 32176 24560.13 23085 26026 2475343 2475343 0.00
crit 78.6 43.80% 51005.48 34339 66282 51029.94 47822 54584 4007650 4007650 0.00
DPS Timeline Chart

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d. Getting two single-target direct-damage Fire critical strikes in a row will make your next Pyroblast instant cast, cost no mana, and deal $s3% additional damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.200000
  • base_dd_min:2017.24
  • base_dd_max:2562.19
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.360000
  • base_td:374.68
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - mirror_image 13362 / 2592
fireball 13362 2.0% 148.3 2.67sec 7807 4572 6009 12117 7832 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.31 147.83 0.00 0.00 1.7077 0.0000 1157851.92 1157851.92 0.00 4571.70 4571.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.61 70.09% 6008.62 4988 6868 6010.80 5799 6245 622556 622556 0.00
crit 44.18 29.88% 12116.94 9977 13737 12122.25 11459 12927 535296 535296 0.00
miss 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:88082
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88082
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.812000
  • base_dd_min:1657.70
  • base_dd_max:2114.08

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.8 0.0 189.2sec 189.2sec 3.75% 3.75%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.8%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
berserking 4.1 1.1 116.1sec 86.5sec 8.79% 15.65%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:8.8%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 11.2sec 10.36% 15.57%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.4%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.7 1.8 61.5sec 48.5sec 35.35% 35.35%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.3%
heating_up 70.9 0.2 6.3sec 6.3sec 27.32% 38.75%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • heating_up_1:27.3%
  • heating_up_2:0.1%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
invocation 9.9 2.8 47.7sec 36.5sec 87.37% 92.54%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:87.4%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.1 1.0 371.7sec 347.2sec 11.63% 11.63%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.6%
jade_spirit 9.0 0.7 51.9sec 47.5sec 24.09% 25.59%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:24.1%
lightweave_embroidery_3 7.4 1.1 64.3sec 54.6sec 25.46% 25.46%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.5%
presence_of_mind 5.4 0.0 91.2sec 91.2sec 0.30% 1.33%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:0.3%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
pyroblast 45.5 1.8 9.7sec 9.4sec 17.41% 92.78%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyroblast
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • pyroblast_1:17.4%

Spelldata details

  • id:48108
  • name:Pyroblast!
  • tooltip:Your next Pyroblast spell is instant cast, costs no mana, and deals $11366s3% additional damage.
  • description:Getting two direct-damage critical strikes in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
raid_movement 4.0 0.0 84.5sec 84.4sec 6.34% 6.34%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.3 1.0 50.4sec 45.1sec 31.06% 31.06%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:31.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
molten_armor

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_armor_1:100.0%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by $s1%. Reduces all physical damage taken by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T14H
alter_time_activate Mana 2.8 8489.5 3000.0 3000.0 0.0
combustion Mana 12.1 361740.7 30000.0 30000.0 21.6
fireball Mana 140.9 1690667.5 12000.0 12000.0 9.4
ice_lance Mana 15.4 46248.8 3000.0 3000.0 4.7
inferno_blast Mana 28.4 170692.7 6000.0 6000.0 10.6
mirror_image Mana 3.0 17928.0 6000.0 6000.0 64.6
nether_tempest Mana 32.7 146981.5 4500.0 4500.0 36.8
pyroblast Mana 48.9 53696.0 1098.0 1098.0 322.3
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 833144.05 462.47 52455.38 5.92%
evocation Mana 39.71 1312232.89 33046.33 880959.55 40.17%
mana_gem Mana 3.00 166371.39 55457.13 39465.31 19.17%
Resource RPS-Gain RPS-Loss
Mana 5131.54 5541.52
Combat End Resource Mean Min Max
Health 458253.00 458253.00 458253.00
Mana 216090.77 91430.41 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.7%
dpm_rotation 99.3%
water_elemental-dps_rotation 0.7%
water_elemental-dpm_rotation 99.3%
mirror_image-dps_rotation 0.7%
mirror_image-dpm_rotation 99.3%
Uptimes %
Mana Cap 1.6%
water_elemental-Mana Cap 1.6%
mirror_image-Mana Cap 1.6%

Procs

Count Interval
hat_donor 272.9 1.6sec
mana_gem 3.0 122.8sec
test_for_crit_hotstreak 229.6 1.9sec
crit_test_hotstreak 114.9 3.9sec
hotstreak 44.5 10.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 125901.03
Minimum 108078.78
Maximum 145448.69
Spread ( max - min ) 37369.91
Range [ ( max - min ) / 2 * 100% ] 14.84%
Standard Deviation 4976.6832
5th Percentile 117706.71
95th Percentile 134099.13
( 95th Percentile - 5th Percentile ) 16392.42
Mean Distribution
Standard Deviation 49.7768
95.00% Confidence Intervall ( 125803.47 - 125998.59 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 6002
0.1 Scale Factor Error with Delta=300 211428
0.05 Scale Factor Error with Delta=300 845714
0.01 Scale Factor Error with Delta=300 21142856
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 125901.03

Damage

Sample Data
Count 9996
Mean 55509148.52

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 308.84
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 molten_armor
4 0.00 snapshot_stats
5 0.00 evocation
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.00 time_warp,if=target.health.pct<25|time>5
A 2.81 berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
B 0.31 combustion,if=target.time_to_die<12
C 11.75 combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
D 0.00 combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
E 8.97 evocation,if=buff.invocation.down&buff.alter_time.down
F 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
G 0.09 berserking,if=target.time_to_die<18
H 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
I 2.83 alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
J 0.00 evocation,if=mana.pct<10&target.time_to_die>=30
K 45.08 pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
L 3.82 pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
M 24.94 inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
N 2.99 mirror_image
O 5.39 presence_of_mind,if=buff.alter_time.down
P 32.66 nether_tempest,if=!ticking
Q 144.28 fireball
R 3.51 inferno_blast,moving=1
S 15.42 ice_lance,moving=1

Sample Sequence

NAOPQQMIKQCQQMQKQPQQHQMKQKQQQPQQQQQQQQKPQMKCRSSSSEPQQMKQQQPMKQKQQQQCPKQQQQQOLPEKQMKPKQQQQQCPQQQMKSSSPSSMKHQQEKPMQKQKCQQPQKQQQMKPQQNQMQKEAIKPCQMKQKOLQKQMKPQQQQRKSSSPQQQQQCQKPQQEKPQMKQKQQMKPQHQQQCKQQPMKQQQKQEMKOLPKQSMKSSCQKPQMKQQQQPMKQQQQEKPMKQCQKQKPQQMKQNQPQQQQQQPEAIKMCKMKQOLPQQQKQKQMKPQQQFQQKPKQQCQQQMEKPQQQMKQQPQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 20852 18494 17403
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 31623 26391 7907
Spell Hit 14.97% 14.97% 5091
Spell Crit 31.05% 20.12% 7144
Spell Haste 17.82% 12.21% 5190
Mana Per 5 8837 8416 0
Attack Power 117 100 0
Melee Hit 14.97% 14.97% 5091
Melee Crit 20.53% 15.52% 7144
Melee Haste 12.21% 12.21% 5190
Swing Speed 23.43% 12.21% 5190
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 24.95% 17.45% 2175

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
Neck worldwaker_cachabon,id=87076
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Chest robes_of_the_burning_scroll,id=87010,gems=320crit_320crit_180haste,enchant=80all,reforge=haste_hit
Waist belt_of_malleable_amber,id=86981,gems=320crit_160crit_160hit_120haste,reforge=haste_crit
Legs dreadwoven_leggings_of_failure,id=87174,gems=80int_160crit_80int_160hit_120int,enchant=285int_165crit,reforge=haste_crit
Feet sandals_of_the_blackest_night,id=87162,gems=320crit_60mastery,enchant=175hit,reforge=haste_hit
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_crit
Hands gloves_of_the_burning_scroll,id=87007,enchant=170mastery,reforge=hit_crit
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=haste_crit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Fire_T14H"
origin="unknown"
level=90
race=troll
spec=fire
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
glyphs=evocation/fire_blast/counterspell/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/molten_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
actions+=/combustion,if=target.time_to_die<12
actions+=/combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking,if=target.time_to_die<18
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
actions+=/evocation,if=mana.pct<10&target.time_to_die>=30
actions+=/pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
actions+=/pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
actions+=/inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
actions+=/mirror_image
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/fireball
actions+=/inferno_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=haste_crit
chest=robes_of_the_burning_scroll,id=87010,gems=320crit_320crit_180haste,enchant=80all,reforge=haste_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_crit
hands=gloves_of_the_burning_scroll,id=87007,enchant=170mastery,reforge=hit_crit
waist=belt_of_malleable_amber,id=86981,gems=320crit_160crit_160hit_120haste,reforge=haste_crit
legs=dreadwoven_leggings_of_failure,id=87174,gems=80int_160crit_80int_160hit_120int,enchant=285int_165crit,reforge=haste_crit
feet=sandals_of_the_blackest_night,id=87162,gems=320crit_60mastery,enchant=175hit,reforge=haste_hit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17403
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5091
# gear_crit_rating=7144
# gear_haste_rating=5190
# gear_mastery_rating=2175
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Frost_T14H : 121350 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
121349.5 121349.5 46.40 / 0.04% 3895 / 3.2% 19.2 5055.9 4853.6 Mana 0.00% 48.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
Glyphs
  • evocation
  • icy_veins
  • ice_lance

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:321786|258391|181925|149029|121312|64959|40762&chds=0,643573&chco=69CCF0,0070DE,0070DE,0070DE,0070DE,0070DE,C41F3B&chm=t++321786++mirror_image,69CCF0,0,0,15|t++258391++frozen_orb,0070DE,1,0,15|t++181925++frostfire_bolt,0070DE,2,0,15|t++149029++ice_lance,0070DE,3,0,15|t++121312++frost_bomb,0070DE,4,0,15|t++64959++frostbolt,0070DE,5,0,15|t++40762++fire_blast,C41F3B,6,0,15&chtt=Mage_Frost_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,20,17,16,15,8,7,6,5,5,2,0,0,0&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,C41F3B,C41F3B,0070DE&chl=frostbolt|ice_lance|water_elemental: waterbolt|frostfire_bolt|frost_bomb|mini_ice_lance|mini_frostfire_bolt|mini_frostbolt|water_elemental: mini_waterbolt|frozen_orb|mirror_image: frostbolt|fire_blast|mirror_image: fire_blast|water_elemental: freeze&chtt=Mage_Frost_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:QTVZchjiklmqux023576686631xwwtsqoljigfdcaYVVTSRQPPPPONNMLLMNOQRRSTVXYabbbcddfggffedddddcbaYXWVUUUUTTTTTUVWWXWXXYZabdeeddddddddddbbbccdccaZYXXXXXWWVVUVVUUUUTTUUVVWWWWWWVVVVVWWWWVVVVVVUUTSSSTVWXXYYZaabcdfghiklmlkihgedbaaZZZYXVUTSSSTTTTTTTTTSSSRSSSSTTTTTTUVWXZZabbbbbbbcccbbaaaZZZYXWVUUUUUUVVVVVVVVUTTSSSSUVVVVUUTTTUUVWXYYZaabaZYXWWWWWWVVVUTTTTUUUVVWWWXXXYYXXWWWWWWWWWVVVVVVUTTTUVWXYZabcdeefghijkllllkkjjihgfeddccbaaZYYYYXXWVUTTSSSSSSSSSSTTTTUVWXYZaabbbbbbaaaaaaaZYXXWWVUTTTTTTTUUUVVVVVWWXYYZaaabbbbbbbbbbbcccccbbaaZZYXXWVVVVUUUTTTSSSTTUUUVVUUTTTSSSRRRRR&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=121350|max=287741&chxp=1,1,42,100&chtt=Mage_Frost_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,4,2,2,5,13,10,20,29,33,30,49,61,91,126,148,194,246,296,333,395,463,473,528,546,591,615,586,538,550,506,432,349,360,296,252,194,133,119,106,76,64,46,31,15,15,8,8,4,3&chds=0,615&chbh=5&chxt=x&chxl=0:|min=112297|avg=121350|max=129384&chxp=0,1,53,100&chtt=Mage_Frost_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:43.8,18.1,11.9,11.8,10.2,2.0,1.0,0.7&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,69CCF0,0070DE,C41F3B,69CCF0&chl=frostbolt 197.2s|ice_lance 81.7s|frostfire_bolt 53.6s|frost_bomb 53.3s|evocation 45.7s|frozen_orb 9.0s|fire_blast 4.5s|mirror_image 3.4s&chtt=Mage_Frost_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Frost_T14H 121350
alter_time_activate 0 0.0% 2.8 185.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 2.85 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
blood_fury 0 0.0% 4.1 126.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.11 4.11 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<12
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
evocation 0 0.0% 10.0 46.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 39.8 0 0 0 18.4% 0.0% 9.7%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 10.01 39.84 39.84 4.5718 1.0926 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.5 81.65% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.3 18.35% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
fire_blast 409 0.3% 4.0 85.39sec 45546 40762 38060 78803 45546 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.99 3.99 0.00 0.00 1.1174 0.0000 181635.81 181635.81 0.00 40762.08 40762.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.26 81.63% 38060.21 35439 48906 38025.17 0 46834 123897 123897 0.00
crit 0.73 18.37% 78802.90 73004 100747 43978.20 0 100747 57738 57738 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:2136
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2136
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Blasts the enemy for $s1 Fire damage. $?s89926&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards.][]$?s89926&s44457[Also spreads your Living Bomb effect to up to 2 nearby enemy targets within $119717A1 yards.][]$?s89926&s112948[Also instantly triggers your Frost Bomb effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.789000
  • base_dd_min:963.74
  • base_dd_max:1142.80
frost_bomb 14359 11.8% 46.3 9.74sec 139716 121312 0 0 0 0.0% 0.0% 0.0% 0.0% 45.9 117218 243469 140896 18.8% 0.0% 36.8%

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.30 46.30 45.91 45.91 1.1517 3.6154 6468622.19 6468622.19 0.00 29495.47 121312.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.3 81.24% 117217.65 88466 161232 117259.38 110244 122797 4372197 4372197 0.00
crit 8.6 18.76% 243468.99 182241 332137 243611.33 0 332137 2096425 2096425 0.00
DPS Timeline Chart

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:7.79
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d.
  • description:Places a Frost Bomb on the target. After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d. Frost Bomb's countdown and cooldown are reduced by haste.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:$@spelldesc112948
Direct Damage
  • may_crit:true
  • direct_power_mod:2.462000
  • base_dd_min:3285.74
  • base_dd_max:3285.74
frostbolt 22205 (28411) 18.3% (23.4%) 134.2 3.31sec 95428 64959 62466 127994 74825 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 134.21 133.75 0.00 0.00 1.4690 0.0000 10007456.46 10007456.46 0.00 64959.36 64959.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.52 81.14% 62465.75 22087 95479 62500.04 57130 67776 6778784 6778784 0.00
crit 25.23 18.86% 127994.49 45499 196687 128033.38 96363 155107 3228673 3228673 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.250000
  • base_dd_min:1144.86
  • base_dd_max:1457.09
frostfire_bolt 15236 (21643) 12.6% (17.8%) 47.3 9.34sec 206387 181925 76543 155505 145717 87.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.25 47.10 0.00 0.00 1.1345 0.0000 6863604.57 6863604.57 0.00 181925.34 181925.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.84 12.39% 76542.91 35177 121653 76441.43 0 116466 446876 446876 0.00
crit 41.26 87.61% 155504.65 57972 250605 155655.20 138759 183048 6416729 6416729 0.00
DPS Timeline Chart

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.brain_freeze.up
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][$s2] Frostfire damage and slowing the target by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
frozen_orb 5149 4.2% 7.5 62.97sec 307455 258391 0 0 0 0.0% 0.0% 0.0% 0.0% 75.0 25647 53243 30901 19.0% 0.0% 16.7%

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.54 7.54 75.04 75.04 1.1899 1.0000 2318800.75 2318800.75 0.00 27600.17 258390.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.8 80.96% 25646.69 18358 33460 25663.42 23647 28089 1558121 1558121 0.00
crit 14.3 19.04% 53242.74 37818 68929 53278.46 44824 62009 760680 760680 0.00
DPS Timeline Chart

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains20&buff.alter_time.down
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:(null)
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal $84721s2 Frost damage to all nearby enemy targets for $d. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by $84721s1% for $84721d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by $s1%.
  • description:$@spelldesc84714
Direct Damage
  • may_crit:true
  • direct_power_mod:0.511000
  • base_dd_min:593.76
  • base_dd_max:763.41
ice_lance 19367 (27041) 16.0% (22.3%) 72.3 6.02sec 168337 149029 34080 152434 120827 73.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.34 72.21 0.00 0.00 1.1296 0.0000 8724698.42 8724698.42 0.00 149029.22 149029.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.28 26.71% 34080.27 4429 125024 33498.51 7795 62197 657198 657198 0.00
crit 52.92 73.29% 152434.23 9123 257549 152366.31 125020 177030 8067501 8067501 0.00
DPS Timeline Chart

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.fingers_of_frost.up
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:Deals $?a44544[${$m1*1.25} to ${$M1*1.25}][$s1] Frost damage to an enemy target$?s56377&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]$?s56377&a44544[, and ${$m1*1.25*$56377m2/100} to ${$M1*1.25*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is quadrupled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
icy_veins 0 0.0% 5.2 94.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.24 5.24 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<22
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
mini_frostbolt 6206 5.1% 0.0 1.#Rsec 0 0 34506 71857 41875 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 66.87 0.00 0.00 0.0000 0.0000 2800321.20 2800321.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.68 80.27% 34506.14 23854 43592 34556.45 32012 37525 1852299 1852299 0.00
crit 13.19 19.73% 71856.99 49139 89801 71957.32 60001 85938 948022 948022 0.00
DPS Timeline Chart

Action details: mini_frostbolt

Static Values
  • id:131079
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131079
  • name:Frostbolt
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc116
Direct Damage
  • may_crit:true
  • direct_power_mod:1.350000
  • base_dd_min:1236.44
  • base_dd_max:1573.66
mini_frostfire_bolt 6406 5.3% 0.0 1.#Rsec 0 0 44232 95293 89712 89.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 32.20 0.00 0.00 0.0000 0.0000 2888685.12 2888685.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.52 10.93% 44231.71 39258 57394 42898.21 0 57394 155674 155674 0.00
crit 28.68 89.07% 95292.71 64697 118232 95377.12 84816 104072 2733011 2733011 0.00
DPS Timeline Chart

Action details: mini_frostfire_bolt

Static Values
  • id:131081
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131081
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:(null)
  • description:$@spelldesc44614
Direct Damage
  • may_crit:true
  • direct_power_mod:1.674000
  • base_dd_min:1533.19
  • base_dd_max:1951.33
mini_ice_lance 7674 6.3% 0.0 1.#Rsec 0 0 14526 81810 60621 68.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 56.96 0.00 0.00 0.0000 0.0000 3453075.64 3453075.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.94 31.49% 14525.66 4429 52853 14418.83 5279 34381 260564 260564 0.00
crit 39.02 68.51% 81809.96 9123 108878 81880.66 66523 93180 3192512 3192512 0.00
DPS Timeline Chart

Action details: mini_ice_lance

Static Values
  • id:131080
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131080
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc30455
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
mirror_image 0 (2417) 0.0% (2.0%) 3.0 181.11sec 366059 321786 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 2.96 0.00 0.00 1.1376 0.0000 0.00 0.00 0.00 321786.26 321786.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
presence_of_mind 0 0.0% 5.5 90.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.47 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pet - water_elemental 21920 / 21920
freeze 99 0.1% 17.3 26.60sec 2568 0 2165 4343 2568 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.31 17.31 0.00 0.00 0.0000 0.0000 44449.34 44449.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.11 81.50% 2164.83 1669 2613 2164.91 2015 2275 30542 30542 0.00
crit 3.20 18.50% 4343.18 3337 5049 4199.58 0 5049 13908 13908 0.00
DPS Timeline Chart

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:owner.buff.fingers_of_frost.stack=0
Spelldata
  • id:33395
  • name:Freeze
  • school:frost
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect. $?s112965[Grants the Mage a charge of Fingers of Frost for each target hit by Freeze.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.023000
  • base_dd_min:394.72
  • base_dd_max:458.72
mini_waterbolt 5177 4.3% 0.0 1.#Rsec 0 0 14590 29547 17521 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 132.98 0.00 0.00 0.0000 0.0000 2329921.80 2329921.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.92 80.40% 14590.34 8152 18473 14603.23 13867 15492 1559967 1559967 0.00
crit 26.06 19.60% 29546.69 16304 36946 29575.01 26092 33309 769955 769955 0.00
DPS Timeline Chart

Action details: mini_waterbolt

Static Values
  • id:131581
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131581
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.426000
  • base_dd_min:387.95
  • base_dd_max:498.79
waterbolt 16645 (21822) 13.7% (18.0%) 245.4 1.83sec 40026 21850 25883 51522 30698 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 245.43 244.11 0.00 0.00 1.8318 0.0000 7493571.36 7493571.36 0.00 21850.09 21850.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.26 81.22% 25882.70 7654 41030 25887.28 24499 27358 5131590 5131590 0.00
crit 45.84 18.78% 51522.10 18983 82061 51528.00 41697 59597 2361981 2361981 0.00
DPS Timeline Chart

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:364.27
  • base_dd_max:468.35
pet - mirror_image 12625 / 2417
fire_blast 1909 0.3% 43.1 28.20sec 3794 0 3164 6396 3794 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.13 43.13 0.00 0.00 0.0000 0.0000 163629.52 163629.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.73 80.52% 3163.93 2889 3733 3165.53 2996 3372 109881 109881 0.00
crit 8.40 19.48% 6396.04 5777 7465 6398.63 0 7465 53749 53749 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59637
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.005000
  • base_dd_min:984.34
  • base_dd_max:1105.55
frostbolt 10716 1.7% 194.8 5.91sec 4713 3636 3943 7970 4727 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 194.83 194.23 0.00 0.00 1.2961 0.0000 918215.90 918215.90 0.00 3636.07 3636.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 156.39 80.52% 3942.89 2923 4683 3944.64 3755 4115 616629 616629 0.00
crit 37.84 19.48% 7969.89 5845 9366 7973.50 7299 8563 301587 301587 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.017000
  • base_dd_min:1004.56
  • base_dd_max:1110.30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.8 0.0 185.5sec 185.5sec 3.79% 3.79%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.8%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.1 1.6 125.6sec 83.8sec 15.31% 15.31%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:15.3%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 14.0sec 10.36% 13.13%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.4%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 47.5 1.3 9.4sec 9.2sec 19.68% 19.68%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:19.7%

Spelldata details

  • id:44549
  • name:Brain Freeze
  • tooltip:(null)
  • description:Your most recently applied Nether Tempest, Living Bomb, or Frost Bomb spell has a chance when it deals damage to grant you the Brain Freeze effect. The Brain Freeze effect causes your next Frostfire Bolt to be instant cast, cost no mana, and act as if your target were frozen for $57761d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.3 1.1 65.0sec 55.2sec 32.97% 32.97%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.0%
fingers_of_frost 45.5 14.8 9.9sec 7.4sec 29.69% 79.20%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:12.00%
  • default_value:-1.00

Stack Uptimes

  • fingers_of_frost_1:23.0%
  • fingers_of_frost_2:6.7%

Spelldata details

  • id:112965
  • name:Fingers of Frost
  • tooltip:(null)
  • description:Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a $s1% chance, your Blizzard ticks have a $s2% chance, and your successful Scorches have a $s3% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by $44544s2% for $44544d. Limit $44544s1 charges.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
icy_veins 5.3 2.6 93.9sec 58.6sec 26.13% 30.62%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • icy_veins_1:26.1%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
invocation 10.0 2.8 47.3sec 36.3sec 87.66% 90.96%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:87.7%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.9 103.2sec 85.9sec 11.43% 11.43%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.4%
jade_spirit 8.2 0.7 56.6sec 51.4sec 21.86% 27.99%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.9%
lightweave_embroidery_3 7.1 0.9 66.7sec 58.1sec 24.46% 24.46%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:24.5%
presence_of_mind 5.5 0.0 90.8sec 90.8sec 1.12% 1.22%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.1%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 84.9sec 6.31% 6.31%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 8.7 1.0 53.8sec 47.6sec 29.27% 29.27%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_armor

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • frost_armor_1:100.0%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Spell haste increased by $7302w1%. Attackers are slowed.
  • description:Increases your spell haste by $7302s1%. If an enemy strikes the caster, their movement is slowed by $7321s2% for $7321d. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T14H
alter_time_activate Mana 2.8 8543.2 3000.0 3000.0 0.0
fire_blast Mana 4.0 23928.0 6000.0 6000.0 7.6
frost_bomb Mana 46.3 173618.7 3750.0 3750.0 37.3
frostbolt Mana 134.2 1610561.8 12000.0 12000.0 8.0
frozen_orb Mana 7.5 226257.5 30000.0 30000.0 10.2
ice_lance Mana 72.3 217025.5 3000.0 3000.0 56.1
mirror_image Mana 3.0 17732.3 6000.0 6000.0 61.0
time_warp Mana 0.0 3.6 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 861093.05 477.99 79758.76 8.48%
evocation Mana 39.84 1124510.11 28229.03 1253764.73 52.72%
mana_gem Mana 3.00 200947.00 66982.33 10279.52 4.87%
Resource RPS-Gain RPS-Loss
Mana 4853.63 5055.90
Combat End Resource Mean Min Max
Health 458267.00 458267.00 458267.00
Mana 229637.58 122076.92 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.5%
dpm_rotation 99.5%
water_elemental 100.0%
water_elemental-dps_rotation 0.5%
water_elemental-dpm_rotation 99.5%
water_elemental-water_elemental 100.0%
Uptimes %
Mana Cap 1.5%
water_elemental-Mana Cap 1.5%
mirror_image-Mana Cap 1.5%

Procs

Count Interval
mana_gem 3.0 125.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 121349.53
Minimum 112297.21
Maximum 129384.02
Spread ( max - min ) 17086.82
Range [ ( max - min ) / 2 * 100% ] 7.04%
Standard Deviation 2366.8169
5th Percentile 117474.35
95th Percentile 125265.19
( 95th Percentile - 5th Percentile ) 7790.84
Mean Distribution
Standard Deviation 23.6729
95.00% Confidence Intervall ( 121303.13 - 121395.93 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1461
0.1 Scale Factor Error with Delta=300 47820
0.05 Scale Factor Error with Delta=300 191281
0.01 Scale Factor Error with Delta=300 4782037
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 121349.53

Damage

Sample Data
Count 9996
Mean 43706900.18

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 366.10
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 frost_armor
4 0.00 water_elemental
5 0.00 snapshot_stats
6 0.00 evocation
7 0.00 jade_serpent_potion
Default action list
# count action,conditions
8 0.00 counterspell,if=target.debuff.casting.react
9 0.00 cold_snap,if=health.pct<30
A 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
B 0.00 time_warp,if=target.health.pct<25|time>5
C 5.47 presence_of_mind,if=buff.alter_time.down
D 17.31 water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
E 0.24 icy_veins,if=target.time_to_die<22
F 0.27 blood_fury,if=target.time_to_die<12
G 4.15 frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
H 6.27 ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
I 0.00 frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
J 0.66 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
K 2.52 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
L 4.96 icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
M 0.00 icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
N 47.23 frost_bomb,if=!ticking
O 0.03 icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
P 2.96 mirror_image
Q 9.01 evocation,if=buff.invocation.down&buff.alter_time.down
R 0.00 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
S 1.00 jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
T 3.84 blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
U 11.43 frostbolt,if=debuff.frostbolt.stack<3
V 2.80 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
W 0.05 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
X 43.10 frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Y 0.00 ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Z 49.64 ice_lance,if=buff.fingers_of_frost.react
a 5.02 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
b 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
c 125.38 frostbolt
d 3.99 fire_blast,moving=1
e 15.77 ice_lance,moving=1

Sample Sequence

CDKLNPTUUUUUNJJbcccNcccccNccDcVGHNcccXZcNcccXdeeeeeeNDQXZUNUUUXaZNccccXZNZDcZcXZNCccccXNZQLSXZNccZDXZcNcccXccNTZcaZdXebeeDNZcZZcQNXcccXNZcccDXZNcccXccNccCcXccNPDQKLXNZZZcXcNUUUVGHcHNdXZDeeeNccZXccNcccXZQDNZTccXZcNaZbccXZNZccXZcDNCZcccXZNcccQLNXcccXZDdZeeeeNccZcXaNZZccXcDcNZZcQNXcccXcNZccDcXZNZcccCXZNccPcXcNcDQKLTXNZZZcccVGHNcHcZXDcNZcccZXNccZXccNcccDQNXZccXZNZaZcX

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 128 122 80
Agility 131 125 80
Stamina 22276 20251 20183
Intellect 22000 19587 18443
Spirit 559 559 350
Health 458267 429917 0
Mana 300000 300000 0
Spell Power 32886 27484 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 20.77% 14.82% 3706
Spell Haste 28.33% 16.40% 6969
Mana Per 5 9625 8730 0
Attack Power 119 102 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.79% 9.79% 3706
Melee Haste 16.40% 16.40% 6969
Swing Speed 28.04% 16.40% 6969
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.66% 21.66% 1700

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
Neck worldwaker_cachabon,id=87076
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest robes_of_the_burning_scroll,id=87010,gems=160int_160int,enchant=80all,reforge=crit_hit
Waist belt_of_malleable_amber,id=86981,gems=160int_160int_160int
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=160int,enchant=175hit,reforge=mastery_crit
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands gloves_of_the_burning_scroll,id=87007,enchant=170haste
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=mastery_crit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Frost_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
glyphs=evocation/icy_veins/ice_lance

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/frost_armor
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/cold_snap,if=health.pct<30
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
actions+=/icy_veins,if=target.time_to_die<22
actions+=/blood_fury,if=target.time_to_die<12
actions+=/frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
actions+=/ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
actions+=/frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
actions+=/frost_bomb,if=!ticking
actions+=/icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
actions+=/mirror_image
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
actions+=/jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
actions+=/blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
actions+=/frostbolt,if=debuff.frostbolt.stack<3
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.fingers_of_frost.react
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/frostbolt
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=mastery_crit
chest=robes_of_the_burning_scroll,id=87010,gems=160int_160int,enchant=80all,reforge=crit_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=160int_160int_160int
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=160int,enchant=175hit,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18443
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3706
# gear_haste_rating=6969
# gear_mastery_rating=1700
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Monk_Windwalker_1h_T14H : 109022 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
109022.2 109022.2 57.68 / 0.05% 4840 / 4.4% 8159.5 12.5 12.4 Energy 10.72% 52.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:160254|106494|89620|37720|22040|18876|13064&chds=0,320508&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++160254++rising_sun_kick,C79C6E,0,0,15|t++106494++fists_of_fury,C79C6E,1,0,15|t++89620++blackout_kick,C79C6E,2,0,15|t++37720++tiger_palm,C79C6E,3,0,15|t++22040++melee_main_hand,C79C6E,4,0,15|t++18876++jab,C79C6E,5,0,15|t++13064++melee_off_hand,C79C6E,6,0,15&chtt=Monk_Windwalker_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,18,17,11,10,8,6,5,4,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473&chl=blackout_kick|melee_main_hand|rising_sun_kick|melee_off_hand|fists_of_fury|tiger_strikes_melee|jab|xuen_the_white_tiger: crackling_tiger_lightning|tiger_palm|blackout_kick_dot|xuen_the_white_tiger: melee&chtt=Monk_Windwalker_1h_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:00011223444787677765411100zyxvvvuuusromkigffedcbbaaaaZZYabdfhjllmlmmnnonnnnnmmmmllkkkkkjjjiiihhhhhhgggggggggggggggghhhhhgfdcaYXXXYXYXYXYYZYYYacefhjlkkkkkkkkjjiiiiiiihhhhhghhijjkklmnooopqqrrstuuuttttttsssrrqomkjhffeededdccccbbacdeghjkkkjjjjjkjjjjjjkkkkkkkkkkkkkkkkkkkkkjjjjjjjjiiiiihhhhhhhhgfdcaZXVVVWVWWWWXXXXYYZbdfhjllllllmlmlllllllllkkkkkkkkjjjiiiiihiijjkkllmnnooppqqqrsssssssssssrrrsssssssssrrrrrrqqppponnmmmllkkjjjjiiiiiiiiiiiijjjjjjjjjjjjjjjjjjkkkkkkkkkkkkkkkkkjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjiiijijjjjjjjjjjjjjiiiiiiihhhhhghhhhhhggggggffggf&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109022|max=179082&chxp=1,1,61,100&chtt=Monk_Windwalker_1h_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,0,3,3,5,7,12,13,16,40,47,69,108,139,190,241,284,357,427,448,537,568,643,611,622,599,597,537,514,452,380,352,278,212,176,144,90,103,57,42,27,18,9,7,6,2,1,0,1&chds=0,643&chbh=5&chxt=x&chxl=0:|min=97189|avg=109022|max=120432&chxp=0,1,51,100&chtt=Monk_Windwalker_1h_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.4,25.1,11.1,10.3,9.7,0.7,10.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ffffff&chl=jab 146.1s|blackout_kick 113.1s|rising_sun_kick 49.9s|tiger_palm 46.6s|fists_of_fury 43.7s|invoke_xuen 3.1s|waiting 48.3s&chtt=Monk_Windwalker_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Monk_Windwalker_1h_T14H 109022
berserking 0 0.0% 3.0 180.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
blackout_kick 22507 20.6% 109.1 4.07sec 92890 89620 65162 135068 92890 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.09 109.09 0.00 0.00 1.0365 0.0000 10133830.49 10133830.49 0.00 89620.43 89620.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.82 60.33% 65161.64 51170 75768 65169.41 63463 66445 4289039 4289039 0.00
crit 43.27 39.67% 135067.52 105409 156082 135096.20 131786 138881 5844792 5844792 0.00
DPS Timeline Chart

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combo_breaker_bok.react
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:(null)
  • description:Kick with a blast of Chi energy, dealing ${8*$<low>} to ${8*$<high>} Physical damage.$?s128595[ If behind the target, you deal an additional $m2% damage over $128531d. If in front of the target, you are instantly healed for $m2% of the damage done.][] $?s117967[ Also causes you to gain Shuffle, increasing your parry chance by $115307s1% and your Stagger amount by an additional $115307s2% for $115307d.][]$?s116645[ Also empowers you with Serpent's Zeal, causing you and your summoned Jade Serpent Statue to heal nearby injured targets equal to $127722m1% of your auto-attack damage. Stacks up to 2 times.][]
blackout_kick_dot 3356 3.1% 109.0 4.07sec 13864 0 0 0 0 0.0% 0.0% 0.0% 0.0% 327.0 4622 0 4622 0.0% 0.0% 72.6%

Stats details: blackout_kick_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.02 109.02 327.01 327.01 0.0000 1.0000 1511434.31 1511434.31 0.00 4621.98 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 327.0 100.00% 4621.97 1737 14130 4625.13 3909 5526 1511434 1511434 0.00
DPS Timeline Chart

Action details: blackout_kick_dot

Static Values
  • id:128531
  • school:physical
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128531
  • name:Blackout Kick
  • school:physical
  • tooltip:$w1 damage every $t1 sec.
  • description:$@spelldesc100784
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:4450.47
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
energizing_brew 0 0.0% 6.7 65.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: energizing_brew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.66 6.66 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: energizing_brew

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35
Spelldata
  • id:115288
  • name:Energizing Brew
  • school:physical
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
fists_of_fury 10277 9.5% 13.7 28.94sec 340177 106494 0 0 0 0.0% 0.0% 0.0% 0.0% 53.9 60822 125736 86274 39.2% 0.0% 8.9%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.67 13.67 53.90 53.90 3.1943 0.7464 4650379.54 4650379.54 0.00 106493.99 106493.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.8 60.79% 60821.72 58389 71032 60824.78 58890 63223 1993019 1993019 0.00
crit 21.1 39.21% 125735.96 120282 146327 125738.95 120822 132629 2657361 2657361 0.00
DPS Timeline Chart

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w2 damage every $t2 sec. $?s125671[Parrying all attacks.][]
  • description:Pummel all targets in front of you with rapid hand strikes, stunning them and dealing ${7.5*$<low>} to ${7.5*$<high>} damage immediately and every $113656t2 sec for $113656d. Damage is spread evenly over all targets.$?s125671[ Your parry chance is increased by 100% while channeling.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: fists_of_fury_tick

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
invoke_xuen 0 0.0% 3.0 180.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: invoke_xuen

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: invoke_xuen

Static Values
  • id:123904
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.invoke_xuen.enabled
Spelldata
  • id:123904
  • name:Invoke Xuen, the White Tiger
  • school:nature
  • tooltip:(null)
  • description:Invokes the White Tiger Celestial, summoning an effigy at the command of the caster. The effigy will assist you, attacking your primary target and also inflicting tiger lightning every $123999t1 sec to 3 nearby enemies within $123996A1 yards dealing $123996o1 damage over $123996d. Lasts for $d. |CFFFFFFFFBrewmaster|R Xuen will also taunt the target, forcing it to attack him.
jab 6121 5.6% 140.9 3.20sec 19565 18876 13716 28437 19565 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: jab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.93 140.93 0.00 0.00 1.0365 0.0000 2757289.83 2757289.83 0.00 18875.85 18875.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.93 60.27% 13715.52 10780 15962 13716.61 13467 13970 1164901 1164901 0.00
crit 56.00 39.73% 28437.08 22207 32882 28442.71 27794 29110 1592388 1592388 0.00
DPS Timeline Chart

Action details: jab

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
Spelldata
  • id:100780
  • name:Jab
  • school:physical
  • tooltip:(null)
  • description:You Jab the target, dealing ${1.5*$<low>} to ${1.5*$<high>} damage and generating $s2 Chi.
melee_main_hand 18520 17.0% 208.2 2.16sec 40078 22040 33665 70655 40078 39.8% 19.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 208.17 208.17 0.00 0.00 1.8184 0.0000 8342937.72 8342937.72 0.00 22040.36 22040.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.92 17.26% 33665.43 26217 41457 33666.40 32386 35476 1209278 1209278 0.00
crit 82.95 39.85% 70654.58 54008 85402 70675.08 68642 72853 5860492 5860492 0.00
glance 49.78 23.91% 25576.76 19663 31093 25582.11 24685 26673 1273168 1273168 0.00
miss 39.52 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 10985 10.1% 212.3 2.12sec 23300 13064 19558 41122 23300 39.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.32 212.32 0.00 0.00 1.7835 0.0000 4946904.82 4946904.82 0.00 13063.72 13063.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.57 17.22% 19558.42 15147 24536 19558.84 18723 20479 715217 715217 0.00
crit 84.45 39.77% 41122.19 31203 50544 41135.04 40020 42554 3472682 3472682 0.00
glance 51.00 24.02% 14881.60 11360 18402 14885.17 14197 15570 759006 759006 0.00
miss 40.30 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rising_sun_kick 17746 16.3% 48.1 9.40sec 166101 160254 116691 241715 166101 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.13 48.13 0.00 0.00 1.0365 0.0000 7993778.22 7993778.22 0.00 160253.76 160253.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.11 60.48% 116690.55 92105 136382 116687.79 113535 120547 3396470 3396470 0.00
crit 19.02 39.52% 241715.40 189737 280948 241753.35 232203 253255 4597308 4597308 0.00
DPS Timeline Chart

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.rising_sun_kick.remains<=3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:(null)
  • description:You kick upwards, dealing ${14.4*$<low>} to ${14.4*$<high>} damage and applying Mortal Wounds to the target. Also causes all targets within $130320A1 yards to take an increased $130320m1% damage from your abilities for $130320d. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
tiger_palm 3907 3.6% 45.0 10.04sec 39096 37720 27355 56700 39096 40.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.98 44.98 0.00 0.00 1.0365 0.0000 1758648.67 1758648.67 0.00 37719.82 37719.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.99 59.99% 27355.40 21560 31925 27357.79 26258 28241 738196 738196 0.00
crit 18.00 40.01% 56700.31 44414 65765 56710.54 52988 59184 1020452 1020452 0.00
DPS Timeline Chart

Action details: tiger_palm

Static Values
  • id:100787
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.tiger_power.stack<3|buff.tiger_power.remains<=3
Spelldata
  • id:100787
  • name:Tiger Palm
  • school:physical
  • tooltip:(null)
  • description:Attack with the palm of your hand, dealing ${3*$<low>} to ${3*$<high>} damage. Also grants you Tiger Power, causing your attacks to ignore $125359m1% of enemies' armor for $125359d. Stacks up to $m2 times.
tiger_strikes_melee 8663 7.9% 101.2 4.71sec 38563 0 26911 56036 38563 40.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_strikes_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.17 101.17 0.00 0.00 0.0000 0.0000 3901386.23 3901386.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.70 59.99% 26910.82 15147 41457 26917.16 24347 30472 1633408 1633408 0.00
crit 40.47 40.01% 56036.28 31203 85402 56044.75 43976 67078 2267978 2267978 0.00
DPS Timeline Chart

Action details: tiger_strikes_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tigereye_brew_use 0 0.0% 7.0 60.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigereye_brew_use

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.01 7.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigereye_brew_use

Static Values
  • id:116740
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
Spelldata
  • id:116740
  • name:Tigereye Brew
  • school:physical
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
pet - xuen_the_white_tiger 24186 / 6939
crackling_tiger_lightning 17123 4.5% 22.9 18.79sec 96096 92711 0 0 0 0.0% 0.0% 0.0% 0.0% 113.8 13582 27732 19346 40.7% 0.0% 88.5%

Stats details: crackling_tiger_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.90 22.90 113.75 113.75 1.0365 1.0000 2200576.60 2200576.60 0.00 16005.71 92710.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.4 59.27% 13582.08 11910 18111 13583.01 12796 14412 915684 915684 0.00
crit 46.3 40.73% 27731.97 23821 36223 27738.54 25404 29901 1284893 1284893 0.00
DPS Timeline Chart

Action details: crackling_tiger_lightning

Static Values
  • id:123996
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123996
  • name:Crackling Tiger Lightning
  • school:nature
  • tooltip:Taking $m1 damage every $t1 sec.
  • description:$@spelldesc123904
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.459500
  • base_td:291.20
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
melee 7064 1.8% 201.0 2.00sec 4510 7111 3283 6698 4510 41.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.99 200.99 0.00 0.00 0.6342 0.0000 906442.31 906442.31 0.00 7110.91 7110.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.43 34.55% 3283.07 3023 3988 3283.18 3146 3514 227959 227959 0.00
crit 83.39 41.49% 6698.14 6045 7976 6698.81 6384 6988 558579 558579 0.00
glance 48.16 23.96% 2489.81 2267 2991 2490.02 2361 2627 119904 119904 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.035771
  • base_dd_min:1158.00
  • base_dd_max:1158.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 6.66% 8.69%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.47%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
combo_breaker_bok 33.7 0.1 13.1sec 13.1sec 13.61% 30.73%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_bok
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_bok_1:13.6%

Spelldata details

  • id:116768
  • name:Combo Breaker: Blackout Kick
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
combo_breaker_tp 32.7 1.0 13.5sec 13.1sec 16.70% 72.38%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_tp
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_tp_1:16.7%

Spelldata details

  • id:118864
  • name:Combo Breaker: Tiger Palm
  • tooltip:Your next Tiger Palm costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel_oh 13.7 15.3 32.9sec 15.1sec 53.79% 53.56%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:53.8%
energizing_brew 6.7 0.0 65.0sec 65.0sec 8.79% 8.80%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_energizing_brew
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • energizing_brew_1:8.8%

Spelldata details

  • id:115288
  • name:Energizing Brew
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:1.01%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.7 0.0 61.6sec 61.6sec 25.31% 25.31%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.3%
synapse_springs_2 7.9 0.0 60.6sec 60.6sec 17.45% 17.45%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
terror_in_the_mists 7.5 0.0 63.7sec 63.7sec 32.64% 32.64%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.6%
tiger_power 1.9 43.1 163.8sec 10.0sec 98.87% 99.37%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_power
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_power_1:0.8%
  • tiger_power_2:0.7%
  • tiger_power_3:97.5%

Spelldata details

  • id:125359
  • name:Tiger Power
  • tooltip:Your attacks ignore $m1% armor.
  • description:$@spelldesc100787
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
tiger_stance 0.0 0.0 0.0sec 0.0sec 0.07% 0.07%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_stance_1:0.1%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:(null)
  • description:Increases damage done by $m3% and increases the amount of Chi generated by your Jab and Expel Harm abilities by $m4.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
tiger_strikes 25.4 0.0 17.5sec 17.5sec 18.09% 23.64%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_strikes
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_strikes_1:3.5%
  • tiger_strikes_2:5.2%
  • tiger_strikes_3:3.5%
  • tiger_strikes_4:5.9%

Spelldata details

  • id:120273
  • name:Tiger Strikes
  • tooltip:Attack speed increased by $s1%, and the next $n autoattacks cause an extra attack.
  • description:$@spelldesc120272
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tigereye_brew 7.9 66.9 59.9sec 6.0sec 91.26% 100.00%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_1:10.3%
  • tigereye_brew_2:10.4%
  • tigereye_brew_3:9.6%
  • tigereye_brew_4:9.3%
  • tigereye_brew_5:9.6%
  • tigereye_brew_6:10.0%
  • tigereye_brew_7:9.5%
  • tigereye_brew_8:10.0%
  • tigereye_brew_9:10.0%
  • tigereye_brew_10:2.5%

Spelldata details

  • id:125195
  • name:Tigereye Brew
  • tooltip:Use Tigereye Brew to consume charges to gain 2% damage per charge.
  • description:$@spelldesc123980
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:1.01%
tigereye_brew_use 7.0 0.0 60.1sec 60.1sec 22.86% 22.86%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew_use
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_use_1:22.9%

Spelldata details

  • id:116740
  • name:Tigereye Brew
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 397.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
windsong_crit 7.4 2.0 55.9sec 42.8sec 22.10% 21.45%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:22.1%
windsong_haste 7.4 2.0 55.8sec 42.7sec 22.19% 21.76%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:22.2%
windsong_mastery 7.5 2.0 55.5sec 42.6sec 22.26% 21.65%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:22.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Monk_Windwalker_1h_T14H
blackout_kick Chi 109.1 151.1 1.4 1.4 67045.1
fists_of_fury Chi 13.7 41.0 3.0 3.0 113392.4
jab Energy 140.9 5637.2 40.0 40.0 489.1
rising_sun_kick Chi 48.1 96.3 2.0 2.0 83050.3
tiger_palm Chi 45.0 12.4 0.3 0.3 141546.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.50 5186.62 2.88 224.01 4.14%
chi Chi 140.93 302.59 2.15 0.00 0.00%
combo_breaker_savings Chi 66.08 99.60 1.51 0.00 0.00%
energizing_brew Energy 158.58 385.82 2.43 10.62 2.68%
Resource RPS-Gain RPS-Loss
Energy 12.37 12.51
Chi 0.67 0.67
Combat End Resource Mean Min Max
Health 454543.00 454543.00 454543.00
Mana 300000.00 300000.00 300000.00
Energy 35.60 0.24 98.37
Chi 1.78 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 4.0%
xuen_the_white_tiger-Energy Cap 4.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 109022.25
Minimum 97188.63
Maximum 120431.76
Spread ( max - min ) 23243.12
Range [ ( max - min ) / 2 * 100% ] 10.66%
Standard Deviation 2942.3138
5th Percentile 104262.18
95th Percentile 113942.57
( 95th Percentile - 5th Percentile ) 9680.39
Mean Distribution
Standard Deviation 29.4290
95.00% Confidence Intervall ( 108964.57 - 109079.93 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2797
0.1 Scale Factor Error with Delta=300 73902
0.05 Scale Factor Error with Delta=300 295611
0.01 Scale Factor Error with Delta=300 7390292
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 109022.25

Damage

Sample Data
Count 9996
Mean 45996589.82

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 390.42
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 stance
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
Default action list
# count action,conditions
5 5.00 auto_attack
6 0.00 chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 7.94 use_item,name=bonebreaker_gauntlets
9 3.01 berserking
A 5.20 rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
B 15.70 tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
C 0.00 run_action_list,name=aoe,if=num_targets>5
D 0.00 run_action_list,name=st,if=num_targets<=5
actions.st
# count action,conditions
J 7.01 tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
K 6.66 energizing_brew,if=energy<=35
L 3.01 invoke_xuen,if=talent.invoke_xuen.enabled
M 42.93 rising_sun_kick
N 13.67 fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
O 0.00 zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
P 31.46 blackout_kick,if=buff.combo_breaker_bok.react
Q 24.75 tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
R 4.53 tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
S 140.93 jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
T 77.63 blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

Sample Sequence

589LSABSBBSTSMSTSTSTSMSKPTSBPTMSSTSTSPMSPTSTBSMS5MSPTSQTS8JMSPTTSTSMSNSBSMQSPKTSTSMSQTSPTSMSNSQTSMPSQPTSTJMSTSPTSM8SBSNQ5SASTSTSKQTSMSTSTSNSMSTSBTSMSTSPNJSMPB89LSQTSMPSTSPTSMPRSTSTSMSKPTSPTSMSTB5SASTSNSBMSSPTJST8MSTSTSBMPSTSTSMQSTSKPTSMSQTSTSNPSAPRSTSPQMSTSQTJSN85PSASQTSTSPMSQNSQMSSKTTSTSMSPTSTSQMSNPSSMTSTJSQMSQ89LTSNPSMSSPTTSTBSMSQTSTS7KMSQSQTTSMQSPTSNSMQSQSTSPMJTST8SPQNSAPRSPSQTMSTSPTSTSM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 184 175 80
Agility 21699 19301 18268
Stamina 22010 20009 19896
Intellect 257 245 80
Spirit 271 271 80
Health 454543 426529 0
Mana 300000 300000 0
Energy 100 100 0
Chi 4 4 0
Spell Power 0 0 0
Spell Hit 15.02% 15.02% 2552
Spell Crit 12.89% 7.89% 3564
Spell Haste 20.43% 14.70% 6246
Mana Per 5 6000 6000 0
Attack Power 48105 38927 0
Melee Hit 7.51% 7.51% 2552
Melee Crit 35.65% 28.74% 3564
Melee Haste 14.70% 14.70% 6246
Swing Speed 26.17% 14.70% 6246
Expertise 7.51% / 7.51% 7.51% / 7.51% 2555
Armor 18523 18523 18523
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.16% 16.16% 2121

Gear

Average Item Level: 506.50
Head red_crane_headpiece,id=87086,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders red_crane_spaulders,id=87088,gems=160agi,enchant=200agi_100crit,reforge=exp_hit
Shirt empty
Chest red_crane_tunic,id=87084,gems=160agi_160agi,enchant=80all,reforge=mastery_haste
Waist tomb_raiders_girdle,id=87022,gems=160agi_160agi_160agi
Legs red_crane_leggings,id=87087,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=160agi,enchant=140agi,reforge=crit_hit
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_hit
Hands bonebreaker_gauntlets,id=86964,gems=160agi,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503,enchant=160agi,reforge=crit_hit
Finger2 painful_thorned_ring,id=86974,enchant=160agi,reforge=exp_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back arrow_breaking_windcloak,id=87044,enchant=180hit
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=windsong,reforge=exp_hit
Off Hand claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=exp_haste
Unknown empty
Tabard empty

Talents

Level
15 Celerity Tiger's Lust Momentum
30 Chi Wave Zen Sphere Chi Burst
45 Power Strikes Ascension Chi Brew
60 Deadly Reach Charging Ox Wave Leg Sweep
75 Healing Elixirs Dampen Harm Diffuse Magic
90 Rushing Jade Wind Invoke Xuen, the White Tiger Chi Torpedo

Profile

#!./simc

monk="Monk_Windwalker_1h_T14H"
origin="unknown"
level=90
race=troll
spec=windwalker
role=hybrid
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/stance
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=auto_attack
actions+=/chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
actions+=/virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
actions+=/tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/run_action_list,name=st,if=num_targets<=5

actions.aoe=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.aoe+=/energizing_brew,if=energy<=35
actions.aoe+=/rushing_jade_wind,if=talent.rushing_jade_wind.enabled
actions.aoe+=/rising_sun_kick,if=chi=4&(!talent.chi_burst.enabled|num_targets<=7)
actions.aoe+=/spinning_crane_kick

actions.st=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.st+=/energizing_brew,if=energy<=35
actions.st+=/invoke_xuen,if=talent.invoke_xuen.enabled
actions.st+=/rising_sun_kick
actions.st+=/fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
actions.st+=/zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
actions.st+=/blackout_kick,if=buff.combo_breaker_bok.react
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
actions.st+=/jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
actions.st+=/blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

head=red_crane_headpiece,id=87086,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=red_crane_spaulders,id=87088,gems=160agi,enchant=200agi_100crit,reforge=exp_hit
back=arrow_breaking_windcloak,id=87044,enchant=180hit
chest=red_crane_tunic,id=87084,gems=160agi_160agi,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_hit
hands=bonebreaker_gauntlets,id=86964,gems=160agi,enchant=170haste,addon=synapse_springs_mark_ii
waist=tomb_raiders_girdle,id=87022,gems=160agi_160agi_160agi
legs=red_crane_leggings,id=87087,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140agi,reforge=crit_hit
finger1=regails_band_of_the_endless,id=90503,enchant=160agi,reforge=crit_hit
finger2=painful_thorned_ring,id=86974,enchant=160agi,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=windsong,reforge=exp_hit
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=exp_haste

# Gear Summary
# gear_strength=80
# gear_agility=18268
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2555
# gear_hit_rating=2552
# gear_crit_rating=3564
# gear_haste_rating=6246
# gear_mastery_rating=2121
# gear_armor=18523
# meta_gem=agile_primal
# tier14_2pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=windsong
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Paladin_Retribution_T14H : 113142 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
113142.5 113142.5 47.60 / 0.04% 3980 / 3.5% 84.5 1280.5 1277.8 Mana 8.19% 53.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
Glyphs
  • templars_verdict
  • double_jeopardy
  • mass_exorcism

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:273236|84687|83278|64326|48379|31535|12151&chds=0,546472&chco=F58CBA,F58CBA,C79C6E,F58CBA,F58CBA,C79C6E,C79C6E&chm=t++273236++execution_sentence,F58CBA,0,0,15|t++84687++hammer_of_wrath,F58CBA,1,0,15|t++83278++templars_verdict,C79C6E,2,0,15|t++64326++exorcism,F58CBA,3,0,15|t++48379++judgment,F58CBA,4,0,15|t++31535++crusader_strike,C79C6E,5,0,15|t++12151++melee,C79C6E,6,0,15&chtt=Paladin_Retribution_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,15,14,10,10,8,7,6,5,5,4,0&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,C79C6E,C79C6E,F58CBA,F58CBA,F58CBA,C79C6E,F58CBA,F58CBA,C79C6E,F58CBA&chl=hand_of_light|hammer_of_wrath|templars_verdict|melee|censure|exorcism|judgment|crusader_strike|execution_sentence|seal_of_truth_proc|guardian_of_ancient_kings: melee|ancient_fury&chtt=Paladin_Retribution_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:hkoosvwwxyyz1357787764200xusrpnlljigedaYWVUUTSQQQPPOONNMMNOOPQRRRSSTSSTTTUUUUVVUUUTTTSRQQQQQRRSSTTTUVVWXXZZabbccccbbaaaaZYYWWVUVVVUTTTTTTTTSRRSSSSSSQQQQQQQQQQQQQQQQQQQQRRRRRQQQPPPPPPPPPQQSSTUUVWWXYZabccdddddcbaaZZZZZYYYXXWWVVUVUUUUUUTSSRRQPPPPPPQQQRRRSRSSSSSTTTTTTTTSSRQQQQQPPPPPPPQQRRSSTUVVVVVVVWWXXZZacdefgijkmmnoppqqqqppommkjhfdbZZYXWWVVUUTTTSSSSSSSTTTTSSSSSSRSSSSSSTTUUUUUUVVVWXXYYYYYZYYYYYZZZaaaaabbbbbbbbbbbbaaZZYYXXWVVVUUUUVVVVWWWWWWXXXXXXXXXWWVVUUUUUUUUUUUUUUUUUVVVVVWWWWXWXXXXXYYZaabccddddeeeffffeedccbaZYYXWWVVVUUTTTTTTTTUUUUTTTTTSSSSSSRRRRQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113142|max=284888&chxp=1,1,40,100&chtt=Paladin_Retribution_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,4,7,16,19,41,45,61,104,126,170,218,302,360,406,462,525,524,617,595,566,592,523,506,465,438,404,375,310,247,209,181,168,106,93,52,57,34,13,22,13,5,6,5,1,0,0,1&chds=0,617&chbh=5&chxt=x&chxl=0:|min=104797|avg=113142|max=122941&chxp=0,1,46,100&chtt=Paladin_Retribution_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:21.3,18.8,18.0,14.7,13.1,4.0,2.1,8.2&chds=0,100&chdls=ffffff&chco=C79C6E,F58CBA,C79C6E,F58CBA,F58CBA,F58CBA,F58CBA,ffffff&chl=crusader_strike 96.1s|hammer_of_wrath 84.8s|templars_verdict 80.9s|judgment 66.1s|exorcism 58.9s|inquisition 18.0s|execution_sentence 9.5s|waiting 36.9s&chtt=Paladin_Retribution_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Paladin_Retribution_T14H 113142
ancient_fury 507 0.4% 2.0 300.81sec 112503 0 92281 190743 112503 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 225006.66 225006.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.59 79.46% 92280.98 67595 107755 88673.49 0 107755 146656 146656 0.00
crit 0.41 20.54% 190743.05 139246 221974 70847.10 0 221974 78350 78350 0.00
DPS Timeline Chart

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86704
  • name:Ancient Fury
  • school:holy
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Power, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.107000
  • base_dd_min:229.65
  • base_dd_max:310.71
avenging_wrath 0 0.0% 5.2 95.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 5.16 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:95.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
censure 10495 9.3% 307.1 1.47sec 15381 0 0 0 0 0.0% 0.0% 0.0% 0.0% 200.9 19068 39448 23512 21.8% 0.0% 99.5%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 307.06 307.06 200.87 200.87 0.0000 2.2308 4722874.21 4722874.21 0.00 10539.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 307.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.1 78.19% 19068.18 5720 33965 19080.44 18244 20092 2994936 2994936 0.00
crit 43.8 21.81% 39447.56 11784 69968 39474.53 34481 45112 1727938 1727938 0.00
DPS Timeline Chart

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:107.34
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
crusader_strike 6728 6.0% 78.3 5.76sec 38734 31535 31462 64882 38734 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.26 78.26 0.00 0.00 1.2283 0.0000 3031360.70 3031360.70 0.00 31534.63 31534.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.22 78.23% 31462.41 28773 45511 31463.04 30212 32610 1926217 1926217 0.00
crit 17.03 21.76% 64881.72 59272 93752 64883.98 59744 76739 1105144 1105144 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:3.29
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage plus $m1 and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage plus $m1.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:632.63
  • base_dd_max:632.63
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
execution_sentence 5753 5.1% 7.8 60.98sec 331373 273236 0 0 0 0.0% 0.0% 0.0% 0.0% 77.1 27554 56775 33538 20.5% 0.0% 17.1%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.81 77.15 77.15 1.2128 1.0000 2587272.11 2587272.11 0.00 29871.29 273236.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.3 79.52% 27553.93 8396 193728 27585.51 19557 35002 1690363 1690363 0.00
crit 15.8 20.48% 56774.60 17296 399080 56867.31 26100 161670 896909 896909 0.00
DPS Timeline Chart

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc114916 |CFFFFFFFFStay of Execution|R If used on friendly targets, the falling hammer heals the target for ${$SPH*$114917m2/1000+26.72716306*$114917m1} healing over $114917d. This healing is dealt slowly at first and increases over time, culminating in a final burst of healing.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.222096
  • base_td:486.46
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
exorcism 8411 7.4% 50.1 9.04sec 75525 64326 62070 128657 75525 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.14 50.14 0.00 0.00 1.1741 0.0000 3787008.82 3787008.82 0.00 64326.15 64326.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.01 79.79% 62070.42 39991 106725 62097.15 56870 69919 2483512 2483512 0.00
crit 10.13 20.21% 128657.14 82382 219853 128722.13 100196 181808 1303497 1303497 0.00
DPS Timeline Chart

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:12.65
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:(null)
  • description:Forcefully attempt to expel the evil from the target with a blast of Holy Light. Causes $s1 Holy damage and generates a charge of Holy Power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.677000
  • base_dd_min:6577.24
  • base_dd_max:7342.84
guardian_of_ancient_kings 0 0.0% 2.0 300.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: guardian_of_ancient_kings

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: guardian_of_ancient_kings

Static Values
  • id:86698
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up&buff.avenging_wrath.up
Spelldata
  • id:86698
  • name:Guardian of Ancient Kings
  • school:holy
  • tooltip:Protected by a Guardian of Ancient Kings. Attacks by you and your Guardian infuse you with Ancient Power and unleash Ancient Fury when your Guardian departs.
  • description:Summons a Guardian of Ancient Kings to help you deal damage for $d. The Guardian of Ancient Kings will attack your current enemy. Both your attacks and the attacks of the Guardian will infuse you with Ancient Power that is unleashed as Ancient Fury when the Guardian departs.
hammer_of_wrath 15974 14.1% 70.1 6.40sec 102467 84687 83084 171167 102488 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.11 70.09 0.00 0.00 1.2099 0.0000 7183482.63 7183482.63 0.00 84686.91 84686.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.65 77.97% 83084.13 44873 127994 83240.79 76738 90287 4540627 4540627 0.00
crit 15.44 22.03% 171167.44 92439 263668 171508.30 136330 236327 2642855 2642855 0.00
DPS Timeline Chart

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1800.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:(null)
  • description:Hurls a magical hammer that strikes an enemy for $s1 Holy damage$?s53503[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health$?s53503[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1746.58
  • base_dd_max:1930.43
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
hand_of_light 22017 19.5% 214.6 2.10sec 46195 0 46195 0 46195 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 214.58 214.58 0.00 0.00 0.0000 0.0000 9912506.39 9912506.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 214.58 100.00% 46195.07 12956 154338 46238.38 41854 51926 9912506 9912506 0.00
DPS Timeline Chart

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:75100.82
  • base_dd_max:75100.82
inquisition 0 0.0% 15.2 30.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 15.22 0.00 0.00 1.1816 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
judgment 7105 6.3% 53.5 8.32sec 59717 48379 48472 100270 59717 21.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.52 53.52 0.00 0.00 1.2344 0.0000 3196279.45 3196279.45 0.00 48378.63 48378.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.90 78.29% 48471.92 32635 113049 48465.81 45276 53084 2031141 2031141 0.00
crit 11.62 21.71% 100269.67 67229 232881 100255.51 85692 140579 1165138 1165138 0.00
DPS Timeline Chart

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:4.38
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:(null)
  • description:A magic attack that unleashes the energy of a Seal to cause $s1 Holy damage$?s105424[ and generates one charge of Holy Power.]?s111529[, generate one charge of Holy Power, and apply the Physical Vulnerability debuff to a target. |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:623.49
  • base_dd_max:623.49
melee 11232 9.9% 162.6 2.76sec 31137 12151 26568 54780 31137 21.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.58 162.58 0.00 0.00 2.5626 0.0000 5062288.20 5062288.20 0.00 12150.62 12150.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.99 54.12% 26567.53 23292 37536 26577.29 25365 27676 2337691 2337691 0.00
crit 35.54 21.86% 54780.16 47981 77324 54797.97 50391 60132 1946844 1946844 0.00
glance 39.04 24.01% 19920.38 17469 28152 19927.56 18517 21741 777754 777754 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth_proc 5104 4.5% 307.1 1.47sec 7492 0 6076 12553 7492 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 307.06 307.06 0.00 0.00 0.0000 0.0000 2300412.97 2300412.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 239.93 78.14% 6075.55 4155 8705 6077.14 5936 6236 1457680 1457680 0.00
crit 67.14 21.86% 12552.71 8560 17932 12555.95 11912 13334 842733 842733 0.00
DPS Timeline Chart

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:9839.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over $31803d.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463s1% additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R $@spelldesc31803
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.12
templars_verdict 14949 13.2% 66.2 6.68sec 101706 83278 82491 169901 101706 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.24 66.24 0.00 0.00 1.2213 0.0000 6736560.11 6736560.11 0.00 83278.45 83278.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.67 78.01% 82491.47 72783 115128 82513.02 79565 85977 4262241 4262241 0.00
crit 14.56 21.99% 169900.71 149933 237163 169941.87 152640 194719 2474319 2474319 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:physical
  • tooltip:(null)
  • description:A powerful weapon strike that consumes 3 charges of Holy Power to deal $s1% weapon damage plus $s2.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:628.06
  • base_dd_max:628.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
pet - guardian_of_ancient_kings 36000 / 4867
melee 36000 4.2% 48.5 6.96sec 44565 35382 47400 0 44565 0.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.47 48.47 0.00 0.00 1.2595 0.0000 2160027.30 2160027.30 0.00 35382.44 35382.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.86 76.05% 47399.97 33219 57828 47399.45 43390 51114 1747108 1747108 0.00
glance 11.61 23.95% 35565.38 24914 43371 35565.75 29441 41065 412919 412919 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 241.1 300.8sec 1.4sec 13.52% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_ancient_power
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • ancient_power_1:0.1%
  • ancient_power_2:0.1%
  • ancient_power_3:0.2%
  • ancient_power_4:0.3%
  • ancient_power_5:0.1%
  • ancient_power_6:0.1%
  • ancient_power_7:0.2%
  • ancient_power_8:0.1%
  • ancient_power_9:0.1%
  • ancient_power_10:0.1%
  • ancient_power_11:0.1%
  • ancient_power_12:0.1%
  • ancient_power_13:0.1%
  • ancient_power_14:0.2%
  • ancient_power_15:0.2%
  • ancient_power_16:0.1%
  • ancient_power_17:0.1%
  • ancient_power_18:0.1%
  • ancient_power_19:0.1%
  • ancient_power_20:11.0%

Spelldata details

  • id:86700
  • name:Ancient Power
  • tooltip:Strength increased by $s1%. When Guardian of Ancient Kings departs, the Paladin releases Ancient Fury, causing Holy damage split among all enemies within $86704a1 yards.
  • description:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
avenging_wrath 5.2 0.0 95.7sec 95.7sec 33.22% 38.06%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • avenging_wrath_1:33.2%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.58%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 13.1 12.5 34.1sec 17.0sec 49.72% 49.30%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:49.7%
darkmist_vortex 7.1 0.0 67.2sec 67.2sec 30.85% 30.85%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:30.8%
glyph_double_jeopardy 9.6 43.9 49.7sec 8.3sec 77.76% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:77.8%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:(null)
  • description:Judging a target increases the damage of your next Judgment by $121027s1%, but only if used on a different second target.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inquisition 4.7 10.5 88.6sec 30.4sec 97.75% 99.18%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inquisition_1:97.7%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 305.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 9.3 0.0 50.3sec 50.3sec 30.63% 30.63%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:30.6%
synapse_springs_2 7.8 0.0 61.0sec 61.0sec 17.15% 17.15%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T14H
crusader_strike Mana 78.3 140868.4 1800.0 1800.0 21.5
exorcism Mana 50.1 120342.6 2400.0 2400.0 31.5
hammer_of_wrath Mana 70.1 126189.8 1800.0 1800.0 56.9
inquisition Holy Power 15.2 45.7 3.0 3.0 0.0
judgment Mana 53.5 189473.2 3540.0 3540.0 16.9
templars_verdict Holy Power 66.2 198.7 3.0 3.0 33901.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 88650.00 49.21 46462.59 34.39%
sword_of_light Mana 224.74 486973.67 2166.80 322103.64 39.81%
holy_power_crusader_strike Holy Power 78.26 78.26 1.00 0.00 0.00%
holy_power_exorcism Holy Power 50.14 49.69 0.99 0.45 0.90%
holy_power_hammer_of_wrath Holy Power 70.09 68.07 0.97 2.02 2.88%
holy_power_judgments_of_the_bold Holy Power 53.52 51.56 0.96 1.97 3.68%
Resource RPS-Gain RPS-Loss
Mana 1277.75 1280.53
Holy Power 0.55 0.54
Combat End Resource Mean Min Max
Health 463797.00 463797.00 463797.00
Mana 58776.97 55035.00 60000.00
Holy Power 3.21 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.4%
guardian_of_ancient_kings-Mana Cap 0.4%

Procs

Count Interval
hat_donor 74.5 6.0sec
the_art_of_war 32.6 13.5sec
wasted_art_of_war 2.8 115.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 113142.46
Minimum 104796.76
Maximum 122941.00
Spread ( max - min ) 18144.24
Range [ ( max - min ) / 2 * 100% ] 8.02%
Standard Deviation 2427.8923
5th Percentile 109338.51
95th Percentile 117297.90
( 95th Percentile - 5th Percentile ) 7959.40
Mean Distribution
Standard Deviation 24.2838
95.00% Confidence Intervall ( 113094.86 - 113190.05 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1768
0.1 Scale Factor Error with Delta=300 50320
0.05 Scale Factor Error with Delta=300 201280
0.01 Scale Factor Error with Delta=300 5032021
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 113142.46

Damage

Sample Data
Count 9996
Mean 48745052.25

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 398.06
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
4 0.00 seal_of_truth
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 0.00 rebuke
8 0.00 seal_of_truth,if=mana.pct>=90|seal.none
9 0.00 seal_of_insight,if=mana.pct<=20
A 1.00 mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
B 5.00 auto_attack
C 15.22 inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
D 2.00 guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
E 5.16 avenging_wrath,if=buff.inquisition.up
F 7.81 use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
G 7.81 execution_sentence,if=buff.inquisition.up
H 40.14 templars_verdict,if=holy_power=5
I 70.11 hammer_of_wrath
J 35.80 wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
K 50.14 exorcism
L 78.26 crusader_strike
M 53.52 judgment
N 26.10 templars_verdict,if=holy_power>=3

Sample Sequence

BKLMCEDFGILIMIHIKIHIKIHILIHILIHIKICILMHKLMHLNMLKMBLHMLNKMKCLMFGLNMKLNMLNKLMNLMLNKLMCLMLNEIKJIKJIHJILJIHJILJIHJIKCILJIFGJIHKMBLHMLNKLMNLMCLKLMNKLNMLKNLMLNMLKNLMLCFGMLKNLMEILJIHJILJIHJIKJIHJILCIMIKBHILJIHJKLMHLNMLKNLMLCMLFGKMLHLMNLKMLHKMKHLNKMLCLMLNKMLEINJILJIMHIKMIDAIBHJICFGIKJIKJIHJIKJIHJKLMHKLNMLNLMKCLMLNKMLNLMILNMIKLHJILFGCJIKLMHILMHILEKHILJIHIKJIHJICJILJIMJIHJIKJIHJILJIHMLIHKLJIHKFGCILMNILMKJIHLMI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20774 18420 17360
Agility 190 181 80
Stamina 22671 20610 20440
Intellect 200 190 80
Spirit 205 205 80
Health 463797 434943 0
Mana 60000 60000 0
Holy Power 5 5 0
Spell Power 22988 18545 0
Spell Hit 15.16% 15.16% 2607
Spell Crit 13.45% 8.45% 3020
Spell Haste 24.50% 18.57% 7893
Mana Per 5 1500 1500 0
Attack Power 45978 37090 0
Melee Hit 7.67% 7.67% 2607
Melee Crit 15.05% 10.05% 3020
Melee Haste 18.57% 18.57% 7893
Swing Speed 30.43% 18.57% 7893
Expertise 7.49% 7.49% 2548
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.37% 9.74% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 42.88% 32.38% 4453

Gear

Average Item Level: 507.73
Head white_tiger_helmet,id=87101,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_haste
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=crit_haste
Shirt empty
Chest white_tiger_battleplate,id=87099,gems=320haste_320haste_120crit,enchant=80all,reforge=crit_mastery
Waist waistplate_of_overwhelming_assault,id=86955,gems=320haste_80str_160hit_80str_160haste_120haste,reforge=mastery_exp
Legs white_tiger_legplates,id=87102,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
Feet impaling_treads,id=86979,gems=320haste_60hit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=320haste,enchant=180str,reforge=hit_haste
Hands white_tiger_gauntlets,id=87100,gems=320haste,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
Finger1 dread_shadow_ring,id=87158,reforge=hit_haste
Finger2 ring_of_the_bladed_tempest,id=86957
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel,reforge=crit_haste
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Burden of Guilt
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence

Profile

#!./simc

paladin="Paladin_Retribution_T14H"
origin="unknown"
level=90
race=tauren
spec=retribution
role=hybrid
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
glyphs=templars_verdict/double_jeopardy/mass_exorcism

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
actions.precombat+=/seal_of_truth
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=rebuke
actions+=/seal_of_truth,if=mana.pct>=90|seal.none
actions+=/seal_of_insight,if=mana.pct<=20
actions+=/mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
actions+=/auto_attack
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
actions+=/guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
actions+=/avenging_wrath,if=buff.inquisition.up
actions+=/use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
actions+=/execution_sentence,if=buff.inquisition.up
actions+=/templars_verdict,if=holy_power=5
actions+=/hammer_of_wrath
actions+=/wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
actions+=/exorcism
actions+=/crusader_strike
actions+=/judgment
actions+=/templars_verdict,if=holy_power>=3

head=white_tiger_helmet,id=87101,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=white_tiger_battleplate,id=87099,gems=320haste_320haste_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=320haste,enchant=180str,reforge=hit_haste
hands=white_tiger_gauntlets,id=87100,gems=320haste,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=320haste_80str_160hit_80str_160haste_120haste,reforge=mastery_exp
legs=white_tiger_legplates,id=87102,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=320haste_60hit,enchant=140mastery
finger1=dread_shadow_ring,id=87158,reforge=hit_haste
finger2=ring_of_the_bladed_tempest,id=86957
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel,reforge=crit_haste

# Gear Summary
# gear_strength=17360
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2548
# gear_hit_rating=2607
# gear_crit_rating=3020
# gear_haste_rating=7893
# gear_mastery_rating=4453
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=white_tiger_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Priest_Disc_T14H : 70847 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
17040.7 17040.7 21.80 / 0.13% 1825 / 10.7% 2.1 70847.3 70847.3 33.82 / 0.05% 2835 / 4.0% 12.6 5621.9 5038.0 Mana 17.86% 31.1 100.0%
Origin http://mop.chardev.org/profile/383-Priest_Disc_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
Glyphs
  • power_word_shield
  • prayer_of_mending
  • renew

Charts

http://3.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:130036|90453|82949|74328&chds=0,260073&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++130036++power_word_shield,F58CBA,0,0,15|t++90453++greater_heal,F58CBA,1,0,15|t++82949++renew,F58CBA,2,0,15|t++74328++penance_heal,F58CBA,3,0,15&chtt=Priest_Disc_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:45,27,14,10,3&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=greater_heal|penance_heal|power_word_shield|renew|power_word_shield_glyph&chtt=Priest_Disc_T14H Healing Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:0w1y1zywzxzz558023402z3z3zz1213z1z1yyxuqrmnlmhiiiigeggaYccefgijjkmnnononpoooompopoppopnmnoloponoqoonmkmikjhgfeccZYYYXWZZZYYWXVVVWXXabcefffedeehgjjnnooppmnlmmmnonllkkiifeddccbaaZZabcdeefgiiklmnopqqrqrqpoonnmkihfeccbbZbabbbaaZYYZZaaaabbbabZaZZZaacdeefghjlmmnoopppopoonnmmllkjhhgfeedcbbaZYYXXWWVUTTSSSSSSUVWYYZZaaddghjjnopoppopoooooppnnlmjkhhggffedcbaZZYXXWXWXXZZbbddffhhiiklmnooqqqqqppoonnnnmmkkiiggeeccbaZZYYXWWWVVVVVVVWXYYaabcdefghhjjllnnoopopoooonnmmllkjihffddbbaZYYXWWVVVUUUVVVWXYZabcddffghijklmmooooooononnmmllkjiigfedcbaaYYXWVVUUTTTUUUVVUVVVVVVWWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=17041|max=123887&chxp=1,1,14,100&chtt=Priest_Disc_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,4,10,7,29,34,37,61,104,114,118,207,228,274,317,358,454,506,472,556,544,556,581,525,496,462,456,428,398,279,266,236,183,178,132,104,77,57,41,29,19,19,11,12,2,4,2,3,2&chds=0,581&chbh=5&chxt=x&chxl=0:|min=65206|avg=70847|max=77377&chxp=0,1,46,100&chtt=Priest_Disc_T14H HPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.5,26.0,9.2,9.0,2.0,17.9&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=greater_heal 159.8s|penance_heal 117.1s|power_word_shield 41.3s|renew 40.3s|mindbender 8.9s|waiting 80.4s&chtt=Priest_Disc_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Disc_T14H 17041
berserking 0 0.0% 3.0 180.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
divine_aegis 11732 68.8% 0.0 1.#Rsec 0 0 33467 0 33467 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 157.76 0.00 0.00 0.0000 0.0000 5279655.11 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.76 100.00% 33466.67 0 59609 33447.67 28449 38654 5279655 0 0.00
DPS Timeline Chart
greater_heal 32158 45.3% 78.0 5.70sec 185295 90453 137580 274996 185295 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 78.01 78.01 0.00 0.00 2.0485 0.0000 14455277.08 14455277.08 0.00 90452.89 90452.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.92 65.28% 137579.84 136103 142682 137580.69 136256 139079 7006070 7006070 0.00
crit 27.09 34.72% 274995.83 272205 285364 274992.42 272205 279098 7449207 7449207 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.inner_focus.up
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
greater_heal_divine_aegis 0 0.0% 27.1 16.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 27.09 27.09 0.00 0.00 0.0000 0.0000 0.00 3458771.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.09 100.00% 0.00 0 0 0.00 0 0 0 3458772 100.00
HPS Timeline Chart

Action details: greater_heal_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:81661.57
  • base_dd_max:81661.57
inner_focus 0 0.0% 15.7 30.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inner_focus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inner_focus

Static Values
  • id:89485
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:89485
  • name:Inner Focus
  • school:physical
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
mindbender 0 0.0% 7.0 60.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 1.2766 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=20
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
penance_heal 19310 27.3% 62.3 7.27sec 139783 74328 0 0 0 0.0% 0.0% 0.0% 0.0% 185.3 39754 79543 47074 18.4% 0.0% 22.5%

Stats details: penance_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 62.29 62.29 185.27 184.97 1.8806 0.5469 8707138.40 8707138.40 0.00 74327.87 74327.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.9 81.60% 39753.98 30374 41394 39752.75 39549 40011 6000346 6000346 0.00
crit 34.0 18.40% 79542.75 60748 82788 79538.36 77497 80721 2706793 2706793 0.00
HPS Timeline Chart

Action details: penance_heal

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9300.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.grace.down
Spelldata
  • id:47540
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: penance_heal_tick

Static Values
  • id:47666
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47666
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc47540
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:6202.59
  • base_dd_max:7008.46
penance_heal_tick_divine_aegis 0 0.0% 34.0 12.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: penance_heal_tick_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 34.03 34.03 0.00 0.00 0.0000 0.0000 0.00 1256809.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.03 100.00% 0.00 0 0 0.00 0 0 0 1256810 100.00
HPS Timeline Chart

Action details: penance_heal_tick_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:23691.64
  • base_dd_max:23691.64
power_word_shield 9641 (11934) 13.6% (16.8%) 32.7 14.07sec 164117 130036 33298 0 33298 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 32.71 130.24 0.00 0.00 1.2621 0.0000 4336904.10 4357646.61 0.48 130036.32 130036.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.24 100.00% 33298.25 0 59609 33297.92 32771 33630 4336904 4357647 0.48
HPS Timeline Chart

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:18300.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!cooldown.rapture.remains
Spelldata
  • id:17
  • name:Power Word: Shield
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:1.870900
  • base_dd_min:19428.31
  • base_dd_max:19428.31
power_word_shield_glyph 2294 3.2% 32.7 14.07sec 31538 0 26641 53300 31538 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 32.71 32.71 0.00 0.00 0.0000 0.0000 1031645.34 1031645.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.70 81.63% 26641.16 26371 27646 26640.98 26417 26881 711414 711414 0.00
crit 6.01 18.37% 53299.84 52742 55292 53226.70 0 55292 320231 320231 0.00
HPS Timeline Chart

Action details: power_word_shield_glyph

Static Values
  • id:55672
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:55672
  • name:Glyph of Power Word: Shield
  • school:physical
  • tooltip:(null)
  • description:$55672s1% of the absorb from your Power Word: Shield spell is converted into healing.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:26371.06
  • base_dd_max:26371.06
power_word_shield_glyph_divine_aegis 0 0.0% 6.0 64.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 6.01 6.01 0.00 0.00 0.0000 0.0000 0.00 148690.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.01 100.00% 0.00 0 0 0.00 0 0 0 148691 100.00
HPS Timeline Chart

Action details: power_word_shield_glyph_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:15822.60
  • base_dd_max:15822.60
renew 7446 10.5% 32.0 14.03sec 104454 82949 0 0 0 0.0% 0.0% 0.0% 0.0% 130.5 21638 43293 25636 18.5% 0.0% 70.3%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 32.04 32.04 130.54 130.54 1.2593 2.4268 3346579.40 3346579.40 0.00 9370.55 82949.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.4 81.54% 21638.27 21412 22447 21638.39 21460 21829 2303164 2303164 0.00
crit 24.1 18.46% 43293.19 42824 44894 43294.18 42824 44204 1043415 1043415 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!dot.renew.ticking&mana>20000
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
renew_divine_aegis 0 0.0% 24.1 17.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: renew_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 24.10 24.10 0.00 0.00 0.0000 0.0000 0.00 484461.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.10 100.00% 0.00 0 0 0.00 0 0 0 484462 100.00
HPS Timeline Chart

Action details: renew_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:12847.25
  • base_dd_max:12847.25
pet - mindbender 23389 / 5309
melee 23389 31.2% 84.6 4.44sec 28268 24182 29917 59865 28268 15.5% 15.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.65 84.65 0.00 0.00 1.1690 0.0000 2392769.83 2392769.83 0.00 24181.61 24181.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.57 45.57% 29917.21 26088 31773 29917.49 28625 31253 1154039 1154039 0.00
crit 13.09 15.46% 59865.10 52175 63547 59860.28 54784 63547 783481 783481 0.00
glance 20.28 23.96% 22444.23 19566 23830 22445.53 21243 23653 455250 455250 0.00
dodge 6.36 7.51% 0.00 0 0 0.00 0 0 0 0 0.00
miss 6.34 7.50% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 20.5 18.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.53 20.53 0.00 0.00 1.2835 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.8sec 6.66% 9.86%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 7.01%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
inner_focus 15.7 0.0 29.6sec 30.3sec 11.79% 19.99%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_focus
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_focus_1:11.8%

Spelldata details

  • id:89485
  • name:Inner Focus
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:45.00
  • default_chance:0.00%
jade_spirit 7.9 0.0 59.6sec 59.6sec 20.82% 20.67%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:20.8%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
mindbender-shadowcrawl 20.5 0.0 18.9sec 18.9sec 85.39% 84.88%

Buff details

  • buff initial source:Priest_Disc_T14H_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:19.4%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Disc_T14H
greater_heal Mana 78.0 1104833.4 14162.3 14162.3 13.1
penance_heal Mana 62.3 579301.8 9300.0 9300.0 15.0
power_word_shield Mana 32.7 598623.8 18300.0 18300.0 9.0
renew Mana 32.0 249902.0 7800.0 7800.0 13.4
Resource Gains Type Count Total Average Overflow
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1801.50 972309.71 539.72 0.00 0.00%
mindbender Mana 71.95 863345.74 12000.00 0.00 0.00%
Rapture Mana 32.71 403969.78 12349.40 12582.00 3.02%
Resource RPS-Gain RPS-Loss
Mana 5038.04 5621.92
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 36925.82 146.32 121835.70
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 24.1 17.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 17040.74
Minimum 12686.41
Maximum 21485.91
Spread ( max - min ) 8799.50
Range [ ( max - min ) / 2 * 100% ] 25.82%
Standard Deviation 1112.2921
5th Percentile 15236.64
95th Percentile 18886.02
( 95th Percentile - 5th Percentile ) 3649.38
Mean Distribution
Standard Deviation 11.1251
95.00% Confidence Intervall ( 17018.93 - 17062.54 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 163
0.1% Error 16366
0.1 Scale Factor Error with Delta=300 10561
0.05 Scale Factor Error with Delta=300 42245
0.01 Scale Factor Error with Delta=300 1056139
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 17040.74

Damage

Sample Data
Count 9996
Mean 5279655.11

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 70847.33
Minimum 65205.77
Maximum 77376.88
Spread ( max - min ) 12171.10
Range [ ( max - min ) / 2 * 100% ] 8.59%
Standard Deviation 1725.0630
5th Percentile 68078.70
95th Percentile 73749.62
( 95th Percentile - 5th Percentile ) 5670.91
Mean Distribution
Standard Deviation 17.2541
95.00% Confidence Intervall ( 70813.51 - 70881.15 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2277
0.1 Scale Factor Error with Delta=300 25403
0.05 Scale Factor Error with Delta=300 101614
0.01 Scale Factor Error with Delta=300 2540350
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 70847.33

Heal

Sample Data
Count 9996
Mean 31877544.32

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 233.59
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=75
6 6.95 shadowfiend,if=mana.pct<=20
7 0.00 hymn_of_hope,if=pet.shadowfiend.active
8 3.00 berserking
9 15.68 inner_focus
A 0.00 power_infusion,if=talent.power_infusion.enabled
B 32.71 power_word_shield,if=!cooldown.rapture.remains
C 62.29 penance_heal,if=buff.grace.down
D 15.87 greater_heal,if=buff.inner_focus.up
E 0.00 penance_heal
F 32.04 renew,if=!dot.renew.ticking&mana>20000
G 64.04 greater_heal,if=mana>20000

Sample Sequence

89BCDFGGCBG5GFCGG9BDCFGGGBCGFGG9CBDGFBCFG6CGGBC9DFGCGBGCFGGB9CDFGCGBGCFC6BCFG9DCBFCGGCBFGCG9DBCFGCBCFC68GGBC9DFGCGBGCFGGBC9DFGBCFGCBC6CFGG9BCDFGCGBGCFGGC9DCBCFCC6BFCGG9CBDFCGGBCFGGCG9BDCFCBC68CFGGBCGF9DCGBGCFGGCBG9DCFGCCC6BFCGG9CDBFCGGCGBF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.40% 34.90% 3577

Gear

Average Item Level: 508.13
Head guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
Neck korvens_ambersealed_beetle,id=86976,reforge=crit_haste
Shoulders guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
Shirt empty
Chest guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
Waist belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
Legs guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
Hands guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982
Finger2 watersoul_signet,id=87151
Trinket1 spirits_of_the_sun,id=87163
Trinket2 jade_courtesan_figurine,id=87081
Back drape_of_gathering_clouds,id=86961,enchant=180int
Main Hand unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Disc_T14H"
origin="http://mop.chardev.org/profile/383-Priest_Disc_T14H.html"
level=90
race=troll
spec=discipline
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
glyphs=power_word_shield/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=75
actions+=/shadowfiend,if=mana.pct<=20
actions+=/hymn_of_hope,if=pet.shadowfiend.active
actions+=/berserking
actions+=/inner_focus
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/power_word_shield,if=!cooldown.rapture.remains
actions+=/penance_heal,if=buff.grace.down
actions+=/greater_heal,if=buff.inner_focus.up
actions+=/penance_heal
actions+=/renew,if=!dot.renew.ticking&mana>20000
actions+=/greater_heal,if=mana>20000

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Holy_T14H : 69258 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
2586.1 2586.1 8.62 / 0.33% 732 / 28.3% 0.0 69258.3 69258.3 48.92 / 0.07% 4079 / 5.9% 20.8 3331.8 2856.4 Mana 4.86% 35.3 100.0%
Origin http://mop.chardev.org/profile/326-Priest_Holy_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
Glyphs
  • circle_of_healing
  • prayer_of_mending
  • renew

Charts

http://2.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:126412|93092|65916|33978&chds=0,252824&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++126412++greater_heal,F58CBA,0,0,15|t++93092++flash_heal,F58CBA,1,0,15|t++65916++holy_word_serenity,F58CBA,2,0,15|t++33978++heal,F58CBA,3,0,15&chtt=Priest_Holy_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,16,16,16,11,10&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=heal|renew|echo_of_light|greater_heal|holy_word_serenity|flash_heal&chtt=Priest_Holy_T14H Healing Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:eiiijkkmnnnqrttvwy001323445656777787530xwtrqqpnmlljjihgfghiijklmmlmmmmlllkkkjjijjjjiiiiiiihiihhhhhggggggggffffffffffffffedcbaaZYXXXXXXXWWWWWWXXYYZabcccccccccccdddcdccdccdddddddeeeeefefeefeeeeeeddccbbaZYYXXXWVUTTSRRRRSRSSSTTTUUVWXYZabcdddefffggghhhhhhhiiiiiiiiiiiiiihhhhhhhhhhhgggggggggggggffedcbaZYYYXXXXXXWWWWWXXYZZabcdcdcdddddddddddddedddddddddddddddddddddeeeeeeeeeeeeeeeeeeddddcccccccccccccdddddddddddddddddddddccccccccccccccccccccccccccccccccccccccccccccccccccccbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaZZZZZZZZZZY&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=2586|max=132197&chxp=1,1,2,100&chtt=Priest_Holy_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,2,4,3,7,11,12,20,37,34,62,78,100,129,206,266,312,380,430,484,526,639,593,660,661,627,568,519,519,430,360,294,259,182,156,116,85,72,55,32,20,16,10,8,4,1,4,0,1&chds=0,661&chbh=5&chxt=x&chxl=0:|min=59321|avg=69258|max=79164&chxp=0,1,50,100&chtt=Priest_Holy_T14H HPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:63.7,11.3,8.6,7.6,1.6,0.8,0.8,4.9&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=heal 287.1s|holy_word_serenity 50.7s|greater_heal 38.9s|flash_heal 34.1s|hymn_of_hope 7.2s|renew 3.8s|shadowfiend 3.4s|waiting 21.9s&chtt=Priest_Holy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Holy_T14H 2586
berserking 0 0.0% 3.0 181.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
chakra 0 0.0% 15.0 31.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.01 15.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: chakra

Static Values
  • id:81208
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:81208
  • name:Chakra: Serenity
  • school:holy
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
echo_of_light 11028 15.9% 235.5 1.91sec 21066 0 0 0 0 0.0% 0.0% 0.0% 0.0% 437.4 11343 0 11343 0.0% 0.0% 97.1%

Stats details: echo_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 235.51 235.51 437.39 437.39 0.0000 1.0000 4961375.67 4961375.67 0.00 11343.24 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.51 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 437.4 100.00% 11343.24 1934 48457 11364.46 9432 13174 4961376 4961376 0.00
HPS Timeline Chart

Action details: echo_of_light

Static Values
  • id:77489
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:77489
  • name:Echo of Light
  • school:holy
  • tooltip:Healing $w every sec.
  • description:Heals every sec for $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:10695.69
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
flash_heal 7036 10.2% 26.8 16.37sec 118325 93092 79391 158817 118325 49.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flash_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 26.82 26.82 0.00 0.00 1.2711 0.0000 3174066.86 3174066.86 0.00 93092.06 93092.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.68 50.98% 79390.70 78504 82299 79394.21 78504 81540 1085705 1085705 0.00
crit 13.15 49.02% 158817.30 157008 164597 158819.92 157008 164597 2088362 2088362 0.00
HPS Timeline Chart

Action details: flash_heal

Static Values
  • id:2061
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.surge_of_light.up
Spelldata
  • id:2061
  • name:Flash Heal
  • school:holy
  • tooltip:(null)
  • description:Heals a friendly target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.642000
  • base_dd_min:15767.86
  • base_dd_max:18324.82
greater_heal 11042 15.8% 32.0 9.88sec 153290 126412 105723 211459 153290 45.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 32.04 32.04 0.00 0.00 1.2126 0.0000 4911363.98 4911363.98 0.00 126412.13 126412.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.63 55.01% 105722.99 104694 109756 105720.35 104694 109295 1863489 1863489 0.00
crit 14.41 44.99% 211458.76 209389 219511 211450.49 209389 218246 3047875 3047875 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.serendipity.react>=2&mana.pct>40
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
heal 21598 31.3% 136.9 3.28sec 71268 33978 49534 99096 71268 43.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 136.90 136.90 0.00 0.00 2.0975 0.0000 9756533.26 9756533.26 0.00 33977.84 33977.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.87 56.15% 49533.79 48973 51339 49535.00 49145 50104 3807491 3807491 0.00
crit 60.03 43.85% 99095.84 97945 102678 99098.51 98283 100033 5949042 5949042 0.00
HPS Timeline Chart

Action details: heal

Static Values
  • id:2050
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:2050
  • name:Heal
  • school:holy
  • tooltip:(null)
  • description:Heal your target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.024000
  • base_dd_min:9847.03
  • base_dd_max:11443.84
holy_word_serenity 7424 10.7% 39.9 11.40sec 83789 65916 62762 125550 83789 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_word_serenity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.90 39.90 0.00 0.00 1.2711 0.0000 3343480.03 3343480.03 0.00 65916.45 65916.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.54 66.51% 62761.55 62097 65101 62761.58 62097 63411 1665705 1665705 0.00
crit 13.36 33.49% 125549.59 124193 130202 125548.40 124193 130202 1677775 1677775 0.00
HPS Timeline Chart

Action details: holy_word_serenity

Static Values
  • id:88684
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.chakra_serenity.up
Spelldata
  • id:88684
  • name:Holy Word: Serenity
  • school:holy
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.300000
  • base_dd_min:12366.55
  • base_dd_max:14517.25
renew 11129 16.1% 3.1 103.85sec 1638816 1317699 0 0 0 0.0% 0.0% 0.0% 0.0% 182.5 19144 38304 27463 43.4% 0.0% 99.1%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.06 3.06 182.47 182.47 1.2437 2.4475 5011209.03 5011209.03 0.00 11125.81 1317698.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.3 56.58% 19144.41 18941 19857 19144.45 19037 19259 1976715 1976715 0.00
crit 79.2 43.42% 38303.97 37883 39714 38304.23 38024 38570 3034494 3034494 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:-0.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowfiend 0 0.0% 2.8 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 0.00 0.00 1.2340 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=65
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
pet - shadowfiend 35576 / 2586
melee 35576 100.0% 27.7 12.27sec 41959 38591 44404 88866 41959 15.4% 14.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.72 27.72 0.00 0.00 1.0873 0.0000 1163159.79 1163159.79 0.00 38590.62 38590.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.65 45.62% 44404.27 38959 47436 44402.63 41346 47436 561623 561623 0.00
crit 4.27 15.41% 88866.20 77918 94873 87630.63 0 94873 379548 379548 0.00
glance 6.67 24.05% 33298.72 29219 35577 33247.69 0 35577 221988 221988 0.00
dodge 2.07 7.47% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.07 7.45% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.5 72.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 5.49 0.00 0.00 1.2371 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.1sec 181.1sec 6.64% 5.63%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.66%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
hymn_of_hope 0.9 3.2 0.0sec 1.7sec 2.90% 2.90%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_hymn_of_hope
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • hymn_of_hope_1:2.9%

Spelldata details

  • id:64904
  • name:Hymn of Hope
  • tooltip:Maximum mana increased by $s2%.
  • description:Restores $64904s1% mana to $64901s2 nearby low mana friendly party or raid targets every $64901t1 sec for $64901d, and increases their total maximum mana by $64904s2% for $64904d. Maximum of $*4;s2 mana restores. The Priest must channel to maintain the spell.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
jade_spirit 8.7 0.0 54.5sec 54.5sec 22.83% 22.99%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
serendipity 8.9 17.9 50.7sec 16.3sec 70.64% 70.64%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serendipity
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serendipity_1:22.1%
  • serendipity_2:48.5%

Spelldata details

  • id:63735
  • name:Serendipity
  • tooltip:Reduces the cast time of your next Greater Heal or Prayer of Healing by $s1% and mana cost by $s2%.
  • description:When you heal with Binding Heal or Flash Heal, the cast time of your next Greater Heal or Prayer of Healing spell is reduced by $63735s1% and mana cost reduced by $63735s2%. Stacks up to 2 times. Lasts $63735d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
serenity 39.9 0.0 11.4sec 11.4sec 52.78% 37.44%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serenity
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serenity_1:52.8%

Spelldata details

  • id:88684
  • name:Holy Word: Serenity
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
  • max_stacks:
  • duration:6.00
  • cooldown:10.00
  • default_chance:0.00%
surge_of_light 26.9 2.4 16.3sec 14.9sec 8.30% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_surge_of_light
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_light_1:6.2%
  • surge_of_light_2:2.1%

Spelldata details

  • id:114255
  • name:Surge of Light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • description:You have a $109186s1% chance when you Smite, Heal, Flash Heal, Binding Heal or Greater Heal to cause your next Flash Heal to be instant cast and have no mana cost. Limit 2 charges.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
shadowfiend-shadowcrawl 5.5 0.0 72.4sec 72.4sec 83.35% 85.91%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.1%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
chakra_serenity

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_chakra_serenity
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chakra_serenity_1:100.0%

Spelldata details

  • id:81208
  • name:Chakra: Serenity
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:30.00
  • default_chance:1.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Holy_T14H
greater_heal Mana 32.0 457348.5 14274.4 14274.4 10.7
heal Mana 136.9 780328.6 5700.0 5700.0 12.5
holy_word_serenity Mana 39.9 239422.0 6000.0 6000.0 14.0
renew Mana 3.1 23851.0 7800.0 7800.0 210.1
Resource Gains Type Count Total Average Overflow
hymn_of_hope_max_mana Mana 0.94 42357.44 45000.00 0.00 0.00%
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1801.50 967723.88 537.18 2.04 0.00%
shadowfiend Mana 23.59 219318.56 9298.86 0.26 0.00%
hymn_of_hope Mana 4.10 27416.21 6693.18 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 2856.43 3331.76
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 86284.63 20105.54 251361.49
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%
shadowfiend-Mana Cap 0.0%
lightwell-Mana Cap 0.0%

Procs

Count Interval
hat_donor 79.2 5.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 2586.09
Minimum 1214.99
Maximum 4267.97
Spread ( max - min ) 3052.98
Range [ ( max - min ) / 2 * 100% ] 59.03%
Standard Deviation 439.7395
5th Percentile 1873.47
95th Percentile 3337.92
( 95th Percentile - 5th Percentile ) 1464.45
Mean Distribution
Standard Deviation 4.3983
95.00% Confidence Intervall ( 2577.47 - 2594.71 )
Normalized 95.00% Confidence Intervall ( 99.67% - 100.33% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1110
0.1% Error 111070
0.1 Scale Factor Error with Delta=300 1650
0.05 Scale Factor Error with Delta=300 6602
0.01 Scale Factor Error with Delta=300 165072
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 2586.09

Damage

Sample Data
Count 9996
Mean 0.00

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 69258.31
Minimum 59321.00
Maximum 79164.24
Spread ( max - min ) 19843.24
Range [ ( max - min ) / 2 * 100% ] 14.33%
Standard Deviation 2495.3013
5th Percentile 65267.11
95th Percentile 73425.27
( 95th Percentile - 5th Percentile ) 8158.16
Mean Distribution
Standard Deviation 24.9580
95.00% Confidence Intervall ( 69209.40 - 69307.23 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4986
0.1 Scale Factor Error with Delta=300 53153
0.05 Scale Factor Error with Delta=300 212612
0.01 Scale Factor Error with Delta=300 5315322
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 69258.31

Heal

Sample Data
Count 9996
Mean 31158028.83

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 264.96
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=50
6 2.76 shadowfiend,if=mana.pct<=65
7 0.99 hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
8 3.00 berserking
9 15.01 chakra_serenity
A 3.06 renew,if=!ticking
B 39.90 holy_word,if=buff.chakra_serenity.up
C 32.50 greater_heal,if=buff.serendipity.react>=2&mana.pct>40
D 26.83 flash_heal,if=buff.surge_of_light.up
E 139.91 heal

Sample Sequence

89ABEEEEEEBEDEEEEBEEEEE9EBEDEEDCCBCCABCC6CE9EBEDEEEBEEEEDBCCCC9CCCBC5CCCCCDBEEEEEBEE9EDBEDEBEEDEEBE9EDEDBEEEEEBEE8EEE9BEEEEEBEEEEEBEE9BEEDEEBEEE679ABDEEDCCBCCCCCCCBCDEE9EBEDEEEBEEBEE9EEBDEDEEBEEEEEBE9EEEEBEEDEDBE8EDEEE9BEEEEEBDEEDDDBEDED9EBEEEEEBE6EEEBEE9EEEBEEEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.70% 17.45% 3577

Gear

Average Item Level: 508.13
Head guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
Neck korvens_ambersealed_beetle,id=86976,reforge=crit_haste
Shoulders guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
Shirt empty
Chest guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
Waist belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
Legs guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
Hands guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982
Finger2 watersoul_signet,id=87151
Trinket1 spirits_of_the_sun,id=87163
Trinket2 jade_courtesan_figurine,id=87081
Back drape_of_gathering_clouds,id=86961,enchant=180int
Main Hand unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Holy_T14H"
origin="http://mop.chardev.org/profile/326-Priest_Holy_T14H.html"
level=90
race=troll
spec=holy
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
glyphs=circle_of_healing/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=50
actions+=/shadowfiend,if=mana.pct<=65
actions+=/hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
actions+=/berserking
actions+=/chakra_serenity
actions+=/renew,if=!ticking
actions+=/holy_word,if=buff.chakra_serenity.up
actions+=/greater_heal,if=buff.serendipity.react>=2&mana.pct>40
actions+=/flash_heal,if=buff.surge_of_light.up
actions+=/heal

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Shadow_T14H : 108238 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
108237.8 108237.8 41.42 / 0.04% 3479 / 3.2% 21.9 4693.3 4459.7 Mana 0.00% 35.9 100.0%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:361364|194447|143307|127628|113200|103223|101944|52675&chds=0,722729&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9&chm=t++361364++devouring_plague,9482C9,0,0,15|t++194447++vampiric_touch,9482C9,1,0,15|t++143307++shadow_word_pain,9482C9,2,0,15|t++127628++halo_damage,9482C9,3,0,15|t++113200++shadow_word_death,9482C9,4,0,15|t++103223++mind_spike,000066,5,0,15|t++101944++mind_blast,9482C9,6,0,15|t++52675++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,10,10,9,8,6,6,5,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mind_spike|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=Priest_Shadow_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:457777775433434441ywutromkjhggfgeddcbbaaZZYZZZZaaaaaaabbbbbbbcccbaZZZZZZaaabbbcccccccbbbbbbaaZZYXXXWWWXXYYZZaaaabbbbbbbbbbaZYYXWXWWWWXXXXXYYYYYZZZaabaaaZZZYYZZZZZZZZZZaaabbbbccccddeeeeffghhhghhhhhhhhhggffeedcbaZZYYYYYXXXWWWVWWWWXXXYYZZZZZZZZZZZZZZZZZZZZZaaaaaabbbbccccccccccbbbbaaaaaaZZZZZZZZZYYXXWXXXXXXXXWWWXXXYYZZabcccccddddefffffffffffffeeeeeeedddddccdddeefghijklmnooppqqqrrrrrqqponnmlkkjjiiiihhhhhhggggggggghhhhhiiiijjjkkkkkkkkkkkkkkkkkkkkkkkkkkkkllllllllmmmmmmmmmmmmmmmmllllllllllllllllllllmmmmmmmmmmmmnnnnnnnnnnnnnmmmmmmlllllkkkjjjiihhhhgggffee&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=108238|max=212645&chxp=1,1,51,100&chtt=Priest_Shadow_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,1,4,3,6,11,17,39,60,67,102,137,201,239,275,337,427,501,524,615,620,595,599,578,571,487,458,442,392,327,276,233,185,147,125,103,80,58,41,32,27,12,13,10,5,4,2,2,3&chds=0,620&chbh=5&chxt=x&chxl=0:|min=100682|avg=108238|max=116635&chxp=0,1,47,100&chtt=Priest_Shadow_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:50.8,11.6,9.7,9.6,5.9,4.7,3.9,2.9,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 228.9s|mind_blast 52.4s|mind_spike 43.5s|shadow_word_pain 43.4s|vampiric_touch 26.8s|devouring_plague 21.2s|shadow_word_death 17.4s|halo_damage 12.9s|shadowfiend 3.1s&chtt=Priest_Shadow_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T14H 108238
berserking 0 0.0% 3.0 180.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6037 (17050) 5.6% (15.8%) 18.2 25.93sec 421593 361364 125008 258685 149288 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 0.00 0.00 1.1667 0.0000 2718650.12 2718650.12 0.00 361364.35 361364.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.90 81.84% 125008.31 112133 177071 125019.87 114125 136640 1863019 1863019 0.00
crit 3.31 18.16% 258684.61 230994 364766 251739.61 0 364766 855631 855631 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2643 2.4% 47.7 9.38sec 24970 0 20894 43334 24996 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.66 47.61 0.00 0.00 0.0000 0.0000 1190043.24 1190043.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.91 81.72% 20894.18 18622 29405 20901.25 19465 22685 812961 812961 0.00
crit 8.70 18.28% 43334.46 38362 60574 43337.59 0 55030 377083 377083 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8370 7.7% 18.2 25.93sec 206957 0 0 0 0 0.0% 0.0% 0.0% 0.0% 152.4 20691 42889 24728 18.2% 0.0% 25.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.21 18.21 152.41 152.41 0.0000 0.7416 3768853.63 3768853.63 0.00 33342.06 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.7 81.81% 20690.82 18622 29405 20694.67 20023 21585 2580069 2580069 0.00
crit 27.7 18.19% 42889.34 38362 60574 42898.54 39292 48314 1188785 1188785 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3663 3.4% 11.1 41.85sec 148159 127628 124043 257578 148722 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.08 0.00 0.00 1.1609 0.0000 1648183.30 1648183.30 0.00 127627.64 127627.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 81.52% 124043.28 113411 170370 124054.21 114314 136789 1120633 1120633 0.00
crit 2.05 18.48% 257577.68 233627 350962 230233.33 0 338156 527550 527550 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11849 11.0% 45.1 10.05sec 118360 101944 98920 204991 118360 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.10 45.10 0.00 0.00 1.1610 0.0000 5338211.22 5338211.22 0.00 101944.30 101944.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.84 81.67% 98920.18 89948 142709 98934.75 94871 102609 3643817 3643817 0.00
crit 8.27 18.33% 204990.82 185293 293981 204989.17 0 266732 1694394 1694394 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20400 (26767) 18.9% (24.7%) 130.8 3.39sec 92165 52675 0 0 0 0.0% 0.0% 0.0% 0.0% 294.0 26122 54180 31261 18.3% 0.0% 47.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.83 130.83 293.98 293.98 1.7497 0.7198 9190098.85 9190098.85 0.00 52675.24 52675.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 240.1 81.68% 26122.43 23869 37691 26129.00 25604 26698 6272872 6272872 0.00
crit 53.8 18.32% 54180.11 49170 77644 54196.33 51370 57940 2917227 2917227 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6367 5.9% 92.0 4.79sec 31164 0 26060 54040 31179 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.04 91.99 0.00 0.00 0.0000 0.0000 2868211.87 2868211.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.16 81.71% 26059.68 23869 37691 26066.14 25075 27356 1958718 1958718 0.00
crit 16.83 18.29% 54039.95 49170 77644 54055.44 49408 61523 909494 909494 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 9979 9.2% 37.7 11.50sec 119255 103223 99629 206481 119255 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.69 0.00 0.00 1.1553 0.0000 4494840.10 4494840.10 0.00 103222.88 103222.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.77 81.63% 99628.83 90737 144415 99649.47 92804 108960 3065400 3065400 0.00
crit 6.92 18.37% 206480.81 186918 297495 206279.97 0 261068 1429440 1429440 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4378 4.0% 14.9 5.50sec 132078 113200 110049 228053 132078 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.94 14.94 0.00 0.00 1.1668 0.0000 1972733.85 1972733.85 0.00 113199.85 113199.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.15 81.33% 110049.04 87347 138878 110137.68 101754 120069 1336849 1336849 0.00
crit 2.79 18.67% 228053.33 179935 286089 217061.03 0 286089 635885 635885 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10510 (13807) 9.7% (12.8%) 37.2 12.10sec 166985 143307 0 0 0 0.0% 0.0% 0.0% 0.0% 238.5 15241 31545 19829 28.1% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.20 37.20 238.51 238.51 1.1652 1.8620 4729482.18 4729482.18 0.00 12744.64 143307.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.4 71.86% 15241.03 13998 22099 15242.17 14862 15781 2612188 2612188 0.00
crit 67.1 28.14% 31545.07 28835 45524 31549.58 30100 33300 2117294 2117294 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3296 3.0% 74.6 5.96sec 19888 0 15305 31652 19900 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.57 74.52 0.00 0.00 0.0000 0.0000 1483032.71 1483032.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.57 71.89% 15305.12 13998 22099 15307.63 14586 16124 819950 819950 0.00
crit 20.95 28.11% 31651.53 28835 45524 31657.03 29228 35019 663083 663083 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 2.94 0.00 0.00 1.0407 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3851 3.6% 77.9 5.72sec 22265 0 19108 38484 22644 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.88 76.58 0.00 0.00 0.0000 0.0000 1733962.07 1733962.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.60 81.75% 19107.92 17405 27698 19111.01 18242 20027 1196220 1196220 0.00
crit 13.97 18.25% 38484.40 34811 55396 38498.04 34811 44500 537742 537742 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8798 (11556) 8.1% (10.7%) 23.1 19.75sec 225561 194447 0 0 0 0.0% 0.0% 0.0% 0.0% 193.1 17161 35593 20525 18.3% 0.0% 93.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.08 23.08 193.09 193.09 1.1600 2.1863 3963286.00 3963286.00 0.00 11595.75 194446.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.8 81.75% 17161.38 15681 25120 17162.85 16612 17740 2708898 2708898 0.00
crit 35.2 18.25% 35592.96 32302 51748 35598.44 33290 38837 1254388 1254388 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2758 2.5% 60.3 7.34sec 20598 0 17233 35721 20611 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.31 60.27 0.00 0.00 0.0000 0.0000 1242242.30 1242242.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.26 81.73% 17232.92 15681 25120 17234.91 16406 18310 848856 848856 0.00
crit 11.01 18.27% 35721.15 32302 51748 35722.70 0 44998 393387 393387 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 68428 / 5339
melee 68428 4.9% 39.7 9.41sec 60004 71070 52544 106304 60004 19.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.67 39.67 0.00 0.00 0.8443 0.0000 2380418.72 2380418.72 0.00 71070.00 71070.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.34 56.31% 52543.56 39622 62482 52557.15 48424 57705 1173757 1173757 0.00
crit 7.81 19.69% 106304.27 79243 124963 106306.39 0 124963 830452 830452 0.00
glance 9.52 24.00% 39517.47 29716 46861 39524.19 29716 46861 376211 376211 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.84 5.84 0.00 0.00 1.0757 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.63% 11.04%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.59%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.5 0.0 63.4sec 63.4sec 32.80% 32.80%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
glyph_mind_spike 27.5 10.2 16.0sec 11.5sec 32.75% 36.40%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:25.2%
  • glyph_mind_spike_2:7.5%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 415.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.6 0.0 54.7sec 54.7sec 22.73% 22.82%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.0 0.0 52.5sec 52.5sec 29.62% 29.62%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shadow_word_death_reset_cooldown 7.6 0.0 11.3sec 11.3sec 9.77% 48.97%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.8%
surge_of_darkness 34.6 3.4 12.7sec 11.5sec 14.08% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:13.3%
  • surge_of_darkness_2:0.8%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 7.9 0.0 60.9sec 60.8sec 17.38% 17.38%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
twist_of_fate 1.0 128.5 0.0sec 0.6sec 18.09% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.1%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:(null)
  • description:After damaging or healing a target below $s1% health, you deal $123254s1% increased damage and healing for $123254d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
shadowfiend-shadowcrawl 5.8 0.0 74.2sec 74.2sec 83.36% 80.59%

Buff details

  • buff initial source:Priest_Shadow_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T14H
devouring_plague Shadow Orb 18.2 54.6 3.0 3.0 140531.1
halo_damage Mana 11.1 500600.2 45000.0 45000.0 3.3
mind_blast Mana 45.1 405914.8 9000.0 9000.0 13.2
mind_flay Mana 130.8 392500.3 3000.0 3000.0 30.7
shadow_word_death Mana 14.9 116501.4 7800.0 7800.0 16.9
shadow_word_pain Mana 37.2 491092.6 13200.0 13200.0 12.7
vampiric_touch Mana 23.1 207703.2 9000.0 9000.0 25.1
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 511518.61 283.94 28931.75 5.35%
shadowfiend Mana 39.67 252551.77 6366.18 104486.04 29.26%
Shadow Orbs from Mind Blast Shadow Orb 45.10 45.10 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.62 7.62 1.00 0.00 0.00%
Devouring Plague Health Health 200.02 0.00 0.00 2777654.02 100.00%
Vampiric Touch Mana Mana 253.36 1245015.34 4913.99 94342.41 7.04%
Resource RPS-Gain RPS-Loss
Mana 4459.70 4693.28
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 194130.88 58500.00 300000.00
Shadow Orb 1.07 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.3%
shadowfiend-Mana Cap 5.3%
lightwell-Mana Cap 5.3%

Procs

Count Interval
hat_donor 183.9 2.4sec
Shadowy Recall Extra Tick 274.4 1.6sec
Shadowy Apparition Procced 77.9 5.7sec
FDCL Mind Spike proc 38.0 11.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 108237.78
Minimum 100681.78
Maximum 116634.54
Spread ( max - min ) 15952.76
Range [ ( max - min ) / 2 * 100% ] 7.37%
Standard Deviation 2112.8413
5th Percentile 104928.23
95th Percentile 111886.40
( 95th Percentile - 5th Percentile ) 6958.16
Mean Distribution
Standard Deviation 21.1326
95.00% Confidence Intervall ( 108196.36 - 108279.20 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1463
0.1 Scale Factor Error with Delta=300 38108
0.05 Scale Factor Error with Delta=300 152432
0.01 Scale Factor Error with Delta=300 3810811
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 108237.78

Damage

Sample Data
Count 9996
Mean 46341831.43

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 269.80
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 7.90 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 18.21 devouring_plague,if=shadow_orb=3
B 2.99 berserking
C 45.54 mind_blast,if=num_targets<=4&cooldown_react
D 37.69 mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E 18.31 shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F 14.94 shadow_word_death,if=num_targets<=4
G 23.34 vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H 11.12 halo_damage
I 2.94 shadowfiend,if=cooldown_react
J 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=2
K 66.92 mind_flay,chain=1,interrupt=1
L 0.00 shadow_word_death,moving=1
M 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N 18.89 shadow_word_pain,moving=1
O 0.00 dispersion

Sample Sequence

8ABCEGHIKCKDKGKCADDEKCKDGKCKEHDNNNCADGK8KCKDKDCEDGKCAKHDKCGEKCKCADEGKC8KDKHNNNNNNNCGKCAKDKECGKCKHKCAEGBK8KCIKCKEGKDCADDHKCNDNNNGCKCAKGKE8CKDDDHKCDDDGKCADDDEKCKDKGKCDDKEKCADDHGKNNNN8NNCKDDKGCKCAEKGCHKDDDCEKCAGKFBFCK8KIDEFACFGKHDKCFAFKECGFFKDKCAFFK9DCEFAFGHKCKDF8FKDCADEFFGKCKFAFK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21147 18775 17679
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35789 27206 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Average Item Level: 508.25
Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160spi_160int_120haste
Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Finger1 watersoul_signet,id=90511
Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T14H"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=shadowform
actions+=/use_item,name=guardian_serpent_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/devouring_plague,if=shadow_orb=3
actions+=/berserking
actions+=/mind_blast,if=num_targets<=4&cooldown_react
actions+=/mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/halo_damage
actions+=/shadowfiend,if=cooldown_react
actions+=/mind_sear,chain=1,interrupt=1,if=num_targets>=2
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160spi_160int_120haste
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17679
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Rogue_Assassination_T14H : 111539 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
111539.3 111539.3 54.70 / 0.05% 4562 / 4.1% 6035.5 18.5 18.2 Energy 44.96% 37.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
Glyphs
  • vendetta

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:96383|79934|67654|60273|50914|31791|15882|13157|6594&chds=0,192765&chco=ABD473,C79C6E,C79C6E,C55D54,C79C6E,9482C9,9482C9,C79C6E,C79C6E&chm=t++96383++envenom,ABD473,0,0,15|t++79934++ambush,C79C6E,1,0,15|t++67654++dispatch,C79C6E,2,0,15|t++60273++rupture,C55D54,3,0,15|t++50914++mutilate,C79C6E,4,0,15|t++31791++shadow_blade,9482C9,5,0,15|t++15882++shadow_blade_offhand,9482C9,6,0,15|t++13157++melee_main_hand,C79C6E,7,0,15|t++6594++melee_off_hand,C79C6E,8,0,15&chtt=Rogue_Assassination_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,12,12,12,10,9,5,5,4,3,2,2,1&chds=0,100&chdls=ffffff&chco=ABD473,ABD473,ABD473,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,9482C9,C55D54,C79C6E,9482C9,C79C6E&chl=deadly_poison_instant|venomous_wound|deadly_poison_dot|dispatch|envenom|melee_main_hand|mutilate_mh|melee_off_hand|shadow_blade|rupture|mutilate_oh|shadow_blade_offhand|ambush&chtt=Rogue_Assassination_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wxyz010112134567664300zywvttrqoommljhgdcaYXXWXWWVVUUTTTTTVVXYZabaaaaaaababbbaaZaZZYYXYXXWWWWWWWWVWWWVWVWVVVWVWWWVWVWWXXYYYXXWVUVWXXYZaabaaZaZabcdeeffeccbaaZZZYYYXXXWWWWVWWWWXXXXXYYZZaabbccdeeffffffgfffffffecbaZXWVVVWWWVVUUTTTTTUVWWXYYYXXYYYZZZabcbccddeeffgggfgfgffffefeedccbbbaaZaZZYYXXXXXXWWVUTSRRRSSTTTUUUUUVVWXYZabcdcccbbbbbbbbbbbbbaaaaaaaaaaaaZZZZZZZZZabbcdeefgghiijklmnoopqqqqqqrrqqqpponmlkjihggfedcbbaaaZZZZZZZZZZZZaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaabbccdddeeefffgghhiijjjjjjjjkkkkkkjjjiihhggffeddccbaaaZZZZZZZZZYYYYYXYYXYY&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=111539|max=234395&chxp=1,1,48,100&chtt=Rogue_Assassination_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,4,2,4,6,17,34,34,61,71,120,154,184,258,339,388,515,526,556,618,640,615,645,622,582,517,450,406,378,280,224,185,142,108,82,58,45,37,18,27,15,9,12,2,1,1,1,1,0,1&chds=0,645&chbh=5&chxt=x&chxl=0:|min=101748|avg=111539|max=124091&chxp=0,1,44,100&chtt=Rogue_Assassination_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.9,16.0,11.1,5.4,1.1,1.0,0.5,0.2,45.0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,ABD473,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=dispatch 89.8s|mutilate 71.9s|envenom 50.2s|rupture 24.2s|ambush 4.7s|vendetta 4.4s|preparation 2.1s|slice_and_dice 1.0s|waiting 202.6s&chtt=Rogue_Assassination_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Assassination_T14H 111539
ambush 848 0.8% 4.6 130.99sec 82846 79934 60955 128481 82846 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.57 4.57 0.00 0.00 1.0364 0.0000 378806.54 378806.54 0.00 79933.86 79933.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.09 67.57% 60955.02 52491 92884 60326.93 0 92884 188335 188335 0.00
crit 1.48 32.42% 128480.63 108131 191340 104880.58 0 191340 190472 190472 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
berserking 0 0.0% 3.0 180.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 13657 12.3% 535.5 1.07sec 11485 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.5 29933 63459 41130 33.4% 0.0% 99.6%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 535.53 535.53 149.54 149.54 0.0000 3.0000 6150444.83 6150444.83 0.00 13710.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 535.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.6 66.60% 29932.51 24256 55024 29938.39 28306 31698 2981084 2981084 0.00
crit 49.9 33.40% 63459.20 49967 113348 63498.94 58112 71761 3169360 3169360 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 25457 22.8% 534.5 1.07sec 21439 0 15531 33030 21439 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 534.53 534.53 0.00 0.00 0.0000 0.0000 11459708.11 11459708.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 354.04 66.23% 15531.03 12428 28181 15537.52 14805 16383 5498603 5498603 0.00
crit 180.48 33.76% 33029.83 25603 58052 33050.67 31053 35767 5961105 5961105 0.00
miss 0.01 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
dispatch 13497 12.1% 86.6 5.11sec 70123 67654 51383 107446 70123 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.60 86.60 0.00 0.00 1.0365 0.0000 6072935.20 6072935.20 0.00 67653.71 67653.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.65 66.57% 51383.21 44183 81091 51384.50 47770 55730 2962214 2962214 0.00
crit 28.95 33.43% 107445.64 91016 167048 107475.37 97971 121817 3110721 3110721 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispatch

Static Values
  • id:111240
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:111240
  • name:Dispatch
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that exploits the vulnerability of foes with less than 35% health remaining, causing $m2% weapon damage plus $m1 to the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:486.06
  • base_dd_max:486.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.00
envenom 10755 9.6% 48.4 9.19sec 99900 96383 72036 153885 99900 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.43 48.43 0.00 0.00 1.0365 0.0000 4838017.70 4838017.70 0.00 96382.53 96382.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.94 65.95% 72035.94 28950 139672 72033.43 62131 82406 2300776 2300776 0.00
crit 16.49 34.05% 153885.14 55545 287725 154015.67 125305 202655 2537242 2537242 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4&action.envenom_hot.ticks_remain<2
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.560000
  • base_dd_min:400.06
  • base_dd_max:400.06
melee_main_hand 10175 9.1% 330.6 1.36sec 13890 13157 12392 26275 13890 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 330.59 330.59 0.00 0.00 1.0557 0.0000 4591793.32 4591793.32 0.00 13156.96 13156.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.89 24.17% 12391.79 10924 20356 12391.45 11756 13222 990035 990035 0.00
crit 108.55 32.83% 26274.93 22503 41933 26282.33 25052 28289 2852112 2852112 0.00
glance 79.32 23.99% 9450.35 8193 15267 9451.61 8966 10114 749646 749646 0.00
miss 62.83 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 5104 4.6% 330.4 1.36sec 6972 6594 6217 13193 6972 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 330.35 330.35 0.00 0.00 1.0574 0.0000 2303363.73 2303363.73 0.00 6593.81 6593.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.67 24.12% 6216.55 5462 10178 6216.23 5891 6603 495292 495292 0.00
crit 108.51 32.85% 13192.85 11251 20967 13196.41 12565 14026 1431571 1431571 0.00
glance 79.39 24.03% 4742.56 4096 7633 4743.12 4498 5083 376501 376501 0.00
miss 62.78 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 0 (8133) 0.0% (7.3%) 69.4 4.27sec 52772 50914 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.40 69.40 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 50913.90 50913.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards $s1 combo $lpoint:points;.
mutilate_mh 5393 4.8% 69.4 4.27sec 34991 0 25436 53900 34991 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.40 69.40 0.00 0.00 0.0000 0.0000 2428324.28 2428324.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.10 66.43% 25436.47 21645 39905 25442.70 23946 27034 1172717 1172717 0.00
crit 23.30 33.57% 53900.04 44590 82204 53946.89 48523 61478 1255608 1255608 0.00
DPS Timeline Chart

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
mutilate_oh 2741 2.5% 69.4 4.27sec 17782 0 12927 27391 17782 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.40 69.40 0.00 0.00 0.0000 0.0000 1234065.57 1234065.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.10 66.43% 12926.85 11012 20224 12929.79 12117 13760 595963 595963 0.00
crit 23.30 33.57% 27390.92 22684 41662 27413.57 24553 30763 638102 638102 0.00
DPS Timeline Chart

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
preparation 0 0.0% 2.0 300.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0362 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 3242 2.9% 23.4 19.51sec 62474 60273 0 0 0 0.0% 0.0% 0.0% 0.0% 220.8 4802 10152 6611 33.8% 0.0% 98.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.37 23.37 220.82 220.82 1.0365 2.0000 1459883.67 1459883.67 0.00 3133.75 60273.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.1 66.18% 4801.99 1822 8816 4803.72 4202 5371 701755 701755 0.00
crit 74.7 33.82% 10151.59 3753 18161 10156.45 8850 11617 758128 758128 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2|(combo_points=5&ticks_remain<3)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 4605 4.1% 69.2 5.42sec 29774 31791 21096 44235 29774 37.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.22 69.22 0.00 0.00 0.9366 0.0000 2061031.50 2061031.50 0.00 31791.32 31791.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.26 62.49% 21095.89 16239 30261 21076.32 18410 23104 912513 912513 0.00
crit 25.96 37.51% 44235.39 33453 62338 44162.12 36665 50414 1148518 1148518 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 2294 2.0% 68.9 5.44sec 14900 15882 10562 22120 14900 37.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.92 68.92 0.00 0.00 0.9382 0.0000 1026894.79 1026894.79 0.00 15882.19 15882.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.05 62.47% 10562.40 8120 15131 10551.22 9226 11727 454734 454734 0.00
crit 25.87 37.53% 22120.42 16726 31169 22085.54 18167 24972 572161 572161 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 2.9 180.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
slice_and_dice 0 0.0% 1.0 309.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0356 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.down
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 14.8 31.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.77 14.77 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.2 105.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
vendetta 0 0.0% 4.3 120.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
venomous_wound 13772 12.4% 165.7 2.69sec 37436 0 27262 57749 37436 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.68 165.68 0.00 0.00 0.0000 0.0000 6202389.72 6202389.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.39 66.63% 27262.16 22192 50069 27268.65 25656 28902 3009371 3009371 0.00
crit 55.29 33.37% 57748.70 45715 103143 57779.40 52540 63690 3193019 3193019 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:79136
  • name:Venomous Wound
  • school:nature
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.160000
  • base_dd_min:685.46
  • base_dd_max:685.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.5sec 180.5sec 6.67% 7.40%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
blindside 20.8 0.0 13.9sec 13.9sec 9.45% 9.45%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_blindside
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • blindside_1:9.5%

Spelldata details

  • id:121153
  • name:Blindside
  • tooltip:You may use Dispatch with no cost, regardless of your enemy target's health.
  • description:$@spelldesc121152
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 9.79%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.6 7.3 38.1sec 22.8sec 39.67% 39.65%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:39.7%
dancing_steel_oh 10.6 5.6 41.0sec 26.0sec 34.94% 35.86%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:34.9%
envenom 33.3 15.1 13.4sec 9.2sec 58.01% 61.81%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • envenom_1:58.0%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
  • max_stacks:
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.7 0.0 61.8sec 61.8sec 25.30% 25.30%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.3%
shadow_blades 2.9 0.0 180.8sec 180.8sec 15.30% 15.72%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:15.3%
slice_and_dice 1.0 48.4 323.6sec 9.1sec 99.77% 99.85%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.8%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
synapse_springs_2 8.0 0.0 60.4sec 60.4sec 17.50% 17.50%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
terror_in_the_mists 7.6 0.0 63.2sec 63.2sec 32.94% 32.94%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.9%
tricks_of_the_trade 14.8 0.0 31.2sec 31.2sec 19.52% 100.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.5%
tricks_of_the_trade_trigger 14.8 0.0 31.2sec 31.2sec 1.60% 1.60%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.6%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.2 0.0 105.3sec 105.3sec 0.41% 0.41%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • vanish_1:0.4%
virmens_bite_potion 2.0 0.0 414.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T14H
dispatch Energy 86.6 1976.3 22.8 22.8 3072.9
envenom Energy 48.4 1695.0 35.0 35.0 2854.3
mutilate Energy 69.4 3817.0 55.0 55.0 959.5
rupture Energy 23.4 584.2 25.0 25.0 2499.0
slice_and_dice Energy 1.0 25.0 25.0 25.0 0.0
tricks_of_the_trade Energy 14.8 221.3 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.50 4948.85 2.75 61.24 1.22%
energy_refund Energy 0.01 0.18 30.41 0.00 0.00%
relentless_strikes Energy 65.07 1626.81 25.00 0.00 0.00%
venomous_vim Energy 165.68 1643.55 9.92 13.27 0.80%
Resource RPS-Gain RPS-Loss
Energy 18.25 18.47
Combat End Resource Mean Min Max
Health 457343.00 457343.00 457343.00
Energy 20.52 0.02 57.40
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.1%

Procs

Count Interval
hat_donor 168.2 2.8sec
seal_fate 68.8 6.5sec
venomous_wounds 165.7 2.7sec
no_revealing_strike 537.8 1.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 111539.34
Minimum 101748.24
Maximum 124091.40
Spread ( max - min ) 22343.16
Range [ ( max - min ) / 2 * 100% ] 10.02%
Standard Deviation 2790.4484
5th Percentile 107096.28
95th Percentile 116220.79
( 95th Percentile - 5th Percentile ) 9124.52
Mean Distribution
Standard Deviation 27.9101
95.00% Confidence Intervall ( 111484.63 - 111594.04 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2404
0.1 Scale Factor Error with Delta=300 66470
0.05 Scale Factor Error with Delta=300 265883
0.01 Scale Factor Error with Delta=300 6647091
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 111539.34

Damage

Sample Data
Count 9996
Mean 50207658.98

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 282.07
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 8.57 auto_attack
9 0.00 kick
A 7.96 use_item,name=gloves_of_the_thousandfold_blades
B 3.01 berserking
C 4.18 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 4.57 ambush
E 2.93 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
F 1.00 slice_and_dice,if=buff.slice_and_dice.down
G 0.61 dispatch,if=dot.rupture.ticks_remain<2&energy>90
H 2.09 mutilate,if=dot.rupture.ticks_remain<2&energy>90
I 23.37 rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
J 4.28 vendetta
K 39.99 envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
L 8.44 envenom,if=combo_points>4
M 0.00 envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
N 85.99 dispatch,if=combo_points<5
O 14.77 tricks_of_the_trade
P 67.31 mutilate

Sample Sequence

8ABDFHIJOPNKEPNLPPIPKNPLPNLPLNC8D7C8DLOPNIPPKN8PKPNPLNPAIPKOPPKPPKPIPNKPOPIPNKPPKPNAKPNJIPNO8PKPPIPKNPKPPOKNPIPPKPPBKAPPNIEPOKPNLPLNPLPINPCO8KPNPLPLNPIPPNAKPJNKPOIPPNKPPIPNKPPKNOPNKPPINNNNA8KNNNNKNNNINONNNNKNNN7C8DKNNINNNNOKNNNKNNBIANNJNNKENNLNNOKNNINNNKNNLNNNKNNNO6INNNNKNNANNNKNINNNOINNNN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 120 120 0
Spell Power 0 0 0
Spell Hit 15.03% 15.03% 2549
Spell Crit 12.99% 7.99% 4786
Spell Haste 12.28% 6.93% 2945
Mana Per 5 0 0 0
Attack Power 47874 38727 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 29.81% 22.91% 4786
Melee Haste 6.93% 6.93% 2945
Swing Speed 17.62% 6.93% 2945
Expertise 7.53% / 7.53% 7.53% / 7.53% 2560
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 75.88% 58.38% 5208

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi
Neck choker_of_the_unleashed_storm,id=86953
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_exp
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi,reforge=haste_mastery
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_hit
Hands gloves_of_the_thousandfold_blades,id=87125,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=exp_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit
Main Hand spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=exp_hit
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_hit
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Assassination_T14H"
origin="unknown"
level=90
race=troll
spec=assassination
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
glyphs=vendetta

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=gloves_of_the_thousandfold_blades
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/dispatch,if=dot.rupture.ticks_remain<2&energy>90
actions+=/mutilate,if=dot.rupture.ticks_remain<2&energy>90
actions+=/rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
actions+=/vendetta
actions+=/envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
actions+=/envenom,if=combo_points>4
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/dispatch,if=combo_points<5
actions+=/tricks_of_the_trade
actions+=/mutilate

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi
neck=choker_of_the_unleashed_storm,id=86953
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_hit
hands=gloves_of_the_thousandfold_blades,id=87125,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_exp
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=exp_hit
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_hit

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2560
# gear_hit_rating=2549
# gear_crit_rating=4786
# gear_haste_rating=2945
# gear_mastery_rating=5208
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gloves_of_the_thousandfold_blades,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Combat_T14H : 104752 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
104751.6 104751.6 55.89 / 0.05% 4678 / 4.5% 4515.2 23.2 23.0 Energy 35.13% 44.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
Glyphs
  • adrenaline_rush

Charts

http://3.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:155547|140847|126622|86218|42577|34465|32462|29479|15730|13622&chds=0,311094&chco=C79C6E,C55D54,C79C6E,C79C6E,C79C6E,9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++155547++killing_spree,C79C6E,0,0,15|t++140847++rupture,C55D54,1,0,15|t++126622++eviscerate,C79C6E,2,0,15|t++86218++ambush,C79C6E,3,0,15|t++42577++sinister_strike,C79C6E,4,0,15|t++34465++shadow_blade,9482C9,5,0,15|t++32462++revealing_strike,C79C6E,6,0,15|t++29479++shadow_blade_offhand,9482C9,7,0,15|t++15730++melee_main_hand,C79C6E,8,0,15|t++13622++melee_off_hand,C79C6E,9,0,15&chtt=Rogue_Combat_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,12,11,10,10,9,9,6,5,4,3,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473,9482C9,9482C9,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|main_gauche|melee_main_hand|deadly_poison_instant|melee_off_hand|eviscerate|deadly_poison_dot|shadow_blade|shadow_blade_offhand|killing_spree_mh|rupture|killing_spree_oh|revealing_strike|ambush&chtt=Rogue_Combat_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:7434221zyyyy01331ywwvwxyzzzzzzxxwvurpmjgebZXWUTTVWXYYYYYabdeghjjkkkjigedccbbaZZYXWWVVUUUUUUUVWWXYZabcefghiklmnnnnooooonnljhfdcaZYXWWWVVUTTTSSTUVWXYZZZZYYYYXXXWWWVVVVUVUUUTTUUUUVWXYZbdeghjkmnoqrrsstttttssqqnljgecaYYXXWWVVUTTTSSTUVXXZaaaaZZZZZZZZaaaaaaaaaaaaabaabbbbbbbbbccccddddddeddddcdccdcbaYXVUTSTTTTUUVVVWWXYZbdegijkkkkkkkjjjiihggfeeddccbbaaZZZYYYYYYYZZZZaaaaabbbbbbbccccccccccccddeeffghhiijjkkllllllllkkkjiihggffeddccbbbaaaaaaaabbbbbbbbbbbbccccccccccccccccccccccccddddddeeeeefffffgggghhhhhhiiiiiiiiiiiiiiiiiijjjjjjjjjiiihhggffeeddccbbaZYYYXXXXXWWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=104752|max=207539&chxp=1,1,50,100&chtt=Rogue_Combat_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,3,8,13,14,21,39,44,70,103,125,177,220,285,373,423,467,496,578,622,626,610,633,560,554,495,404,406,331,267,236,181,146,141,71,74,44,38,23,23,17,11,7,8,2,1,0,1,1&chds=0,633&chbh=5&chxt=x&chxl=0:|min=94822|avg=104752|max=116730&chxp=0,1,45,100&chtt=Rogue_Combat_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:40.1,7.4,5.6,4.4,3.5,2.3,1.2,0.5,35.1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,ffffff&chl=sinister_strike 180.6s|eviscerate 33.2s|revealing_strike 25.4s|killing_spree 19.7s|slice_and_dice 15.7s|rupture 10.5s|ambush 5.4s|preparation 2.1s|waiting 158.2s&chtt=Rogue_Combat_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Combat_T14H 104752
adrenaline_rush 0 0.0% 5.1 93.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.08 5.08 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<35
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
ambush 1051 1.0% 5.3 107.36sec 89359 86218 63488 132011 89359 37.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.25 5.25 0.00 0.00 1.0364 0.0000 469456.31 469456.31 0.00 86217.87 86217.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.27 62.25% 63488.01 47302 128140 62993.43 0 110854 207613 207613 0.00
crit 1.98 37.75% 132011.36 97443 254875 121479.57 0 253390 261844 261844 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.25
berserking 0 0.0% 3.0 180.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 8968 8.6% 339.7 1.42sec 11889 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.3 19936 41937 27048 32.3% 0.0% 99.4%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 339.70 339.70 149.31 149.31 0.0000 3.0000 4038710.86 4038710.86 0.00 9016.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 339.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.0 67.67% 19936.10 14169 47478 19940.34 18685 21528 2014452 2014452 0.00
crit 48.3 32.33% 41936.86 29189 97805 41953.63 37752 47491 2024259 2024259 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 10908 10.4% 338.5 1.42sec 14512 0 10645 22485 14512 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 338.54 338.54 0.00 0.00 0.0000 0.0000 4912703.75 4912703.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 227.98 67.34% 10644.68 7259 24523 10647.46 9895 11484 2426740 2426740 0.00
crit 110.56 32.66% 22485.30 14953 50517 22494.89 20398 25147 2485964 2485964 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 9349 8.9% 34.9 12.61sec 120563 126622 89556 186957 120563 31.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.90 34.90 0.00 0.00 0.9521 0.0000 4207533.34 4207533.34 0.00 126622.33 126622.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.79 68.17% 89555.96 46249 196260 89549.28 80744 100355 2130448 2130448 0.00
crit 11.11 31.83% 186957.30 95272 404296 186990.50 154960 247440 2077085 2077085 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&buff.deep_insight.up
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
killing_spree 0 (6813) 0.0% (6.5%) 7.2 65.68sec 423573 155547 0 0 0 0.0% 0.0% 0.0% 0.0% 50.1 0 0 0 34.0% 0.0% 4.0%

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.24 7.24 50.08 50.08 2.7231 0.3573 0.00 0.00 0.00 155546.93 155546.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.1 66.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 17.0 34.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every $t1 sec with both weapons until 7 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 4240 4.0% 50.1 8.42sec 38128 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 27599 57900 38128 34.7% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.08 0.00 0.00 50.08 0.0000 0.0000 1909614.24 1909614.24 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.7 65.25% 27599.45 14718 42456 27587.49 23961 33984 901966 901966 0.00
crit 17.4 34.75% 57900.32 30320 87460 57853.48 47258 70822 1007649 1007649 0.00
DPS Timeline Chart

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 2573 2.5% 50.1 8.42sec 23135 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 16726 35075 23135 34.9% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.08 0.00 0.00 50.08 0.0000 0.0000 1158704.48 1158704.48 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.6 65.07% 16725.65 8916 25719 16718.29 14242 19835 545073 545073 0.00
crit 17.5 34.93% 35075.29 18367 52982 35046.66 27186 43949 613632 613632 0.00
DPS Timeline Chart

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 13079 12.5% 185.2 2.43sec 31816 0 23443 49096 31816 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.16 185.16 0.00 0.00 0.0000 0.0000 5891085.47 5891085.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.72 67.36% 23443.27 16937 48451 23445.44 21909 25192 2923953 2923953 0.00
crit 60.43 32.64% 49096.29 34891 99808 49106.43 44457 54610 2967133 2967133 0.00
DPS Timeline Chart

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:(null)
  • description:A vicious attack that deals damage equal to $86392s2% of a main-hand attack.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
melee_main_hand 11435 10.9% 238.1 1.89sec 21644 15730 19408 40978 21644 32.6% 19.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.12 238.12 0.00 0.00 1.3760 0.0000 5153940.31 5153940.31 0.00 15730.31 15730.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.86 24.30% 19408.06 14718 42216 19410.27 17920 21588 1122887 1122887 0.00
crit 77.71 32.64% 40978.12 30320 86965 40992.80 38129 44428 3184479 3184479 0.00
glance 57.32 24.07% 14768.80 11039 31842 14772.73 13608 16408 846575 846575 0.00
miss 45.23 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 10020 9.6% 345.3 1.30sec 13081 13622 11724 24758 13081 32.7% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 345.33 345.33 0.00 0.00 0.9602 0.0000 4517111.97 4517111.97 0.00 13622.05 13622.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.01 24.33% 11724.25 8916 25719 11724.89 10923 12724 984965 984965 0.00
crit 112.85 32.68% 24757.91 18367 52982 24766.34 23451 26586 2793904 2793904 0.00
glance 82.79 23.97% 8917.00 6687 19180 8919.03 8216 9679 738243 738243 0.00
miss 65.68 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
preparation 0 0.0% 2.0 301.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0366 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
revealing_strike 1830 1.7% 25.3 18.11sec 32635 32462 24147 50319 32635 32.4% 0.0% 0.0% 0.0% 147.5 0 0 0 32.3% 0.0% 98.2%

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.26 25.26 147.48 147.48 1.0053 3.0000 824362.62 824362.62 0.00 1762.13 32461.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.07 67.57% 24146.94 18398 50930 24145.13 21479 27933 412148 412148 0.00
crit 8.19 32.43% 50318.70 37900 108706 50326.79 0 79459 412215 412215 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.9 67.72% 0.00 0 0 0.00 0 0 0 0 0.00
crit 47.6 32.28% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:anticipation_charges<5&ticks_remain<2
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals a weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a $h% chance to generate an extra combo point.
  • description:An instant strike that deals $m1% weapon damage and exposes the target's vulnerabilities, increasing the effectiveness of your offensive finishing moves on that target by $s3%, and giving your Sinister Strikes a $h% chance to generate an extra combo point, for $d. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 3265 3.1% 10.6 41.37sec 138497 140847 0 0 0 0.0% 0.0% 0.0% 0.0% 126.1 8670 18059 11680 32.1% 0.0% 56.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.63 10.63 126.06 126.06 0.9833 2.0000 1472270.76 1472270.76 0.00 5607.28 140846.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.7 67.95% 8669.97 5548 18054 8670.05 7740 10178 742596 742596 0.00
crit 40.4 32.05% 18059.35 11428 37191 18052.53 15952 22374 729675 729675 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 5834 5.6% 65.9 6.07sec 39830 34465 29835 61796 39830 31.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.91 65.91 0.00 0.00 1.1557 0.0000 2625257.30 2625257.30 0.00 34464.86 34464.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.30 68.73% 29835.24 21881 62759 29817.53 26600 33297 1351516 1351516 0.00
crit 20.61 31.27% 61796.26 45074 130020 61719.45 53559 73118 1273741 1273741 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 5130 4.9% 95.6 4.17sec 24153 29479 18062 37455 24153 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.58 95.58 0.00 0.00 0.8193 0.0000 2308539.18 2308539.18 0.00 29479.49 29479.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.56 68.59% 18062.23 13255 38235 18050.30 16262 19787 1184224 1184224 0.00
crit 30.02 31.41% 37455.33 27305 76034 37409.34 32588 43667 1124316 1124316 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 5.0 95.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.98 4.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
sinister_strike 17070 16.3% 183.4 2.44sec 41914 42577 31040 64678 41914 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.43 183.43 0.00 0.00 0.9844 0.0000 7688284.14 7688284.14 0.00 42577.15 42577.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.14 67.67% 31040.47 23798 67542 31043.45 29935 32369 3853247 3853247 0.00
crit 59.29 32.33% 64677.87 49023 139137 64693.85 59828 69763 3835037 3835037 0.00
DPS Timeline Chart

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45
slice_and_dice 0 0.0% 15.5 29.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.52 15.52 0.00 0.00 1.0106 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.remains<2
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 15.0 30.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 15.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Combat_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.3 107.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 4.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.1 0.0 93.2sec 93.2sec 16.63% 23.08%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:16.6%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
berserking 3.0 0.0 180.5sec 180.5sec 6.67% 6.73%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.74%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 12.9 11.8 34.9sec 17.8sec 47.64% 48.68%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:47.6%
dancing_steel_oh 9.8 4.5 44.6sec 29.7sec 31.20% 32.51%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:31.2%
deep_insight 10.9 0.0 41.3sec 41.3sec 35.68% 38.87%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • deep_insight_1:35.7%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
killing_spree 7.2 0.0 65.8sec 65.8sec 4.81% 11.70%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • killing_spree_1:4.8%

Spelldata details

  • id:61851
  • name:Killing Spree
  • tooltip:(null)
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
  • max_stacks:
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
moderate_insight 11.1 0.0 40.9sec 40.9sec 21.52% 20.69%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.5%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.7 0.0 62.1sec 62.1sec 25.19% 25.19%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.2%
shadow_blades 5.0 0.0 95.6sec 95.6sec 19.55% 22.95%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:19.6%
shallow_insight 11.4 0.0 40.9sec 40.9sec 23.94% 20.14%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:23.9%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
slice_and_dice 1.2 14.3 253.7sec 29.8sec 99.74% 99.83%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.7%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
synapse_springs_2 8.0 0.0 60.5sec 60.5sec 17.48% 17.48%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
terror_in_the_mists 7.6 0.0 63.5sec 63.5sec 32.83% 32.83%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tricks_of_the_trade 15.0 0.0 30.8sec 30.8sec 19.89% 100.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.9%
tricks_of_the_trade_trigger 15.0 0.0 30.8sec 30.8sec 1.81% 1.81%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.8%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.3 0.0 107.5sec 107.5sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
virmens_bite_potion 2.0 0.0 414.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Combat_T14H
eviscerate Energy 34.9 1221.5 35.0 35.0 3444.7
revealing_strike Energy 25.3 1010.4 40.0 40.0 815.9
rupture Energy 10.6 265.8 25.0 25.0 5539.9
sinister_strike Energy 183.4 7337.2 40.0 40.0 1047.8
slice_and_dice Energy 15.5 388.1 25.0 25.0 0.0
tricks_of_the_trade Energy 15.0 225.6 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.50 6239.82 3.46 193.37 3.01%
adrenaline_rush Energy 299.70 1058.35 3.53 34.14 3.12%
combat_potency Energy 109.09 1609.45 14.75 26.96 1.65%
relentless_strikes Energy 58.70 1467.50 25.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 23.03 23.19
Combat End Resource Mean Min Max
Health 457329.00 457329.00 457329.00
Energy 26.50 0.02 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.8%

Procs

Count Interval
hat_donor 220.5 2.2sec
main_gauche 185.2 2.4sec
no_revealing_strike 2.5 119.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 104751.55
Minimum 94822.31
Maximum 116729.89
Spread ( max - min ) 21907.58
Range [ ( max - min ) / 2 * 100% ] 10.46%
Standard Deviation 2850.8007
5th Percentile 100237.24
95th Percentile 109592.45
( 95th Percentile - 5th Percentile ) 9355.21
Mean Distribution
Standard Deviation 28.5137
95.00% Confidence Intervall ( 104695.67 - 104807.44 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2845
0.1 Scale Factor Error with Delta=300 69377
0.05 Scale Factor Error with Delta=300 277509
0.01 Scale Factor Error with Delta=300 6937729
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 104751.55

Damage

Sample Data
Count 9996
Mean 47177574.75

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 334.81
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 9.25 auto_attack
9 0.00 kick
A 7.95 use_item,name=bonebreaker_gauntlets
B 3.01 berserking
C 4.25 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 5.25 ambush
E 15.52 slice_and_dice,if=buff.slice_and_dice.remains<2
F 4.98 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
G 7.24 killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
H 5.08 adrenaline_rush,if=energy<35
I 10.63 rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
J 21.98 eviscerate,if=combo_points=5&buff.deep_insight.up
K 12.92 eviscerate,if=anticipation_charges=5
L 25.26 revealing_strike,if=anticipation_charges<5&ticks_remain<2
M 15.04 tricks_of_the_trade
N 183.43 sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

Sample Sequence

8ABDELMNNGNNNC8D7C8DKNNEFLNHNNIJNNNJNNJNNJNMNNJLNNNNNE8NLNNGNAKNNMINNJLNNNNNNENNLNKMNNNFNHIJNNNJNJLNNJNNGNNAENMLNN8NNNNKNILNNNJNNMENNLNNNNNENNNBLANMIJFNNGNJNHNJLNNNKNNNC8DENNNNKNM8LINNJNNNNJNNLNAENGMNNNNNKLNNNINJNELMNNEFNHNNNKNNLKNNNKNAE8NMNGL7C8DNNKNNNNKNLNNNKMENNNILNNNNBNNALKNMNNENNNGLIFNHJNNJNNNJNNJNNMLNNENN6NNNKLNNAINNJMGNNNLNNENNN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22209 20190 20067
Intellect 130 124 80
Spirit 158 158 80
Health 457329 429063 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2558
Spell Crit 11.78% 6.78% 4059
Spell Haste 20.14% 14.42% 6128
Mana Per 5 0 0 0
Attack Power 59843 48409 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 28.59% 21.69% 4059
Melee Haste 14.42% 14.42% 6128
Swing Speed 25.86% 14.42% 6128
Expertise 7.56% / 7.56% 7.56% / 7.56% 2572
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 35.42% 25.42% 2823

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
Hands bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=mastery_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=crit_haste
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Combat_T14H"
origin="unknown"
level=90
race=troll
spec=combat
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
glyphs=adrenaline_rush

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5&buff.deep_insight.up
actions+=/eviscerate,if=anticipation_charges=5
actions+=/revealing_strike,if=anticipation_charges<5&ticks_remain<2
actions+=/tricks_of_the_trade
actions+=/sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=crit_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20067
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2572
# gear_hit_rating=2558
# gear_crit_rating=4059
# gear_haste_rating=6128
# gear_mastery_rating=2823
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Subtlety_T14H : 115672 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
115672.4 115672.4 50.46 / 0.04% 4237 / 3.7% 5597.3 20.6 20.5 Energy 36.38% 45.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

Charts

http://7.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:184444|167436|117658|73648|63237|43851|22032|19912|9997&chds=0,368889&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,C79C6E,C79C6E&chm=t++184444++rupture,C55D54,0,0,15|t++167436++eviscerate,C79C6E,1,0,15|t++117658++ambush,C79C6E,2,0,15|t++73648++hemorrhage,C79C6E,3,0,15|t++63237++backstab,C79C6E,4,0,15|t++43851++shadow_blade,9482C9,5,0,15|t++22032++shadow_blade_offhand,9482C9,6,0,15|t++19912++melee_main_hand,C79C6E,7,0,15|t++9997++melee_off_hand,C79C6E,8,0,15&chtt=Rogue_Subtlety_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,15,13,9,8,8,7,7,6,3,3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473,C55D54,C79C6E,9482C9,C79C6E,9482C9&chl=eviscerate|backstab|melee_main_hand|deadly_poison_instant|ambush|deadly_poison_dot|rupture|melee_off_hand|shadow_blade|hemorrhage|shadow_blade_offhand&chtt=Rogue_Subtlety_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ww23776677777875431zzzyuspnnmlkiihihfdbaZYXXWWVUUTTSSRSRRSTTUVYabceeeeffgggghhhhhhgedbaYXXXVVUUUUUUUUUUUVUVVUVUUUUUUTTTTSRRQPOOOPRSTUUVWWXXYXYZabbcdcbaYXWWVVUUUUUUUTTUUUUVVVWXXXXXXXYYZbdegijklmnnnnoooooonmkhfcaXVUTSSSSSSSSTTTTUVWXYZaaaZZZYYXXXXYZabbcccdddddeeeffffedcbaZYYXXXXWWWVWVVVVVVUUUTSSRQPOOOOOOOPQSTUVWXYabcefggggggggfddcccccbbbaaaaaaaaaaaZZYYXXXXXXXXXXXYYZbdegijklmnnnooopppponmkihfdcbaZYXWWWVVVVVVUUUUVVVVVVVVVVVVVVWXYZaabbccdddeeffffffeddcbaaZZZYYYXXXXWWWWWVVVVVVVVVVVVVVVVVWXZabccdeeefffgggghhggffeeeeeeeeeeddddddcccbbaZYYXWWVVUTTTTTSSSSSS&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=115672|max=253209&chxp=1,1,46,100&chtt=Rogue_Subtlety_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,8,11,14,24,52,76,95,151,199,271,336,441,432,554,585,703,668,661,601,621,601,489,430,367,326,272,195,186,162,124,84,65,62,44,23,25,12,5,7,4,4,0,1,0,0,0,0,1&chds=0,703&chbh=5&chxt=x&chxl=0:|min=107356|avg=115672|max=128226&chxp=0,1,40,100&chtt=Rogue_Subtlety_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.2,14.2,8.2,4.6,4.5,3.0,0.6,0.5,36.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,FFFFFF,C79C6E,ffffff&chl=backstab 127.1s|eviscerate 63.8s|ambush 37.0s|rupture 20.6s|hemorrhage 20.2s|slice_and_dice 13.3s|pool_resource 2.9s|preparation 2.1s|waiting 163.9s&chtt=Rogue_Subtlety_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Subtlety_T14H 115672
ambush 9680 8.4% 35.7 12.40sec 121952 117658 81658 172896 121952 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.70 35.70 0.00 0.00 1.0365 0.0000 4353353.50 4353353.50 0.00 117658.20 117658.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.93 55.84% 81658.06 49486 115791 81666.51 70726 93047 1627614 1627614 0.00
crit 15.77 44.16% 172895.88 101942 238529 172919.42 146201 201774 2725739 2725739 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=5&anticipation_charges=0
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
backstab 17859 15.4% 122.7 3.65sec 65545 63237 46708 98548 65545 36.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.67 122.67 0.00 0.00 1.0365 0.0000 8040313.55 8040313.55 0.00 63236.86 63236.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.10 63.67% 46708.50 32742 81389 46741.07 44001 49902 3647819 3647819 0.00
crit 44.57 36.33% 98548.46 67449 167662 98630.66 89208 108645 4392495 4392495 0.00
DPS Timeline Chart

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus $m1 to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:382.61
  • base_dd_max:382.61
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
berserking 0 0.0% 2.9 181.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 9581 8.3% 302.8 1.64sec 14252 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.4 20350 42900 28888 37.9% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 302.76 302.76 149.36 149.36 0.0000 3.0000 4314845.55 4314845.55 0.00 9629.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 302.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.8 62.14% 20349.98 14677 33334 20355.41 19238 21530 1888625 1888625 0.00
crit 56.6 37.86% 42899.64 30235 68669 42919.37 40286 45790 2426220 2426220 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 10080 8.7% 301.6 1.64sec 15051 0 10517 22281 15051 38.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 301.56 301.56 0.00 0.00 0.0000 0.0000 4538616.25 4538616.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 185.36 61.47% 10517.46 7519 17070 10522.00 10027 11059 1949468 1949468 0.00
crit 116.20 38.53% 22281.26 15488 35164 22294.05 20996 23726 2589149 2589149 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 23762 20.5% 61.6 7.29sec 173545 167436 118573 257333 173545 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.56 61.56 0.00 0.00 1.0365 0.0000 10683445.52 10683445.52 0.00 167436.38 167436.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.17 60.38% 118572.93 88072 197225 118612.67 106556 132230 4407637 4407637 0.00
crit 24.39 39.62% 257333.36 181428 406284 257682.38 224181 303208 6275809 6275809 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
hemorrhage 3306 2.9% 19.5 23.64sec 76336 73648 29493 62371 41884 37.7% 0.0% 0.0% 0.0% 144.6 3278 6940 4648 37.4% 0.0% 96.3%

Stats details: hemorrhage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.51 19.51 144.61 144.61 1.0365 3.0000 1489240.67 1489240.67 0.00 3279.95 73648.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.16 62.31% 29492.88 20468 49395 29495.77 24948 34036 358538 358538 0.00
crit 7.35 37.69% 62371.42 42164 101754 62445.02 0 86386 458576 458576 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.5 62.59% 3278.18 1331 9679 3278.31 2288 4406 296729 296729 0.00
crit 54.1 37.41% 6940.08 2741 20682 6941.97 4730 10099 375397 375397 0.00
DPS Timeline Chart

Action details: hemorrhage

Static Values
  • id:16511
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<4&(dot.hemorrhage.remains<4|position_front)
Spelldata
  • id:16511
  • name:Hemorrhage
  • school:physical
  • tooltip:(null)
  • description:An instant strike that deals $m2% weapon damage (${$m2*1.45}% if a dagger is equipped)$?s56807[. When used on a target that is bleeding, opens the wound further to deal][, causing profuse bleeding that deals] an additional $s4% of the direct strike's damage over $89775d. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2360.39
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.03
melee_main_hand 15264 13.2% 398.7 1.07sec 17293 19912 14672 31478 17293 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 398.70 398.70 0.00 0.00 0.8685 0.0000 6894855.81 6894855.81 0.00 19912.37 19912.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.74 20.00% 14671.95 10396 25216 14678.22 13647 15929 1169871 1169871 0.00
crit 147.51 37.00% 31477.65 21416 53851 31489.77 29533 34046 4643113 4643113 0.00
glance 95.74 24.01% 11300.01 7797 19606 11304.14 10614 12050 1081872 1081872 0.00
miss 75.72 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 7672 6.7% 399.2 1.07sec 8680 9997 7362 15795 8680 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 399.23 399.23 0.00 0.00 0.8682 0.0000 3465224.32 3465224.32 0.00 9997.16 9997.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.06 20.05% 7361.60 5198 13071 7364.90 6862 8020 589342 589342 0.00
crit 147.69 37.00% 15794.74 10708 26926 15801.13 14963 16920 2332800 2332800 0.00
glance 95.76 23.99% 5671.05 3899 9803 5672.88 5331 6138 543082 543082 0.00
miss 75.71 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
premeditation 0 0.0% 9.7 51.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.69 9.69 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:(null)
  • description:When used, adds $s1 combo points to your target. You must add to or use those combo points within $d or the combo points are lost.
preparation 0 0.0% 2.0 300.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 8417 7.3% 19.8 23.19sec 191178 184444 0 0 0 0.0% 0.0% 0.0% 0.0% 217.8 12320 25808 17410 37.7% 0.0% 96.7%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.83 19.83 217.79 217.79 1.0365 2.0000 3791809.46 3791809.46 0.00 8312.91 184444.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.6 62.26% 12319.97 10772 19002 12322.66 11677 13130 1670481 1670481 0.00
crit 82.2 37.74% 25807.74 22190 39145 25812.67 24251 27844 2121329 2121329 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&dot.rupture.remains<5
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 6713 5.7% 92.8 4.18sec 32240 43851 21612 45751 32240 44.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.81 92.81 0.00 0.00 0.7352 0.0000 2992240.51 2992240.51 0.00 43851.35 43851.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.95 55.97% 21611.56 15455 30133 21619.22 20181 23160 1122636 1122636 0.00
crit 40.86 44.03% 45751.16 31838 62075 45761.06 41597 50258 1869605 1869605 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 3338 2.9% 91.8 4.22sec 16208 22032 10851 22966 16208 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.81 91.81 0.00 0.00 0.7357 0.0000 1488039.71 1488039.71 0.00 22031.65 22031.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.21 55.78% 10850.57 7728 15067 10854.90 10156 11683 555681 555681 0.00
crit 40.60 44.22% 22966.45 15919 31037 22970.57 21202 24841 932358 932358 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 3.0 180.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
shadow_dance 0 0.0% 7.8 60.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
slice_and_dice 0 0.0% 13.8 35.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.84 13.84 0.00 0.00 0.9615 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 14.6 31.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.57 14.57 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.1 104.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.14 4.14 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.9 0.0 181.1sec 181.1sec 6.45% 7.29%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.5%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.12%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.9 8.2 37.7sec 21.7sec 41.08% 41.33%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:41.1%
dancing_steel_oh 10.1 4.8 43.5sec 28.7sec 32.50% 32.96%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:32.5%
master_of_subtlety 4.9 0.0 92.1sec 112.6sec 6.61% 6.61%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:6.6%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:(null)
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional $s1% damage.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.9 0.0 60.7sec 60.7sec 25.77% 25.77%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.8%
shadow_blades 3.0 0.0 180.5sec 180.5sec 15.72% 16.73%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:15.7%
shadow_dance 7.8 0.0 60.4sec 60.4sec 13.67% 13.67%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_dance_1:13.7%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
  • max_stacks:
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
slice_and_dice 4.5 9.3 100.0sec 35.1sec 98.99% 99.35%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.0%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
synapse_springs_2 7.8 0.0 60.4sec 60.4sec 17.04% 17.04%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.0%
terror_in_the_mists 7.6 0.0 63.1sec 63.1sec 33.08% 33.08%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:33.1%
tricks_of_the_trade 14.6 0.0 31.5sec 31.5sec 19.26% 100.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.3%
tricks_of_the_trade_trigger 14.6 0.0 31.5sec 31.5sec 1.81% 1.81%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.8%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.1 0.0 105.0sec 105.0sec 0.14% 0.14%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • vanish_1:0.1%
virmens_bite_potion 2.0 0.0 414.8sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T14H
ambush Energy 35.7 1230.8 34.5 34.5 3537.1
backstab Energy 122.7 4293.4 35.0 35.0 1872.7
eviscerate Energy 61.6 2154.6 35.0 35.0 4958.4
hemorrhage Energy 19.5 585.3 30.0 30.0 2544.5
rupture Energy 19.8 495.8 25.0 25.0 7647.1
slice_and_dice Energy 13.8 321.0 23.2 23.2 0.0
tricks_of_the_trade Energy 14.6 218.6 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.50 5167.69 2.87 194.97 3.64%
energetic_recovery Energy 1783.13 1710.27 0.96 72.86 4.09%
relentless_strikes Energy 94.63 2355.88 24.90 9.92 0.42%
Resource RPS-Gain RPS-Loss
Energy 20.50 20.64
Combat End Resource Mean Min Max
Health 457343.00 457343.00 457343.00
Energy 34.36 0.12 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 3.7%

Procs

Count Interval
hat_donor 456.7 2.0sec
honor_among_thieves 211.8 2.1sec
no_revealing_strike 550.6 1.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 115672.37
Minimum 107356.22
Maximum 128226.18
Spread ( max - min ) 20869.95
Range [ ( max - min ) / 2 * 100% ] 9.02%
Standard Deviation 2574.0064
5th Percentile 111698.69
95th Percentile 120173.07
( 95th Percentile - 5th Percentile ) 8474.38
Mean Distribution
Standard Deviation 25.7452
95.00% Confidence Intervall ( 115621.91 - 115722.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1902
0.1 Scale Factor Error with Delta=300 56559
0.05 Scale Factor Error with Delta=300 226236
0.01 Scale Factor Error with Delta=300 5655915
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 115672.37

Damage

Sample Data
Count 9996
Mean 52051984.85

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 342.99
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
6 0.00 premeditation
7 0.00 slice_and_dice
Default action list
# count action,conditions
8 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
9 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
A 8.93 auto_attack
B 0.00 kick
C 3.01 shadow_blades
D 9.22 pool_resource,for_next=1,extra_amount=75
E 7.76 shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
F 7.76 use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
G 2.92 berserking,if=buff.shadow_dance.up
H 0.88 pool_resource,for_next=1,extra_amount=30
I 4.14 vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
J 8.69 premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
K 35.03 ambush,if=combo_points<=5&anticipation_charges=0
L 12.84 slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
M 19.83 rupture,if=combo_points=5&dot.rupture.remains<5
N 0.67 ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
O 61.56 eviscerate,if=combo_points=5
P 17.16 hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
Q 2.35 hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
R 113.44 backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
S 14.57 tricks_of_the_trade
T 9.23 backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

Sample Sequence

ACKQMRORRORSDDDDDEFGKOKOKLKKORMPORRROIAJK9ORRTORRSMIAKRLAPTORRORRRMTSEFKOJKOKOKPORRLRRMRRROPSRORRORRMRRRLPROSEFJAMKKOROPRRORRORRLRRSMPRRORRORCRORMTPODDDEFGJKLKOKOKSORRORRMPRAORROIAJKLRRRORSRMPRRORTOEFJKOKKMKLPRSORRORRMRRROPRORRLRRRSAMPOTEFJKOKKOKORRORSPL9IAJKMRRORRRORRORPMRRRSCORLTTOPDDDEFGKMKOJOKKOORRRORSPMRRLRRROR8RORPMRRRSORTOEFJKLKKOKMKPORR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 28047 24937 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.17% 15.17% 2558
Spell Crit 11.67% 6.67% 3997
Spell Haste 20.12% 14.40% 6122
Mana Per 5 0 0 0
Attack Power 62115 50237 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 33.63% 26.16% 3997
Melee Haste 14.40% 14.40% 6122
Swing Speed 25.85% 14.40% 6122
Expertise 7.65% / 7.65% 7.65% / 7.65% 2600
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 53.37% 38.37% 2876

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
Hands bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=mastery_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_haste
Main Hand spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=mastery_haste
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Subtlety_T14H"
origin="unknown"
level=90
race=troll
spec=subtlety
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth
actions.precombat+=/premeditation
actions.precombat+=/slice_and_dice

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/shadow_blades
actions+=/pool_resource,for_next=1,extra_amount=75
actions+=/shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
actions+=/use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/pool_resource,for_next=1,extra_amount=30
actions+=/vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=5&anticipation_charges=0
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&dot.rupture.remains<5
actions+=/ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
actions+=/eviscerate,if=combo_points=5
actions+=/hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
actions+=/hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
actions+=/backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
actions+=/tricks_of_the_trade
actions+=/backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=mastery_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2600
# gear_hit_rating=2558
# gear_crit_rating=3997
# gear_haste_rating=6122
# gear_mastery_rating=2876
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Shaman_Elemental_T14H : 104995 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
104995.2 104995.2 61.68 / 0.06% 5138 / 4.9% 33.6 2849.4 2826.5 Mana 1.75% 44.4 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://8.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:179998|131081|112423|55720|30110|21595&chds=0,359997&chco=C41F3B,C41F3B,00FF96,ABD473,ABD473,ABD473&chm=t++179998++lava_burst,C41F3B,0,0,15|t++131081++flame_shock,C41F3B,1,0,15|t++112423++elemental_blast,00FF96,2,0,15|t++55720++lightning_bolt,ABD473,3,0,15|t++30110++earth_shock,ABD473,4,0,15|t++21595++unleash_elements,ABD473,5,0,15&chtt=Shaman_Elemental_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,19,11,9,9,6,6,5,3,3,3,2,1,1,1,1,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,00FF96,ABD473,C41F3B,C41F3B,00FF96,C41F3B,ABD473,C41F3B,C79C6E,ABD473,C41F3B,00FF96,C41F3B,ABD473,C41F3B,00FF96,ABD473,C41F3B,C41F3B&chl=lava_burst|lightning_bolt|lava_burst_overload|fulmination|elemental_blast|lightning_bolt_overload|flame_shock|greater_fire_elemental: fire_melee|elemental_blast_overload|searing_totem: searing_bolt|earth_shock|lava_burst_eoe|greater_earth_elemental: earth_melee|lightning_bolt_eoe|lava_burst_overload_eoe|elemental_blast_eoe|greater_fire_elemental: fire_blast|lightning_bolt_overload_eoe|unleash_flame|elemental_blast_overload_eoe|earth_shock_eoe|flame_shock_eoe|unleash_flame_eoe&chtt=Shaman_Elemental_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:lortvwxyz01367867430yxvtrpnljigedcccdcccccdcbbbbaZYYXXWWXXXXXXXWWWWWWWXYYYYYYXWWWVVVVVVVVVVUUTTTTTTTUUVVVVUUUUUTTTUUUVVVVUTSRQPPPPQQRRRRQQQQPPPQRSTUVVVUUUUUUUUUVVVWWWVVVVVUUUUUUVVWWXYZaabcdefghjjjjiihgfedcbaaZZYXWVUTUUUVVVVWWWWWWVVVVUUUUUUUVVVUUUUUUUUUUVVWWWVVVUUUUUUUVVVVVVVVVVVVVVWWWXXWWWVVUTSSRQQRSSTSTTTTUUVVWXYZbbcdcbbaaaaaaaaaaaaaZZZZaZZaaabbbbaZZYYXWWWWXXYZaabccdefhijllmmllkjjhgfedcbaZYXVVUUUUUUUVVVVVVVVVVUUUTTTUUUUUUTTTTTTTUUUVVWWVVVVVVVUUUUVVUUUUUUUUUUUUUVVVVVVVVVUUUUUUUUUUUUUUUUUVVVVVWWWWWWWVVVVVVUUUUUUTTTTTTTTUUUUUUUUUUUUUUTTTTSSSSSRRRR&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=104995|max=254072&chxp=1,1,41,100&chtt=Shaman_Elemental_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,4,3,3,18,16,26,41,59,95,135,161,209,281,333,392,438,487,554,554,601,576,555,577,519,502,452,432,345,319,274,221,205,158,108,92,65,58,33,23,23,13,12,15,1,0,1,1,3&chds=0,601&chbh=5&chxt=x&chxl=0:|min=94133|avg=104995|max=117460&chxp=0,1,47,100&chtt=Shaman_Elemental_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.7,22.7,10.5,8.6,4.1,1.4,1.1,0.5,0.5,1.7&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,00FF96,ABD473,C41F3B,C79C6E,ABD473,C79C6E,C79C6E,ffffff&chl=lightning_bolt 210.2s|lava_burst 102.2s|elemental_blast 47.3s|earth_shock 38.6s|flame_shock 18.7s|searing_totem 6.1s|unleash_elements 4.9s|earth_elemental_totem 2.1s|fire_elemental_totem 2.1s|waiting 7.9s&chtt=Shaman_Elemental_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Elemental_T14H 104995
ascendance 0 0.0% 3.0 181.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.95 2.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.2 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.25 4.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 302.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 2436 (2577) 2.3% (2.5%) 32.0 13.23sec 36353 30110 26699 69456 34364 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.99 31.99 0.00 0.00 1.2073 0.0000 1099319.45 1099319.45 0.00 30110.43 30110.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.26 82.07% 26698.70 24039 35670 26703.19 25235 28212 700988 700988 0.00
crit 5.73 17.93% 69456.32 62260 92385 69282.67 0 88664 398332 398332 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 141 0.1% 1.9 111.12sec 33476 0 25952 67594 33476 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.90 1.90 0.00 0.00 0.0000 0.0000 63635.64 63635.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.56 81.93% 25952.38 24039 35670 20396.12 0 35670 40421 40421 0.00
crit 0.34 18.07% 67593.70 62260 88054 19697.62 0 88054 23214 23214 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
elemental_blast 8165 (11804) 7.8% (11.3%) 29.2 15.51sec 182248 112423 97312 253552 126258 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.17 29.12 0.00 0.00 1.6211 0.0000 3677186.18 3677186.18 0.00 112423.43 112423.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.73 81.47% 97311.55 83944 156856 97348.82 92080 103102 2309056 2309056 0.00
crit 5.40 18.53% 253551.86 217415 391580 252972.49 0 353536 1368130 1368130 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_eoe 487 0.5% 1.7 115.54sec 126257 0 97329 253577 126489 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.74 1.74 0.00 0.00 0.0000 0.0000 219546.90 219546.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.41 81.34% 97329.02 83944 139283 73756.18 0 139283 137406 137406 0.00
crit 0.32 18.66% 253577.43 217415 360742 71034.07 0 360742 82141 82141 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_overload 2972 2.8% 14.2 30.56sec 94575 0 73014 190303 94738 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.16 14.13 0.00 0.00 0.0000 0.0000 1338782.07 1338782.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.51 81.48% 73013.72 62958 104462 73038.35 65477 84048 840673 840673 0.00
crit 2.62 18.52% 190303.36 163062 270558 177038.46 0 257382 498109 498109 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
elemental_blast_overload_eoe 179 0.2% 0.9 132.56sec 94268 0 72556 190331 94411 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.86 0.86 0.00 0.00 0.0000 0.0000 80876.22 80876.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.70 81.44% 72555.69 62958 107366 36416.35 0 107366 50621 50621 0.00
crit 0.16 18.56% 190330.60 163062 270558 27711.32 0 270558 30256 30256 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
fire_elemental_totem 0 0.0% 2.0 1.#Rsec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 5394 (5432) 5.1% (5.2%) 15.3 30.41sec 160154 131081 14993 39004 19187 17.5% 0.0% 0.0% 0.0% 190.6 8754 22757 11203 17.5% 0.0% 98.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.27 15.27 190.60 190.60 1.2218 2.3303 2428198.10 2428198.10 0.00 5283.94 131081.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.60 82.53% 14993.35 13453 25108 14998.48 13627 16924 188948 188948 0.00
crit 2.67 17.47% 39003.52 34844 64571 36768.69 0 59885 104033 104033 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.3 82.51% 8754.08 8146 13917 8757.92 8346 9435 1376723 1376723 0.00
crit 33.3 17.49% 22756.75 21098 36046 22768.68 21098 25574 758494 758494 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 38 0.0% 0.9 140.51sec 18653 0 14565 37808 18653 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.92 0.92 0.00 0.00 0.0000 0.0000 17251.73 17251.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.76 82.41% 14565.29 13453 23122 7923.26 0 23122 11102 11102 0.00
crit 0.16 17.59% 37807.72 34844 64571 5764.12 0 64571 6150 6150 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 8775 8.4% 32.0 13.23sec 123822 0 96004 249479 123822 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.99 31.99 0.00 0.00 0.0000 0.0000 3961120.47 3961120.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.19 81.87% 96004.27 60617 136990 96036.66 87977 102649 2514561 2514561 0.00
crit 5.80 18.13% 249479.14 156997 354805 248984.60 0 322249 1446560 1446560 0.00
DPS Timeline Chart

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.388000
  • base_dd_min:629.69
  • base_dd_max:629.69
lava_burst 28442 (40977) 27.0% (39.0%) 87.2 5.14sec 210930 179998 0 146630 146630 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.20 87.07 0.00 0.00 1.1718 0.0000 12767068.91 12767068.91 0.00 179998.27 179998.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 87.07 100.00% 146630.23 121234 237533 146700.12 142014 152363 12767069 12767069 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_eoe 1674 1.6% 5.2 70.98sec 143896 0 50959 144322 144117 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.22 5.21 0.00 0.00 0.0000 0.0000 750863.69 750863.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.22% 50959.47 46808 60942 581.17 0 60942 581 581 0.00
crit 5.20 99.78% 144321.75 121234 205190 143444.30 0 192255 750283 750283 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_overload 10235 9.7% 42.5 10.40sec 108074 0 38718 108479 108358 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.52 42.40 0.00 0.00 0.0000 0.0000 4594845.12 4594845.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.07 0.17% 38717.98 35106 58402 2678.30 0 58402 2847 2847 0.00
crit 42.33 99.83% 108479.06 90925 169281 108523.75 100923 117196 4591998 4591998 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lava_burst_overload_eoe 626 0.6% 2.5 104.19sec 110722 0 40411 111212 111058 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.54 2.53 0.00 0.00 0.0000 0.0000 281245.91 281245.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.22% 40411.15 35106 48051 222.35 0 48051 222 222 0.00
crit 2.53 99.78% 111212.30 90925 169281 102452.66 0 169281 281024 281024 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lightning_bolt 18548 (25952) 17.7% (24.8%) 137.0 3.11sec 85495 55720 47773 124255 61225 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.98 136.71 0.00 0.00 1.5344 0.0000 8369993.98 8369993.98 0.00 55719.59 55719.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.67 82.41% 47773.29 42194 63523 47778.28 46696 48862 5382410 5382410 0.00
crit 24.04 17.59% 124255.30 109281 164523 124225.95 116307 133293 2987584 2987584 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 1074 1.0% 8.2 46.74sec 59236 0 46444 120833 59364 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.17 0.00 0.00 0.0000 0.0000 484728.84 484728.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.75 82.63% 46444.04 42194 63523 46377.83 0 55970 313367 313367 0.00
crit 1.42 17.37% 120833.20 109281 164523 91013.71 0 157623 171362 171362 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_overload 5975 5.7% 63.7 6.67sec 42312 0 33193 86361 42469 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.72 63.48 0.00 0.00 0.0000 0.0000 2696045.42 2696045.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.41 82.55% 33192.80 30139 45374 33194.63 32011 34815 1739524 1739524 0.00
crit 11.08 17.45% 86361.18 78059 117518 86354.13 78059 98718 956522 956522 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
lightning_bolt_overload_eoe 356 0.3% 3.8 80.46sec 42353 0 33216 86317 42494 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.78 3.77 0.00 0.00 0.0000 0.0000 160263.90 160263.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.11 82.53% 33216.32 30139 45374 31600.69 0 43471 103384 103384 0.00
crit 0.66 17.47% 86317.27 78059 117518 41436.10 0 112589 56880 56880 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
searing_totem 0 0.0% 5.9 72.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.93 5.93 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=2&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
spiritwalkers_grace 0 0.0% 2.0 170.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spiritwalkers_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: spiritwalkers_grace

Static Values
  • id:79206
  • school:nature
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8460.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:79206
  • name:Spiritwalker's Grace
  • school:nature
  • tooltip:Able to move while casting Shaman spells that have a cast time.
  • description:Calls upon spiritual guidance, permitting movement while casting non-instant Shaman spells. This spell may be cast while casting other spells. Lasts $d.
unleash_elements 0 (241) 0.0% (0.2%) 4.0 85.26sec 26703 21595 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.2365 0.0000 0.00 0.00 0.00 21594.91 21594.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unleash_elements

Static Values
  • id:73680
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4919.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.unleashed_fury.enabled&!buff.ascendance.up
Spelldata
  • id:73680
  • name:Unleash Elements
  • school:nature
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 226 0.2% 4.0 85.26sec 25102 0 19578 51169 25102 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 100364.40 100364.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.30 82.52% 19578.23 17366 24681 19558.82 0 24681 64593 64593 0.00
crit 0.70 17.48% 51169.46 44978 63924 27454.18 0 63924 35772 35772 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_flame_eoe 14 0.0% 0.3 126.42sec 25180 0 19613 50909 25180 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.25 0.25 0.00 0.00 0.0000 0.0000 6400.81 6400.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.21 82.21% 19613.13 17366 24681 3790.63 0 24681 4099 4099 0.00
crit 0.05 17.79% 50908.61 44978 63871 2244.11 0 63871 2302 2302 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
pet - greater_fire_elemental 20692 / 5593
fire_blast 1447 0.4% 20.0 18.75sec 8682 0 6795 17161 8682 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.99 19.99 0.00 0.00 0.0000 0.0000 173572.06 173572.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.35 81.79% 6795.00 6103 8922 6794.29 6339 7197 111112 111112 0.00
crit 3.64 18.21% 17161.42 15259 22304 16884.99 0 22304 62460 62460 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 19245 4.9% 110.9 3.24sec 20811 21995 17075 43210 20811 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.94 110.94 0.00 0.00 0.9462 0.0000 2308787.07 2308787.07 0.00 21994.94 21994.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.13 57.81% 17074.61 15391 21961 17074.40 16101 17749 1095022 1095022 0.00
crit 20.17 18.18% 43209.54 38478 54902 43213.25 38872 49910 871691 871691 0.00
glance 26.64 24.01% 12842.50 11544 16471 12843.26 11850 13959 342075 342075 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 4201 / 1116
earth_melee 4201 1.1% 77.2 4.66sec 6438 4491 5770 11587 6438 17.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.18 77.18 0.00 0.00 1.4336 0.0000 496905.89 496905.89 0.00 4490.95 4490.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.17 58.53% 5769.63 5478 7529 5767.65 5562 6176 260624 260624 0.00
crit 13.46 17.44% 11587.45 10955 15059 11582.20 10955 12971 155937 155937 0.00
glance 18.55 24.04% 4330.87 4108 5647 4329.31 4108 4803 80345 80345 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3699 / 2527
searing_bolt 3699 2.4% 190.6 2.03sec 6010 0 4717 12263 6040 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.63 189.70 0.00 0.00 0.0000 0.0000 1145753.82 1145753.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 156.45 82.47% 4717.07 4185 6029 4717.32 4599 4823 737997 737997 0.00
crit 33.25 17.53% 12263.34 10840 15615 12264.00 11579 13000 407757 407757 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 3.0 0.0 181.4sec 181.4sec 9.75% 9.75%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:9.7%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.2 0.0 121.1sec 121.1sec 13.85% 13.85%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.8%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.60%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
elemental_blast_crit 10.3 0.0 40.6sec 40.6sec 17.24% 17.24%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_crit
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_crit_1:17.2%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_haste 10.3 0.0 40.6sec 40.6sec 17.25% 17.25%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_haste_1:17.3%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_mastery 10.3 0.0 40.6sec 40.6sec 17.19% 17.19%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_mastery_1:17.2%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_focus 66.1 64.0 6.8sec 3.4sec 57.63% 58.31%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • elemental_focus_1:30.7%
  • elemental_focus_2:26.9%

Spelldata details

  • id:16246
  • name:Clearcasting
  • tooltip:Your next $n spells have their mana cost reduced by $s1%. Spell damage increased by $s2%. Single-target healing done increased by $s4%.
  • description:After landing a critical strike with a Fire, Frost, or Nature damage spell, you enter a Clearcasting state. The Clearcasting state reduces the mana cost of your next $16246n spells by $16246s1%, increases your spell damage by $s2%, and increases single-target healing done by $s4%.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 7.3 0.0 65.0sec 65.0sec 31.85% 31.85%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:31.8%
jade_serpent_potion 2.0 0.0 301.9sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.3 0.0 56.9sec 56.9sec 21.74% 21.42%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.7%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 8.8 0.0 53.4sec 53.4sec 28.90% 28.90%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.9%
spiritwalkers_grace 2.0 0.0 170.0sec 170.0sec 6.76% 6.76%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_spiritwalkers_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • spiritwalkers_grace_1:6.8%

Spelldata details

  • id:79206
  • name:Spiritwalker's Grace
  • tooltip:Able to move while casting Shaman spells that have a cast time.
  • description:Calls upon spiritual guidance, permitting movement while casting non-instant Shaman spells. This spell may be cast while casting other spells. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
synapse_springs_2 7.8 0.0 61.3sec 61.3sec 17.22% 17.22%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
unleash_flame 4.0 0.0 85.3sec 85.3sec 4.52% 2.12%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_flame_1:4.5%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:1.01%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
lightning_shield

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:7
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:32.1%
  • lightning_shield_3:23.1%
  • lightning_shield_5:20.6%
  • lightning_shield_7:24.2%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T14H
ascendance Mana 3.0 9204.9 3120.0 3120.0 0.0
bloodlust Mana 0.0 80.0 12900.0 12900.0 0.0
earth_elemental_totem Mana 2.0 33720.0 16860.0 16860.0 0.0
earth_shock Mana 32.0 242691.4 7586.4 7586.4 4.8
fire_elemental_totem Mana 2.0 32278.0 16139.0 16139.0 0.0
flame_shock Mana 15.3 99529.5 6518.2 6518.2 24.6
lava_burst Mana 87.2 333319.6 3822.3 3822.3 55.2
lightning_bolt Mana 137.0 478163.4 3490.8 3490.8 24.5
searing_totem Mana 5.9 20997.1 3540.0 3540.0 0.0
spiritwalkers_grace Mana 2.0 16920.0 8460.0 8460.0 0.0
unleash_elements Mana 4.0 16758.2 4191.3 4191.3 6.4
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 636407.25 353.26 39155.70 5.80%
rolling_thunder Mana 122.38 636944.21 5204.73 97324.10 13.25%
Resource RPS-Gain RPS-Loss
Mana 2826.54 2849.43
Combat End Resource Mean Min Max
Health 463699.00 463699.00 463699.00
Mana 289729.57 245057.00 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 33.3 13.1sec
lava_surge 38.1 11.5sec
lightning_shield_too_fast_fill 5.7 65.1sec
rolling_thunder 122.4 3.5sec
uf_flame_shock 0.7 19.1sec
uf_lava_burst 1.9 103.3sec
uf_elemental_blast 0.7 107.8sec
uf_wasted 0.5 47.5sec
wasted_lightning_shield 43.1 18.9sec
wasted_lightning_shield_shock_cd 11.5 65.1sec
fulmination_4 2.4 102.3sec
fulmination_6 29.6 14.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 104995.15
Minimum 94132.94
Maximum 117460.13
Spread ( max - min ) 23327.19
Range [ ( max - min ) / 2 * 100% ] 11.11%
Standard Deviation 3146.2874
5th Percentile 100045.72
95th Percentile 110321.00
( 95th Percentile - 5th Percentile ) 10275.28
Mean Distribution
Standard Deviation 31.4692
95.00% Confidence Intervall ( 104933.47 - 105056.83 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3449
0.1 Scale Factor Error with Delta=300 84504
0.05 Scale Factor Error with Delta=300 338018
0.01 Scale Factor Error with Delta=300 8450462
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 104995.15

Damage

Sample Data
Count 9996
Mean 43097737.73

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 333.48
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 flametongue_weapon,weapon=main
3 0.00 lightning_shield,if=!buff.lightning_shield.up
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 wind_shear
7 0.01 bloodlust,if=target.health.pct<25|time>5
8 1.00 jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
9 0.00 run_action_list,name=single,if=num_targets=1
A 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
L 7.84 use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
M 4.25 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
N 0.00 elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
O 2.00 fire_elemental_totem,if=!active
P 2.95 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
Q 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
R 0.00 unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
S 15.27 flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
T 87.71 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
U 29.28 elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
V 28.93 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
W 3.06 earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
X 2.00 earth_elemental_totem,if=!active
Y 5.93 searing_totem,if=!totem.fire.active
Z 0.36 spiritwalkers_grace,moving=1
a 4.00 unleash_elements,moving=1
b 138.91 lightning_bolt

Sample Sequence

OLSTUXMPTTTTTTTTTTTTTTTUbbbSbbTbVbTUbbbbVbTabbUVTbbSbLTYbUbVbTbbbVbUTbVbTbSbbUTVbbbbTVUbbbTbbSTbLUTYMbbaVTUbTbbTbbSbUbTVbbbTbVTUbbWbTbSbUbVPLTTTTTTTTTTTTTTUTYbbSbbTVUTabTbbVbUTbWTbTSbbULMVbTbbbbbTUVbbYTbSbbTUVbbbbTVbTUbbbbTO8SaXULTbbbTbTbUVbbbTVbbbSTUbVbbbTVbbUVbTbbTYSbTPTMTLTTTTTTTTTTUbbVbTbSbTUVbbbbTbVbbUbTbbVbYbSTUbLVTbbbVTUbbTbb

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 180 171 80
Stamina 22664 20604 20442
Intellect 22230 19806 18716
Spirit 5351 5351 5180
Health 463699 434859 0
Mana 300000 300000 0
Spell Power 33139 27703 7907
Spell Hit 15.24% 15.24% 0
Spell Crit 18.87% 12.91% 1735
Spell Haste 18.78% 13.13% 5579
Mana Per 5 7500 7500 0
Attack Power 788 687 0
Melee Hit 15.24% 15.24% 0
Melee Crit 10.95% 5.95% 1735
Melee Haste 13.13% 13.13% 5579
Swing Speed 24.44% 13.13% 5579
Expertise 0.00% 0.00% 0
Armor 43524 43524 43524
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.62% 34.62% 5585

Gear

Average Item Level: 507.81
Head firebirds_headpiece,id=87141,gems=burning_primal_80int_160spi_180int
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
Shoulders firebirds_shoulderwraps,id=87143,gems=160int,enchant=200int_100crit
Shirt empty
Chest mail_of_screaming_secrets,id=86951,gems=160int_80int_160mastery_120int,enchant=80all
Waist binders_chain_of_unending_summer,id=87183,gems=160int_160int
Legs firebirds_kilt,id=87142,gems=160int_60int,enchant=285int_165spi
Feet lightning_prisoners_boots,id=90515,gems=160int,enchant=170haste,reforge=spi_mastery
Wrists bracers_of_tempestuous_fury,id=86962,enchant=180int,reforge=spi_mastery
Hands firebirds_gloves,id=87140,enchant=170mastery,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
Finger2 watersoul_signet,id=90511,enchant=160int,reforge=spi_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int
Main Hand kritak_imperial_scepter_of_the_swarm,id=86990,gems=500int,enchant=jade_spirit
Off Hand eye_of_the_ancient_spirit,id=87039,enchant=165int,reforge=spi_mastery
Unknown empty
Tabard empty

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Elemental_T14H"
origin="unknown"
level=90
race=orc
spec=elemental
role=spell
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/flametongue_weapon,weapon=main
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=ascendance
actions.ae+=/lava_beam
actions.ae+=/magma_totem,if=num_targets>2&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=2&!totem.fire.active
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking&num_targets<3
actions.ae+=/lava_burst,if=num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
actions.ae+=/earthquake,if=num_targets>4
actions.ae+=/thunderstorm,if=mana.pct_nonproc<80
actions.ae+=/chain_lightning,if=mana.pct_nonproc>10
actions.ae+=/lightning_bolt

actions.single=use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
actions.single+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
actions.single+=/fire_elemental_totem,if=!active
actions.single+=/ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/unleash_elements,moving=1
actions.single+=/lightning_bolt

head=firebirds_headpiece,id=87141,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=firebirds_shoulderwraps,id=87143,gems=160int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int
chest=mail_of_screaming_secrets,id=86951,gems=160int_80int_160mastery_120int,enchant=80all
wrists=bracers_of_tempestuous_fury,id=86962,enchant=180int,reforge=spi_mastery
hands=firebirds_gloves,id=87140,enchant=170mastery,addon=synapse_springs_mark_ii
waist=binders_chain_of_unending_summer,id=87183,gems=160int_160int
legs=firebirds_kilt,id=87142,gems=160int_60int,enchant=285int_165spi
feet=lightning_prisoners_boots,id=90515,gems=160int,enchant=170haste,reforge=spi_mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=watersoul_signet,id=90511,enchant=160int,reforge=spi_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,gems=500int,enchant=jade_spirit
off_hand=eye_of_the_ancient_spirit,id=87039,enchant=165int,reforge=spi_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20442
# gear_intellect=18716
# gear_spirit=5180
# gear_spell_power=7907
# gear_crit_rating=1735
# gear_haste_rating=5579
# gear_mastery_rating=5585
# gear_armor=43524
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=firebirds_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_2.40speed_3142min_5835max,enchant=jade_spirit

Shaman_Enhancement_T14H : 113310 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
113310.1 113310.1 55.21 / 0.05% 4609 / 4.1% 74.3 1298.8 1292.3 Mana 18.87% 38.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://7.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:182044|180809|97516|68086|67055|51316|40496|36714|17862|9903|4752&chds=0,364088&chco=ABD473,C41F3B,C41F3B,ABD473,C79C6E,ABD473,ABD473,ABD473,ABD473,C79C6E,C79C6E&chm=t++182044++stormblast,ABD473,0,0,15|t++180809++flame_shock,C41F3B,1,0,15|t++97516++lava_lash,C41F3B,2,0,15|t++68086++lightning_bolt,ABD473,3,0,15|t++67055++stormstrike,C79C6E,4,0,15|t++51316++earth_shock,ABD473,5,0,15|t++40496++unleash_elements,ABD473,6,0,15|t++36714++windlash_main_hand,ABD473,7,0,15|t++17862++windlash_off_hand,ABD473,8,0,15|t++9903++melee_main_hand,C79C6E,9,0,15|t++4752++melee_off_hand,C79C6E,10,0,15&chtt=Shaman_Enhancement_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,12,11,9,7,7,7,6,6,5,4,4,3,3,3,2,2,2,2,2,2,1,1,1,1,1,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,ABD473,C41F3B,C79C6E,C79C6E,C41F3B,C79C6E,C41F3B,ABD473,C79C6E,C79C6E,ABD473,ABD473,C41F3B,ABD473,C79C6E,C41F3B,ABD473,ABD473,ABD473,C79C6E,ABD473,C79C6E,C41F3B,C41F3B,C41F3B&chl=lava_lash|lightning_shield|lightning_bolt|greater_fire_elemental: fire_melee|melee_main_hand|stormstrike_mh|flame_shock|windfury_mh|flametongue_oh|earth_shock|melee_off_hand|stormstrike_oh|lightning_bolt_eoe|windlash_main_hand|searing_totem: searing_bolt|stormblast_mh|spirit_wolf: melee|unleash_flame|spirit_wolf: spirit_bite|windlash_off_hand|earth_shock_eoe|greater_earth_elemental: earth_melee|stormblast_oh|unleash_wind|unleash_flame_eoe|greater_fire_elemental: fire_blast|flame_shock_eoe&chtt=Shaman_Enhancement_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wwvuxzz034456767840yyxxxxvsrpnkkjjhhgffedccdcccbbaaZYZaabcdefffeccccdeeeeedccbbbaZZYZZZZZZYXWWVVVUUUUUVVWWWVVUUUUVVVVVWWWVUTTSRSTTTUUTTUVVWWWWWXZZaaaZaaaaaaZYXXWWXXWWWWWWWVVVUUUUVWXYZabbcccdeeeeefgghhhgedcaZYXWVUUUUUTTSRRRRRRRSSTUVWWVVVVVVWWWWWWXXYYYYYXXXYXYZZZaaaaaaZZYYYZZaaaaZZYYYYXXWWWWVUTSRQQQRSSSSSSTUVVWXYYZbcddcccddefffedddddeeddeeeeeeeddcccccccddddddddeedeeefghiiiiiiiiiihhgffffffedcbaaZZZZZZZZZZYYYXWWWWWWWWWWWWWWWWVVVUVVVWWWWWWWWVVVVVVVWWWXXWWWWWWWWWWWWWXXXXWWWVVVVVVWWWXXXXXWWWWWWXXXXXYYYYYYXXXXXXYYYZZZZZYYYYYXXXYYYYYXXWWVVVUTTSSSSSSRRQQP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113310|max=251861&chxp=1,1,45,100&chtt=Shaman_Enhancement_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,2,5,15,26,42,51,77,110,144,185,271,305,373,430,478,566,510,534,580,571,581,543,496,472,477,397,340,279,262,220,162,129,102,80,56,41,28,17,14,7,4,4,2,2,1,0,0,1&chds=0,581&chbh=5&chxt=x&chxl=0:|min=104144|avg=113310|max=125276&chxp=0,1,43,100&chtt=Shaman_Enhancement_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:21.0,15.7,13.4,13.0,8.4,4.0,2.0,1.6,1.1,0.5,0.5,18.9&chds=0,100&chdls=ffffff&chco=ABD473,C79C6E,C41F3B,ABD473,ABD473,C41F3B,ABD473,C79C6E,ABD473,C79C6E,C79C6E,ffffff&chl=lightning_bolt 94.6s|stormstrike 70.8s|lava_lash 60.3s|earth_shock 58.7s|unleash_elements 37.9s|flame_shock 18.1s|stormblast 8.9s|searing_totem 7.1s|feral_spirit 5.2s|earth_elemental_totem 2.1s|fire_elemental_totem 2.1s|waiting 85.0s&chtt=Shaman_Enhancement_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Enhancement_T14H 113310
ascendance 0 0.0% 2.9 182.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>=3
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.3 120.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 301.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 5156 (6692) 4.6% (5.9%) 45.4 9.78sec 66391 51316 32117 66558 51143 55.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.38 45.38 0.00 0.00 1.2938 0.0000 2321114.26 2321114.26 0.00 51316.41 51316.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.31 44.76% 32116.89 28637 46962 32119.17 29907 35009 652398 652398 0.00
crit 25.07 55.24% 66557.97 58993 96742 66581.28 61981 72140 1668717 1668717 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 1536 1.4% 13.5 30.73sec 51090 0 32132 66551 51090 55.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.55 13.55 0.00 0.00 0.0000 0.0000 692031.12 692031.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.08 44.92% 32132.45 28637 46962 32054.90 0 42386 195505 195505 0.00
crit 7.46 55.08% 66550.64 58993 96742 66555.43 0 86179 496527 496527 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
feral_spirit 0 0.0% 4.1 121.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.14 4.14 0.00 0.00 1.2515 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7200.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves that aid the Shaman in battle, lasting $d. Spirit Wolves' attacks heal them and their master for $<percent>% of damage done.
fire_elemental_totem 0 0.0% 2.0 300.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 7004 (7259) 6.2% (6.4%) 13.9 33.42sec 234973 180809 23777 49508 27757 15.5% 0.0% 0.0% 0.0% 165.6 14336 29887 16705 15.2% 0.0% 92.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.91 13.91 165.65 165.65 1.2996 2.5132 3153146.42 3153146.42 0.00 7523.99 180809.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.76 84.53% 23776.94 20660 34467 23782.37 21058 26768 279565 279565 0.00
crit 2.15 15.47% 49508.36 42559 67721 44488.10 0 67721 106515 106515 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.4 84.77% 14336.14 9552 21028 14340.30 13305 15421 2013041 2013041 0.00
crit 25.2 15.23% 29887.13 19676 43317 29880.22 26513 34501 754025 754025 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 256 0.2% 4.2 90.86sec 27714 0 23784 49547 27714 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.16 4.16 0.00 0.00 0.0000 0.0000 115160.76 115160.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.52 84.74% 23783.88 15892 34467 23370.98 0 32874 83750 83750 0.00
crit 0.63 15.26% 49546.81 32737 67721 23720.52 0 67721 31410 31410 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 5325 4.7% 284.3 1.58sec 8434 0 7209 15071 8434 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 284.30 284.30 0.00 0.00 0.0000 0.0000 2397871.99 2397871.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 240.00 84.42% 7209.27 4927 11554 7212.83 6939 7615 1730189 1730189 0.00
crit 44.30 15.58% 15071.41 10150 23802 15082.17 13403 16670 667683 667683 0.00
DPS Timeline Chart

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8024
  • name:Flametongue Weapon
  • school:fire
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing magical damage done by $10400s2%. Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 60 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:224.53
  • base_dd_max:224.53
improved_lava_lash 0 0.0% 37.2 12.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: improved_lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
DPS Timeline Chart

Action details: improved_lava_lash

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
lava_lash 13048 11.5% 39.2 11.42sec 149829 97516 108384 225551 149829 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.25 39.25 0.00 0.00 1.5365 0.0000 5880292.46 5880292.46 0.00 97515.67 97515.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.36 64.63% 108383.98 101939 135855 108387.03 104300 112603 2749067 2749067 0.00
crit 13.88 35.37% 225551.12 209995 279861 225629.09 213806 242456 3131225 3131225 0.00
DPS Timeline Chart

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.ticking
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target$?s55444[][ and spreading your Flame Shock from the target to up to four enemies within $105792A1 yards]. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.50
lightning_bolt 11037 (14293) 9.8% (12.6%) 73.3 6.08sec 87843 68086 42446 88153 67842 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.35 73.34 0.00 0.00 1.2902 0.0000 4975316.64 4975316.64 0.00 68085.62 68085.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.59 44.44% 42446.38 31490 68983 42456.24 37671 46885 1383282 1383282 0.00
crit 40.75 55.56% 88153.06 64869 142104 88185.98 80823 97392 3592034 3592034 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 3256 2.9% 21.6 20.21sec 67992 0 42572 88396 68003 55.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.59 21.59 0.00 0.00 0.0000 0.0000 1467897.47 1467897.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.61 44.50% 42572.43 31490 68983 42569.13 0 55962 408970 408970 0.00
crit 11.98 55.50% 88395.79 64869 142104 88405.28 64869 107330 1058928 1058928 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_shield 11584 10.2% 162.4 3.01sec 32129 0 20334 42039 32129 54.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.41 162.41 0.00 0.00 0.0000 0.0000 5217973.65 5217973.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.22 44.47% 20333.70 17800 30038 20340.82 19104 21653 1468461 1468461 0.00
crit 89.19 54.92% 42039.01 36669 61878 42054.18 39755 44382 3749513 3749513 0.00
none 1.00 0.62% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
melee_main_hand 7088 6.3% 204.3 2.21sec 15653 9903 13845 28891 15653 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 204.25 204.25 0.00 0.00 1.5807 0.0000 3197262.01 3197262.01 0.00 9902.87 9902.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.42 22.24% 13845.03 13096 17644 13845.65 13340 14444 628848 628848 0.00
crit 71.18 34.85% 28890.81 26979 36347 28896.27 28006 29815 2056450 2056450 0.00
glance 48.92 23.95% 10465.34 9822 13233 10466.46 10138 10982 511964 511964 0.00
miss 38.73 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3521 3.1% 203.3 2.21sec 7816 4752 6920 14436 7816 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 203.26 203.26 0.00 0.00 1.6446 0.0000 1588649.85 1588649.85 0.00 4752.47 4752.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.29 22.28% 6920.20 6548 8822 6920.48 6677 7187 313424 313424 0.00
crit 70.68 34.77% 14436.10 13489 18173 14438.45 14031 15002 1020329 1020329 0.00
glance 48.74 23.98% 5230.14 4911 6617 5230.76 5064 5448 254898 254898 0.00
miss 38.55 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_totem 0 0.0% 6.9 71.97sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.89 6.89 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=5&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
spiritwalkers_grace 0 0.0% 2.0 170.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spiritwalkers_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: spiritwalkers_grace

Static Values
  • id:79206
  • school:nature
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:8460.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:79206
  • name:Spiritwalker's Grace
  • school:nature
  • tooltip:Able to move while casting Shaman spells that have a cast time.
  • description:Calls upon spiritual guidance, permitting movement while casting non-instant Shaman spells. This spell may be cast while casting other spells. Lasts $d.
stormblast 0 (3635) 0.0% (3.2%) 5.8 75.03sec 279685 182044 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.80 5.80 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 182043.79 182043.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormblast

Static Values
  • id:115356
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5621.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Stormblast
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Hurl a staggering lightning blast at an enemy, dealing Nature damage equal to $115357s1% weapon damage and granting you an additional $115356s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $115356d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormblast_mh 2421 2.1% 5.8 75.03sec 186298 0 129826 272637 186298 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.80 5.80 0.00 0.00 0.0000 0.0000 1081147.25 1081147.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.51 60.46% 129825.90 115011 154947 128960.81 0 154947 455495 455495 0.00
crit 2.29 39.54% 272637.16 236922 319191 258084.60 0 319191 625653 625653 0.00
DPS Timeline Chart

Action details: stormblast_mh

Static Values
  • id:115357
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Stormblast
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormblast_oh 1214 1.1% 5.8 75.03sec 93387 0 64891 136365 93387 39.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.80 5.80 0.00 0.00 0.0000 0.0000 541955.20 541955.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.49 60.13% 64891.17 57505 77474 64578.07 0 76133 226444 226444 0.00
crit 2.31 39.87% 136365.03 118461 159596 129392.72 0 159596 315511 315511 0.00
DPS Timeline Chart

Action details: stormblast_oh

Static Values
  • id:115360
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Stormblast Off-Hand
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike 0 (10531) 0.0% (9.3%) 46.1 9.79sec 103031 67055 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.09 46.09 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 67055.17 67055.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5640.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormstrike_mh 7019 6.2% 46.1 9.79sec 68670 0 50050 103809 68670 34.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.09 46.09 0.00 0.00 0.0000 0.0000 3165089.29 3165089.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.13 65.37% 50050.48 47315 63057 50051.24 48279 51865 1507918 1507918 0.00
crit 15.96 34.63% 103809.44 97470 129898 103827.89 98901 110259 1657171 1657171 0.00
DPS Timeline Chart

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike_oh 3512 3.1% 46.1 9.79sec 34361 0 25025 51906 34361 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.09 46.09 0.00 0.00 0.0000 0.0000 1583757.96 1583757.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.08 65.27% 25024.56 23658 31529 25024.70 24317 25877 752815 752815 0.00
crit 16.01 34.73% 51906.38 48735 64949 51919.21 49484 55772 830943 830943 0.00
DPS Timeline Chart

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
unleash_elements 0 (3410) 0.0% (3.0%) 29.1 15.69sec 52690 40496 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.13 29.13 0.00 0.00 1.3011 0.0000 0.00 0.00 0.00 40495.87 40495.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unleash_elements

Static Values
  • id:73680
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4919.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73680
  • name:Unleash Elements
  • school:nature
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 1760 1.6% 29.1 15.69sec 27186 0 23338 48452 27186 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.13 29.13 0.00 0.00 0.0000 0.0000 792059.30 792059.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.67 84.68% 23337.55 20580 32550 23343.81 21919 24622 575746 575746 0.00
crit 4.46 15.32% 48452.00 42395 67053 48097.28 0 63061 216313 216313 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_flame_eoe 527 0.5% 8.7 47.69sec 27217 0 23319 48375 27217 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 8.72 0.00 0.00 0.0000 0.0000 237217.15 237217.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.36 84.44% 23318.80 20580 32550 23310.93 0 29091 171618 171618 0.00
crit 1.36 15.56% 48375.41 42395 67053 36030.49 0 67053 65599 65599 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_wind 1123 1.0% 29.1 15.69sec 17362 0 12593 26155 17366 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.13 29.13 0.00 0.00 0.0000 0.0000 505841.12 505841.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.88 64.81% 12592.92 11787 15408 12593.72 12073 13213 237726 237726 0.00
crit 10.25 35.19% 26155.27 24281 31740 26166.71 24524 29088 268115 268115 0.00
DPS Timeline Chart

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73681
  • name:Unleash Wind
  • school:physical
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
windfury_mh 5392 4.8% 115.3 11.56sec 21068 0 15221 31661 21068 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.32 115.32 0.00 0.00 0.0000 0.0000 2429587.16 2429587.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.30 64.43% 15220.66 14330 18878 15222.16 14681 15786 1130923 1130923 0.00
crit 41.02 35.57% 31660.53 29520 38888 31665.94 30331 33521 1298665 1298665 0.00
DPS Timeline Chart

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33757
  • name:Windfury Weapon (Passive)
  • school:nature
  • tooltip:(null)
  • description:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_main_hand 3118 2.7% 28.0 13.48sec 49746 36714 34354 72146 49746 40.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.01 28.01 0.00 0.00 1.3550 0.0000 1393330.49 1393330.49 0.00 36713.93 36713.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.60 59.27% 34353.50 30669 41319 34380.10 31494 38194 570314 570314 0.00
crit 11.41 40.73% 72145.92 63179 85118 72193.91 65047 82379 823016 823016 0.00
DPS Timeline Chart

Action details: windlash_main_hand

Static Values
  • id:114089
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Wind Lash
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_off_hand 1587 1.4% 28.4 13.27sec 24916 17862 17191 36109 24916 40.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.45 28.45 0.00 0.00 1.3949 0.0000 708831.41 708831.41 0.00 17862.34 17862.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.83 59.16% 17190.99 15335 20660 17204.38 15811 18758 289346 289346 0.00
crit 11.62 40.84% 36108.89 31590 42559 36130.10 32560 41104 419486 419486 0.00
DPS Timeline Chart

Action details: windlash_off_hand

Static Values
  • id:114093
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Wind Lash Off-Hand
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 13657 / 3604
melee 7040 1.6% 261.2 3.12sec 3201 3571 2408 4915 3201 37.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 261.19 261.19 0.00 0.00 0.8964 0.0000 835978.55 835978.55 0.00 3570.77 3570.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.33 38.80% 2408.42 2190 3326 2409.50 2240 2573 244047 244047 0.00
crit 97.16 37.20% 4915.04 4380 6651 4916.29 4546 5269 477526 477526 0.00
glance 62.70 24.01% 1824.70 1643 2494 1825.28 1697 1968 114405 114405 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 6617 1.5% 39.7 10.84sec 19788 12831 14291 29102 19788 37.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.75 39.75 0.00 0.00 1.5423 0.0000 786527.51 786527.51 0.00 12830.79 12830.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.99 62.88% 14291.30 12732 19692 14296.48 13177 15582 357207 357207 0.00
crit 14.75 37.12% 29102.14 25465 39384 29127.58 25929 32777 429321 429321 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40
pet - greater_fire_elemental 33034 / 8918
fire_blast 1875 0.4% 20.0 18.72sec 11243 0 8151 16841 11243 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 19.98 0.00 0.00 0.0000 0.0000 224685.86 224685.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.87 64.42% 8150.93 7084 12244 8146.92 7292 9185 104927 104927 0.00
crit 7.11 35.58% 16841.21 14168 24488 16853.93 0 22604 119759 119759 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 31159 7.3% 137.6 2.62sec 27137 33540 20470 42503 27137 35.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.62 137.62 0.00 0.00 0.8091 0.0000 3734637.70 3734637.70 0.00 33540.23 33540.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.65 40.44% 20470.14 18227 30254 20470.14 19171 22054 1139257 1139257 0.00
crit 48.91 35.54% 42503.41 36454 60509 42505.12 39286 45848 2078772 2078772 0.00
glance 33.06 24.02% 15627.10 13670 22691 15627.06 14124 17408 516609 516609 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 5340 / 1434
earth_melee 5340 1.3% 97.1 3.72sec 6560 5548 5013 10257 6560 35.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.14 97.14 0.00 0.00 1.1825 0.0000 637239.61 637239.61 0.00 5547.92 5547.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.77 40.94% 5013.49 4538 6746 5013.32 4693 5385 199382 199382 0.00
crit 34.05 35.05% 10256.83 9075 13492 10256.27 9449 11139 349212 349212 0.00
glance 23.32 24.01% 3800.97 3403 5060 3800.96 3455 4183 88645 88645 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3975 / 2870
searing_bolt 3975 2.6% 201.2 2.22sec 6459 0 5538 11501 6462 15.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.21 201.12 0.00 0.00 0.0000 0.0000 1299631.58 1299631.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.96 84.51% 5538.12 4883 8353 5540.30 5316 5775 941275 941275 0.00
crit 31.16 15.49% 11501.25 10060 17207 11508.65 10288 12637 358357 358357 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.9 0.0 182.7sec 182.7sec 9.67% 9.67%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:9.7%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.13% 14.13%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.23%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.6 7.1 38.2sec 23.1sec 39.36% 38.72%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:39.4%
dancing_steel_oh 9.0 3.3 48.0sec 34.1sec 27.91% 27.50%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:27.9%
flurry 15.8 188.6 28.8sec 2.2sec 94.83% 92.77%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_flurry
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:8.7%
  • flurry_2:1.1%
  • flurry_3:28.5%
  • flurry_4:3.9%
  • flurry_5:52.7%

Spelldata details

  • id:16278
  • name:Flurry
  • tooltip:Attack speed increased by $s1%. Haste from items increased by $s2%.
  • description:$@spelldesc16282
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
maelstrom_weapon 74.1 144.4 6.1sec 2.1sec 72.27% 63.79%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • maelstrom_weapon_1:22.9%
  • maelstrom_weapon_2:20.8%
  • maelstrom_weapon_3:13.6%
  • maelstrom_weapon_4:8.3%
  • maelstrom_weapon_5:6.6%

Spelldata details

  • id:53817
  • name:Maelstrom Weapon
  • tooltip:Reduces the cast time and mana cost of your next Nature spell with a base cast time shorter than 10 seconds by $53817s1%.$?$w3!=0[ Next spell's healing effectiveness increased by $w3%.][]
  • description:$@spelldesc51530
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_xuen 7.4 0.0 64.0sec 64.0sec 24.38% 24.38%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.4%
searing_flames 40.2 298.6 11.3sec 1.3sec 93.38% 94.91%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_searing_flames
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • searing_flames_1:12.8%
  • searing_flames_2:12.8%
  • searing_flames_3:12.7%
  • searing_flames_4:12.5%
  • searing_flames_5:42.5%

Spelldata details

  • id:77657
  • name:Searing Flames
  • tooltip:(null)
  • description:When your Searing Totem deals damage or your Fire Elemental lands a melee attack, the damage dealt by your Flametongue Weapon is increased by $77661s1% for $77661d. Stacks up to 5 times. Your Lava Lash ability will consume this effect, dealing $s1% increased damage for each application present.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
spiritwalkers_grace 2.0 0.0 170.5sec 170.5sec 6.76% 4.20%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_spiritwalkers_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • spiritwalkers_grace_1:6.8%

Spelldata details

  • id:79206
  • name:Spiritwalker's Grace
  • tooltip:Able to move while casting Shaman spells that have a cast time.
  • description:Calls upon spiritual guidance, permitting movement while casting non-instant Shaman spells. This spell may be cast while casting other spells. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
synapse_springs_2 7.9 0.0 60.6sec 60.7sec 17.45% 17.45%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
terror_in_the_mists 7.4 0.0 64.5sec 64.5sec 32.27% 32.27%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.3%
unleash_flame 29.1 0.0 15.7sec 15.7sec 38.84% 99.91%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_flame_1:38.8%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:1.01%
unleash_wind 29.1 0.0 15.7sec 15.7sec 25.51% 33.99%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_wind
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_wind_1:0.4%
  • unleash_wind_2:9.2%
  • unleash_wind_3:0.4%
  • unleash_wind_4:9.1%
  • unleash_wind_5:0.4%
  • unleash_wind_6:6.1%

Spelldata details

  • id:73681
  • name:Unleash Wind
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.01%
unleashed_fury_wf 29.1 0.0 15.7sec 15.7sec 51.29% 55.77%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_wf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_wf_1:51.3%

Spelldata details

  • id:118472
  • name:Unleashed Fury
  • tooltip:Your melee autoattacks can trigger Static Shock.
  • description:Your melee autoattacks can trigger Static Shock.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 60.2sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
lightning_shield

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:100.0%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Enhancement_T14H
ascendance Mana 2.9 2285.3 780.0 780.0 0.0
bloodlust Mana 1.0 3070.1 3225.0 3225.0 0.0
earth_elemental_totem Mana 2.0 8430.0 4215.0 4215.0 0.0
earth_shock Mana 45.4 98031.3 2160.0 2160.0 30.7
feral_spirit Mana 4.1 7447.2 1800.0 1800.0 0.0
fire_elemental_totem Mana 2.0 8069.5 4034.8 4034.8 0.0
flame_shock Mana 13.9 24828.0 1785.0 1785.0 131.6
lava_lash Mana 39.2 94192.1 2400.0 2400.0 62.4
searing_totem Mana 6.9 6099.8 885.0 885.0 0.0
spiritwalkers_grace Mana 2.0 4230.0 2115.0 2115.0 0.0
stormblast Mana 5.8 32620.5 5621.0 5621.0 49.8
stormstrike Mana 46.1 259956.3 5640.0 5640.0 18.3
unleash_elements Mana 29.1 35828.6 1229.8 1229.8 42.8
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.50 102979.52 57.16 32133.07 23.78%
primal_wisdom Mana 269.58 479199.42 1777.60 329532.57 40.75%
Resource RPS-Gain RPS-Loss
Mana 1292.30 1298.76
Combat End Resource Mean Min Max
Health 459513.00 459513.00 459513.00
Mana 57065.38 45019.25 60000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
windfury_mh_maelstrom 50.0 14.1sec
windfury_mh_maelstrom_wasted 3.4 118.0sec
melee_main_hand_maelstrom 71.8 6.2sec
melee_main_hand_maelstrom_wasted 3.9 85.7sec
windlash_main_hand_maelstrom 12.2 32.0sec
windlash_main_hand_maelstrom_wasted 2.2 118.8sec
melee_off_hand_maelstrom 71.4 6.2sec
melee_off_hand_maelstrom_wasted 3.8 85.5sec
windlash_off_hand_maelstrom 12.3 31.4sec
windlash_off_hand_maelstrom_wasted 2.1 122.7sec
lava_lash_maelstrom 17.1 25.4sec
lava_lash_maelstrom_wasted 0.6 149.3sec
unleash_wind_maelstrom 12.6 34.4sec
unleash_wind_maelstrom_wasted 1.0 148.3sec
stormblast_mh_maelstrom 2.5 133.8sec
stormblast_mh_maelstrom_wasted 0.2 149.9sec
stormblast_oh_maelstrom 2.5 134.0sec
stormblast_oh_maelstrom_wasted 0.2 154.2sec
stormstrike_mh_maelstrom 20.0 21.6sec
stormstrike_mh_maelstrom_wasted 0.2 156.4sec
stormstrike_oh_maelstrom 20.0 21.7sec
stormstrike_oh_maelstrom_wasted 0.2 154.0sec
hat_donor 127.0 4.2sec
maelstrom_weapon 292.4 1.7sec
static_shock 161.4 3.0sec
swings_clipped_mh 26.3 16.0sec
swings_clipped_oh 26.2 16.0sec
uf_flame_shock 18.0 25.3sec
uf_wasted 14.8 29.6sec
wasted_maelstrom_weapon 17.9 26.2sec
windfury 38.4 11.6sec
maelstrom_weapon_stack_2 17.5 23.7sec
maelstrom_weapon_stack_3 16.2 25.4sec
maelstrom_weapon_stack_4 13.1 31.1sec
maelstrom_weapon_stack_5 26.5 16.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 113310.07
Minimum 104144.19
Maximum 125275.76
Spread ( max - min ) 21131.57
Range [ ( max - min ) / 2 * 100% ] 9.32%
Standard Deviation 2816.1498
5th Percentile 108837.68
95th Percentile 118055.69
( 95th Percentile - 5th Percentile ) 9218.00
Mean Distribution
Standard Deviation 28.1671
95.00% Confidence Intervall ( 113254.86 - 113365.28 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2372
0.1 Scale Factor Error with Delta=300 67701
0.05 Scale Factor Error with Delta=300 270804
0.01 Scale Factor Error with Delta=300 6770101
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 113310.07

Damage

Sample Data
Count 9996
Mean 43445532.94

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 292.10
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 windfury_weapon,weapon=main
3 0.00 flametongue_weapon,weapon=off
4 0.00 lightning_shield,if=!buff.lightning_shield.up
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 0.00 wind_shear
8 0.95 bloodlust,if=target.health.pct<25|time>5
9 5.00 auto_attack
A 7.94 use_item,name=firebirds_grips
B 1.00 virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
C 0.00 run_action_list,name=single,if=num_targets=1
D 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
U 4.31 blood_fury
V 0.00 elemental_mastery,if=talent.elemental_mastery.enabled
W 2.00 fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
X 2.93 ascendance,if=cooldown.strike.remains>=3
Y 6.89 searing_totem,if=!totem.fire.active
Z 29.13 unleash_elements,if=talent.unleashed_fury.enabled
a 0.00 elemental_blast,if=talent.elemental_blast.enabled
b 19.38 lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
c 5.80 stormblast
d 10.15 flame_shock,if=buff.unleash_flame.up&!ticking
e 46.09 stormstrike
f 39.25 lava_lash
g 0.00 unleash_elements
h 20.45 lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
i 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
j 0.00 lightning_bolt,if=buff.ancestral_swiftness.up
k 3.76 flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
l 45.38 earth_shock
m 4.14 feral_spirit
n 2.00 earth_elemental_totem,if=!active
o 1.71 spiritwalkers_grace,moving=1
p 33.82 lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

Sample Sequence

9AUYZde8WXcbflmncbZlfhelpfeZbdpeflpoZl9efblpABeZfYdheplfpZehlfelpZhefdhelpfZhelfpAUelZYpfekm9leZfblpelfpeZlhfehlpeZdfbpeAlYflZbeXcblfbclZbfdepolZ9efhleplfZhekUhAfYelpZpmefhlpelZfbedhfelZbplefhlpeZlAWd9efplZbehlfhnelpZflebhlfepZdhpefblpeUZAflYheplfmpZdeXcbflclZbfbelhpfeZdbefhlApZYebfleplZfbedp

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 21403 19019 18031
Stamina 22365 20332 20170
Intellect 251 239 80
Spirit 251 251 80
Health 459513 431051 0
Mana 60000 60000 0
Spell Power 26113 21111 0
Spell Hit 15.06% 15.06% 2568
Spell Crit 14.19% 9.19% 4137
Spell Haste 13.02% 7.64% 3245
Mana Per 5 1500 1500 0
Attack Power 47478 38383 0
Melee Hit 7.55% 7.55% 2568
Melee Crit 31.81% 24.92% 4137
Melee Haste 7.64% 7.64% 3245
Swing Speed 18.40% 7.64% 3245
Expertise 7.51% / 7.51% 7.51% / 7.51% 2214
Armor 25465 25465 25465
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.22% 37.22% 6364

Gear

Average Item Level: 507.81
Head firebirds_helmet,id=87136,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders waterborne_shoulderguards,id=90505,gems=320agi_60agi,enchant=200agi_100crit,reforge=exp_mastery
Shirt empty
Chest firebirds_cuirass,id=87134,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all,reforge=crit_hit
Waist rangers_chain_of_unending_summer,id=87182,gems=80agi_160hit_160agi_60haste,reforge=haste_mastery
Legs firebirds_legguards,id=87137,gems=320agi_60agi,enchant=285agi_165crit,reforge=haste_mastery
Feet monstrous_stompers,id=86985,gems=80agi_160mastery_120haste,enchant=140agi,reforge=crit_mastery
Wrists jagged_hornet_bracers,id=86997,enchant=180agi
Hands firebirds_grips,id=87135,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 painful_thorned_ring,id=86974,reforge=exp_haste
Finger2 regails_band_of_the_endless,id=90503,reforge=crit_mastery
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=exp_mastery
Off Hand claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Enhancement_T14H"
origin="unknown"
level=90
race=orc
spec=enhancement
role=attack
position=back
professions=engineering=600/jewelcrafting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/windfury_weapon,weapon=main
actions.precombat+=/flametongue_weapon,weapon=off
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/auto_attack
actions+=/use_item,name=firebirds_grips
actions+=/virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=blood_fury
actions.ae+=/ascendance,if=cooldown.strike.remains>=3
actions.ae+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.ae+=/magma_totem,if=num_targets>5&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=5&!totem.fire.active
actions.ae+=/fire_nova,if=(num_targets<=5&active_flame_shock=num_targets)|active_flame_shock>=5
actions.ae+=/lava_lash,if=dot.flame_shock.ticking
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>=3
actions.ae+=/unleash_elements
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking
actions.ae+=/stormblast
actions.ae+=/stormstrike
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
actions.ae+=/feral_spirit
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>1
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react>1

actions.single=blood_fury
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled
actions.single+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.single+=/ascendance,if=cooldown.strike.remains>=3
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
actions.single+=/stormblast
actions.single+=/flame_shock,if=buff.unleash_flame.up&!ticking
actions.single+=/stormstrike
actions.single+=/lava_lash
actions.single+=/unleash_elements
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
actions.single+=/lightning_bolt,if=buff.ancestral_swiftness.up
actions.single+=/flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
actions.single+=/earth_shock
actions.single+=/feral_spirit
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

head=firebirds_helmet,id=87136,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=waterborne_shoulderguards,id=90505,gems=320agi_60agi,enchant=200agi_100crit,reforge=exp_mastery
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=firebirds_cuirass,id=87134,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all,reforge=crit_hit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi
hands=firebirds_grips,id=87135,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=rangers_chain_of_unending_summer,id=87182,gems=80agi_160hit_160agi_60haste,reforge=haste_mastery
legs=firebirds_legguards,id=87137,gems=320agi_60agi,enchant=285agi_165crit,reforge=haste_mastery
feet=monstrous_stompers,id=86985,gems=80agi_160mastery_120haste,enchant=140agi,reforge=crit_mastery
finger1=painful_thorned_ring,id=86974,reforge=exp_haste
finger2=regails_band_of_the_endless,id=90503,reforge=crit_mastery
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=exp_mastery
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=18031
# gear_stamina=20170
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2214
# gear_hit_rating=2568
# gear_crit_rating=4137
# gear_haste_rating=3245
# gear_mastery_rating=6364
# gear_armor=25465
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=firebirds_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Warlock_Affliction_T14H : 124209 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
124208.7 124208.7 46.05 / 0.04% 3857 / 3.1% 17.5 6979.8 6405.6 Mana 0.00% 30.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
Glyphs
  • soul_shards

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:919527|499179|373627|285246|121352|109048|85309|47903|27337&chds=0,1839054&chco=C79C6E,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,435133,9482C9&chm=t++919527++summon_doomguard,C79C6E,0,0,15|t++499179++agony,9482C9,1,0,15|t++373627++corruption,9482C9,2,0,15|t++285246++unstable_affliction,9482C9,3,0,15|t++121352++haunt,9482C9,4,0,15|t++109048++drain_soul,9482C9,5,0,15|t++85309++malefic_grasp,9482C9,6,0,15|t++47903++fel_flame,435133,7,0,15|t++27337++soul_swap,9482C9,8,0,15&chtt=Warlock_Affliction_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,13,12,10,10,10,9,9,5,2,2,2,2,2,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,435133,9482C9,9482C9&chl=agony|unstable_affliction|corruption|haunt|agony_mg|malefic_grasp|unstable_affliction_mg|corruption_mg|drain_soul|agony_ds|unstable_affliction_ds|corruption_ds|doomguard: doom_bolt|fel_flame|soul_swap|felhunter: shadow_bite&chtt=Warlock_Affliction_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:gkoqtvxyxwy135653346786420ywwwwtrrrpoonlihgedddcbaZZaaZYYYYYZZaabbaZaaaabaaabbbccbcccddddddddddcccbbbbbaaaZZaaZZZZYYYYYYXWWWWWVVUUVVVVVWWWWXXXYYYYYZZZYYYYYYXXYYYZZZaabbbbccdddccccccbbbbbaaaaZZZZZZZZZZZZYYYXXWWWWWVVUVVVVVUVVVVVWWWWWWWWXXXXXXXXXYYYZZZabbcdeeeffffffffffffeeedccbbaaaZZZYYYXXWWVVUUUUTTTSTTTTTUUUVVWXXXYYZabcdddeefffffgggghhhhggfffeedddcccbbbaaaaaaaaabbbbcccddddeeeeffffffffffeeedddddccccccccdddeeeffgghhiiiijjjjjjjjjjjjjjjjjjjjiiiiiiihhhggggfffffeeeeeeeeeedddddeeeeeeeefffgghhiijjkklllllmmmllllkkkjjjiihhhhggggggffffeeeddcccbbaaZZZYYYXXXW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=124209|max=255379&chxp=1,1,49,100&chtt=Warlock_Affliction_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,1,6,8,15,19,27,50,91,118,184,250,323,375,425,535,557,609,631,648,689,642,592,517,476,434,381,282,259,202,152,141,98,73,45,43,32,19,14,10,9,2,5,2,0,1,2,1&chds=0,689&chbh=5&chxt=x&chxl=0:|min=115599|avg=124209|max=134808&chxp=0,1,45,100&chtt=Warlock_Affliction_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.1,12.9,10.4,5.3,4.2,3.8,3.4,3.2,2.1,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,435133,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=malefic_grasp 243.5s|drain_soul 58.1s|haunt 46.7s|unstable_affliction 24.1s|fel_flame 18.8s|corruption 17.2s|agony 15.4s|life_tap 14.6s|soul_swap 9.3s|summon_doomguard 1.0s&chtt=Warlock_Affliction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Affliction_T14H 124209
agony 17108 13.8% 13.5 28.63sec 571508 499179 0 0 0 0.0% 0.0% 0.0% 0.0% 347.5 18594 38676 22153 17.7% 0.0% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.47 22.48 347.46 347.46 1.1449 1.2916 7697345.86 7697345.86 0.00 16582.21 499179.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 285.9 82.28% 18593.98 11506 26025 18599.88 17561 19847 5315493 5315493 0.00
crit 61.6 17.72% 38676.34 23703 53612 38685.81 35303 42458 2381853 2381853 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_ds 2985 2.4% 38.1 2.08sec 35388 0 29658 61579 35388 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.0000 0.0000 1347840.22 1347840.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.25 82.05% 29657.82 21457 39038 29685.33 26467 33689 926825 926825 0.00
crit 6.84 17.95% 61578.66 44201 80418 61609.62 0 80418 421015 421015 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_mg 12334 9.9% 338.5 1.08sec 16406 0 13779 28659 16406 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 338.52 338.52 0.00 0.00 0.0000 0.0000 5553695.09 5553695.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.76 82.35% 13779.03 9780 19519 13784.68 12837 14896 3841076 3841076 0.00
crit 59.76 17.65% 28658.91 20147 40209 28667.50 25853 32118 1712619 1712619 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
blood_fury 0 0.0% 4.3 121.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
corruption 14262 11.5% 15.2 25.76sec 422207 373627 0 0 0 0.0% 0.0% 0.0% 0.0% 344.3 15664 32549 18641 17.6% 0.0% 99.6%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 24.21 344.28 344.28 1.1300 1.3035 6417786.84 6417786.84 0.00 13773.70 373626.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 283.6 82.37% 15664.30 12101 22018 15670.15 14964 16733 4441980 4441980 0.00
crit 60.7 17.63% 32549.30 24929 45358 32562.03 29465 35961 1975807 1975807 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_ds 2527 2.0% 38.1 2.08sec 29965 0 25100 52070 29965 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.0000 0.0000 1141283.69 1141283.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.22 81.96% 25099.83 18152 33028 25126.42 22723 28360 783549 783549 0.00
crit 6.87 18.04% 52070.19 37394 68037 52044.86 0 68037 357735 357735 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_mg 10419 8.4% 338.5 1.08sec 13858 0 11642 24196 13858 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 338.52 338.52 0.00 0.00 0.0000 0.0000 4691084.27 4691084.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.78 82.35% 11641.87 9076 16514 11647.76 10857 12537 3245472 3245472 0.00
crit 59.75 17.65% 24196.26 18697 34018 24208.71 21985 26451 1445613 1445613 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.0 81.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.03 6.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
drain_soul 5756 (14019) 4.7% (11.3%) 16.9 4.86sec 375202 109048 0 0 0 0.0% 0.0% 0.0% 0.0% 38.1 57207 118722 68271 18.0% 0.0% 12.0%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.88 16.88 38.09 38.09 3.4407 1.4197 2600296.69 2600296.69 0.00 109048.44 109048.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.2 82.01% 57206.82 41348 75232 57250.21 52452 63045 1786963 1786963 0.00
crit 6.9 17.99% 118721.96 85177 154978 118693.31 0 154978 813333 813333 0.00
DPS Timeline Chart

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=20
Spelldata
  • id:1120
  • name:Drain Soul
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the warlock's other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage, every $t1 seconds.
  • description:Drains the soul of the target, causing ${$m1+$SP*0.375} Shadow damage every $t1 sec and energizing one Soul Shard after it deals damage twice. If the target dies, three Soul Shards are energized. Lasts $d. If the target is at or below $s3% health when Drain Soul deals damage, it deals $s6% additional damage and causes all of your other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.390000
  • base_td:416.60
  • num_ticks:6
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
fel_flame 2034 1.6% 15.7 17.64sec 57337 47903 48384 100178 57337 17.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.68 15.68 0.00 0.00 1.1970 0.0000 899087.85 899087.85 0.00 47902.81 47902.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.97 82.71% 48384.47 39756 65714 48374.56 40898 56859 627556 627556 0.00
crit 2.71 17.29% 100178.48 81898 135372 94823.59 0 124206 271532 271532 0.00
DPS Timeline Chart

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77799
  • name:Fel Flame
  • school:shadowflame
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy and increases the duration of $?s603[Doom]?s111546[Immolate][Corruption]$?s30108[ and Unstable Affliction][] by $s2 sec.$?s29722[ Generates Burning Embers. Critical strikes double this effect.][]$?a104315[ Generates 15 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.750000
  • base_dd_min:761.09
  • base_dd_max:841.21
haunt 12598 10.1% 41.1 11.06sec 137963 121352 116703 242832 138800 17.5% 0.0% 0.0% 0.0% 160.4 0 0 0 0.0% 0.0% 71.2%

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.11 40.86 160.43 160.43 1.1369 2.0000 5671855.17 5671855.17 0.00 15429.63 121351.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.70 82.48% 116703.43 92764 168786 116668.92 106969 124888 3933452 3933452 0.00
crit 7.16 17.52% 242832.28 191095 347699 242718.97 0 347699 1738403 1738403 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.4 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight_to_target&remains
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.750000
  • base_dd_min:1869.36
  • base_dd_max:1869.36
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
life_tap 0 0.0% 12.7 33.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 0.00 0.00 1.1474 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<35
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
malefic_grasp 12020 (46140) 9.7% (37.2%) 99.5 3.68sec 208684 85309 0 0 0 0.0% 0.0% 0.0% 0.0% 338.5 13452 27927 15987 17.5% 0.0% 50.9%

Stats details: malefic_grasp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.55 99.55 338.52 338.52 2.4462 0.6772 5411997.57 5411997.57 0.00 85308.95 85308.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 279.2 82.49% 13452.40 10602 19291 13458.51 12803 14197 3756430 3756430 0.00
crit 59.3 17.51% 27926.74 21841 39739 27942.32 25575 30272 1655568 1655568 0.00
DPS Timeline Chart

Action details: malefic_grasp

Static Values
  • id:103103
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103103
  • name:Malefic Grasp
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the Warlock's other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage, every $t1 seconds.
  • description:Binds the target in twilight, causing $103103o1 Shadow damage over $103103d. Every $t1 sec, when Malefic Grasp deals damage, it causes all of your other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
soul_swap 567 0.5% 9.0 55.21sec 28333 27337 23757 49167 28333 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_swap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.01 9.01 0.00 0.00 1.0364 0.0000 255245.76 255245.76 0.00 27337.02 27337.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.39 81.99% 23756.57 17669 32150 23786.64 20285 27125 175470 175470 0.00
crit 1.62 18.01% 49167.12 36399 66228 40474.93 0 66228 79776 79776 0.00
DPS Timeline Chart

Action details: soul_swap

Static Values
  • id:86121
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:18000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.soulburn.up
Spelldata
  • id:86121
  • name:Soul Swap
  • school:shadow
  • tooltip:(null)
  • description:You instantly deal $86121s1 damage$?s56226[ and copy your Shadow damage-over-time effects from the target][, and remove your Shadow damage-over-time effects from the target]. For $86211d afterwards, the next target you cast Soul Swap: Exhale on will be afflicted by the Shadow damage-over-time effects and suffer $86121s1 damage. You cannot Soul Swap to the same target.$?s74434&!s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Corruption, Unstable Affliction and Agony.|r][]$?s74434&s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Doom, Unstable Affliction and Agony.|r][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:534.10
  • base_dd_max:534.10
soulburn 0 0.0% 9.3 53.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.33 9.33 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
Spelldata
  • id:74434
  • name:Soulburn
  • school:shadow
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
summon_doomguard 0 (2147) 0.0% (1.7%) 1.0 1.#Rsec 952630 919527 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 919526.78 919526.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
unstable_affliction 15275 12.3% 21.1 20.66sec 325000 285246 0 0 0 0.0% 0.0% 0.0% 0.0% 338.2 17070 35487 20321 17.7% 0.0% 99.5%

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.15 30.16 338.24 338.24 1.1394 1.3254 6873291.43 6873291.43 0.00 14549.42 285246.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.5 82.35% 17069.63 13200 24018 17076.89 16286 17915 4754474 4754474 0.00
crit 59.7 17.65% 35487.41 27193 49478 35500.80 32698 38674 2118818 2118818 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_ds 2751 2.2% 38.1 2.08sec 32622 0 27327 56752 32622 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.0000 0.0000 1242476.84 1242476.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.23 82.01% 27327.24 19800 36028 27354.55 24670 30885 853539 853539 0.00
crit 6.85 17.99% 56751.59 40789 74217 56756.20 0 74217 388938 388938 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_mg 11367 9.2% 338.5 1.08sec 15117 0 12702 26414 15117 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 338.52 338.52 0.00 0.00 0.0000 0.0000 5117572.16 5117572.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.88 82.38% 12701.51 9900 18014 12708.91 12016 13507 3542202 3542202 0.00
crit 59.64 17.62% 26414.28 20394 37108 26429.51 24132 28947 1575371 1575371 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
pet - felhunter 0 / 59
shadow_bite 0 0.0% 1.0 1.#Rsec 26247 25335 22118 44236 26247 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% -1.$%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0360 0.0000 26247.00 26247.00 0.00 25334.94 25334.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.81 81.33% 22118.11 22118 22118 17989.22 0 22118 17989 17989 0.00
crit 0.19 18.67% 44236.22 44236 44236 8257.78 0 44236 8258 8258 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:(null)
  • description:Bite the enemy, causing $s1 Shadow damage.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - doomguard 15877 / 2147
doom_bolt 15877 1.7% 21.7 2.73sec 43859 16125 36884 75097 43859 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.72 21.72 0.00 0.00 2.7200 0.0000 952629.74 952629.74 0.00 16124.95 16124.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.76 81.75% 36884.17 32420 47201 36877.49 33788 39355 654901 654901 0.00
crit 3.96 18.25% 75097.16 64840 94401 74209.39 0 94401 297729 297729 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 121.3sec 121.2sec 14.05% 14.05%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.75%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.0 0.0 81.3sec 81.2sec 26.27% 27.90%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.3%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 7.8 0.0 61.6sec 61.6sec 33.69% 33.69%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.7%
jade_serpent_potion 2.0 0.0 369.4sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 9.1 0.0 52.2sec 52.2sec 23.82% 23.83%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.8%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.2 0.0 51.3sec 51.3sec 30.28% 30.28%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.3%
soulburn 9.1 0.3 54.7sec 53.0sec 0.52% 90.01%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_soulburn
  • max_stacks:1
  • duration:30.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • soulburn_1:0.5%

Spelldata details

  • id:74434
  • name:Soulburn
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
  • max_stacks:
  • duration:30.00
  • cooldown:1.00
  • default_chance:0.00%
synapse_springs_2 7.9 0.0 61.1sec 61.1sec 17.31% 17.31%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
grimoire_of_sacrifice

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:1022.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.0%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[$@spelldesc132612][]$?$w4>0[$@spelldesc132613][]$?$w5>0[$@spelldesc132614][] $?s108415[ Maximum health increased by $108503s7%.][] Restores $108503s2% of maximum health every $108503t2 sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[$s5% to $s3][]$?c1[$s3][]$?c2[$s4][]$?c3[$s5][]%$?s108415[, increase your maximum health by $s7%,][] and regenerate $s2% of maximum health every $t2 sec. Lasts for $d. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:1200.00
  • cooldown:120.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Affliction_T14H
agony Mana 13.5 40405.5 3000.0 3000.0 190.5
corruption Mana 15.2 57002.2 3750.0 3750.0 112.6
dark_soul Mana 6.0 90388.7 15000.0 15000.0 0.0
drain_soul Mana 55.0 418730.5 7618.3 24812.3 15.1
fel_flame Mana 15.7 235210.1 15000.0 15000.0 3.8
haunt Soul Shard 41.1 41.1 1.0 1.0 137963.3
malefic_grasp Mana 438.1 1971316.9 4500.0 19802.4 10.5
soul_swap Mana 9.0 162156.7 18000.0 18000.0 1.6
soulburn Soul Shard 9.3 9.3 1.0 1.0 0.0
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 12.7
unstable_affliction Mana 21.1 95168.5 4500.0 4500.0 72.2
pet - felhunter
shadow_bite Energy 1.0 60.0 60.0 60.0 437.4
pet - doomguard
doom_bolt Energy 21.7 760.2 35.0 35.0 1253.1
Resource Gains Type Count Total Average Overflow
drain_soul Soul Shard 13.95 12.77 0.92 1.18 8.46%
life_tap Mana 12.75 928759.70 72855.33 8361.66 0.89%
mp5_regen Mana 1801.50 1956932.42 1086.28 5897.80 0.30%
nightfall Soul Shard 36.65 36.06 0.98 0.59 1.61%
pet - doomguard
energy_regen Energy 239.00 741.99 3.10 155.20 17.30%
Resource RPS-Gain RPS-Loss
Health 0.00 2080.19
Mana 6405.56 6979.83
Soul Shard 0.11 0.11
Combat End Resource Mean Min Max
Health -445752.04 -759616.25 -171526.25
Mana 40741.32 0.00 87041.55
Soul Shard 2.38 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.4%
felhunter-Mana Cap 0.4%
succubus-Mana Cap 0.4%
infernal-Mana Cap 0.4%
observer-Mana Cap 0.4%
shivarra-Mana Cap 0.4%
abyssal-Mana Cap 0.4%
service_felguard-Mana Cap 0.4%
service_imp-Mana Cap 0.4%
service_voidwalker-Mana Cap 0.4%

Procs

Count Interval
hat_donor 447.8 1.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 124208.75
Minimum 115599.35
Maximum 134807.66
Spread ( max - min ) 19208.32
Range [ ( max - min ) / 2 * 100% ] 7.73%
Standard Deviation 2349.0674
5th Percentile 120558.52
95th Percentile 128272.34
( 95th Percentile - 5th Percentile ) 7713.82
Mean Distribution
Standard Deviation 23.4954
95.00% Confidence Intervall ( 124162.70 - 124254.80 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1373
0.1 Scale Factor Error with Delta=300 47105
0.05 Scale Factor Error with Delta=300 188423
0.01 Scale Factor Error with Delta=300 4710582
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 124208.75

Damage

Sample Data
Count 9996
Mean 54920859.45

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 230.38
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.87 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.29 blood_fury
A 6.03 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 1.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>3
F 1.00 summon_doomguard
G 5.89 soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
H 9.01 soul_swap,if=buff.soulburn.up
I 41.54 haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
J 0.00 soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
K 0.00 haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
L 3.44 soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
M 0.05 agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
N 0.20 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
O 1.04 unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
P 13.42 agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
Q 15.01 corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
R 20.44 unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
S 16.64 drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
T 7.68 life_tap,if=mana.pct<35
U 54.11 malefic_grasp,chain=1
V 5.07 life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
W 15.68 fel_flame,moving=1
X 0.00 life_tap

Sample Sequence

79ACFGHIURPIQUIGHUIUIURUIQUTVWWVPWIUI7URIUQPUIUARUIUQUPRUIUQOU9I7UPRQUVVWWWWUIUPRIUQUAGHUIUIRU7TQUPIURUIUQUIRUPVWWWUIUQR9PU7AUIURUQIUTUIPURIUQIURUIPUQIRWTWW7WUIPURUIQAGHTUIURUGHTU8R9SI7SQSIPSRSISLHISISLHSIAGHSSTSISILHSGHS7SISISRSTSISLH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Soul Shard 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.67% 13.72% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 55.65% 40.14% 2972

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_haste
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Affliction_T14H"
origin="unknown"
level=90
race=orc
spec=affliction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
talent_override=grimoire_of_service,if=num_targets>3
glyphs=soul_shards

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>3
actions+=/summon_doomguard
actions+=/soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
actions+=/soul_swap,if=buff.soulburn.up
actions+=/haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
actions+=/soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
actions+=/haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
actions+=/soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
actions+=/agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
actions+=/drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
actions+=/life_tap,if=mana.pct<35
actions+=/malefic_grasp,chain=1
actions+=/life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/soulburn,cycle_targets=1,if=buff.soulburn.down&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target&shard_react
actions.aoe+=/seed_of_corruption,cycle_targets=1,if=(buff.soulburn.down&!in_flight_to_target&!ticking)|(buff.soulburn.up&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target)
actions.aoe+=/haunt,cycle_targets=1,if=!in_flight_to_target&debuff.haunt.remains<cast_time+travel_time&shard_react
actions.aoe+=/life_tap,if=mana.pct<70
actions.aoe+=/fel_flame,cycle_targets=1,if=!in_flight_to_target

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warlock_Demonology_T14H : 118493 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
118492.5 118492.5 49.04 / 0.04% 4104 / 3.5% 11.0 6734.4 6245.2 Mana 0.00% 55.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
Glyphs
  • shadow_bolt

Charts

http://6.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:913205|532161|492266|81499|66548|58263|34886|32257|10761&chds=0,1826409&chco=C79C6E,9482C9,9482C9,435133,FF6F00,C41F3B,9482C9,435133,9482C9&chm=t++913205++summon_doomguard,C79C6E,0,0,15|t++532161++service_felguard,9482C9,1,0,15|t++492266++doom,9482C9,2,0,15|t++81499++hand_of_guldan,435133,3,0,15|t++66548++touch_of_chaos,FF6F00,4,0,15|t++58263++soul_fire,C41F3B,5,0,15|t++34886++shadow_bolt,9482C9,6,0,15|t++32257++fel_flame,435133,7,0,15|t++10761++melee,9482C9,8,0,15&chtt=Warlock_Demonology_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:26,21,17,16,14,12,11,7,7,6,6,4,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,C41F3B,C79C6E,9482C9,9482C9,9482C9,C79C6E,C79C6E,435133,9482C9,9482C9,C79C6E,C79C6E,435133,435133,C79C6E&chl=touch_of_chaos|soul_fire|wild_imp: firebolt|felguard: melee|doom|corruption|shadow_bolt|felguard: felstorm|felguard: legion_strike|shadowflame|melee|doomguard: doom_bolt|service_felguard: felstorm|service_felguard: melee|hand_of_guldan|fel_flame|service_felguard: legion_strike&chtt=Warlock_Demonology_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:pqrtvx333434455875331100zwtomljkkkjjhggghgggddddeeddaaZZZabbbaaaaccccbbbcceeffeeefggiihijjjjjihgffeddccbaYYXXWWWWWYZZbbbbccccccbdcddddccbaYZYYYYYYXXXWWWWXXYZZabaccddeffghihiihgggffedccbcbaaZYXXWWWXXXXWWWWWWVVVVWWWVWVVUUTTUUVWWWWWWXWWXYZcdfghijkkklmnnopqqponljihhgfeeedcbaaZYZaaaaaaZYXXXWWWWWWWVVUTTSTTTTUUUVVUVVVVWXYZabddefghijkllmnnnnmmkkjiihgfeccbaaZZYYZZabccddeeeeffgggggggggfeedddcbbbbbbabaaaaaabbcdeefghiijjkklllllkkjiihhgfeedccbaaaZaZaaZZZZYYYZZZZaaZaaaZZZZaZaZZZZZZZZZZaacdfghijllnnpqrstuuuttsqpoonmkjihgfedcbbaaaaaaaaaaaaaaaaaaZZZZZYYYYYXXXWWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=118493|max=235614&chxp=1,1,50,100&chtt=Warlock_Demonology_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,7,4,10,14,33,57,76,113,133,205,245,308,383,461,499,505,581,581,607,538,561,539,499,471,415,358,337,273,214,197,149,164,111,80,74,59,28,25,17,25,12,6,5,4,2,3,1,3&chds=0,607&chbh=5&chxt=x&chxl=0:|min=110533|avg=118493|max=128827&chxp=0,1,44,100&chtt=Warlock_Demonology_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.0,26.7,22.7,8.1,5.0,4.1,2.1,1.3,0.3,0.3&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,9482C9,435133,435133,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=touch_of_chaos 130.6s|soul_fire 120.2s|shadow_bolt 102.4s|hand_of_guldan 36.3s|fel_flame 22.4s|life_tap 18.3s|doom 9.6s|service_felguard 5.6s|corruption 1.3s|summon_doomguard 1.3s&chtt=Warlock_Demonology_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Demonology_T14H 118493
blood_fury 0 0.0% 4.3 120.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 14.0 28.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.98 13.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 8717 7.4% 1.0 301.64sec 3909445 2987618 0 0 0 0.0% 0.1% 0.0% 0.0% 286.3 11484 23897 13701 17.9% 0.0% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 286.30 286.30 1.3085 1.5616 3922742.51 3922742.51 0.00 8748.47 2987618.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.00 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 235.2 82.14% 11484.16 9509 17236 11490.68 10785 12129 2700643 2700643 0.00
crit 51.1 17.86% 23897.20 19588 35506 23914.41 21144 26595 1222099 1222099 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.06 6.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 10490 8.8% 9.2 47.05sec 510245 492266 0 0 0 0.0% 0.1% 0.0% 0.0% 39.2 100298 209205 120268 18.3% 0.0% 97.7%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.24 9.24 39.18 39.18 1.0365 11.2281 4712464.37 4712464.37 0.00 10483.28 492266.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.23 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.0 81.66% 100297.96 58981 132149 100482.48 86074 110588 3209314 3209314 0.00
crit 7.2 18.34% 209204.60 121500 272228 209372.18 0 272228 1503151 1503151 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:1068.20
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
fel_flame 1624 1.4% 17.7 15.36sec 40804 32257 34380 71016 40804 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fel_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.70 17.70 0.00 0.00 1.2650 0.0000 722420.43 722420.43 0.00 32256.67 32256.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.57 82.32% 34380.18 32415 42511 34386.92 32575 36730 501082 501082 0.00
crit 3.12 17.60% 71015.89 66774 87573 68714.37 0 87573 221339 221339 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fel_flame

Static Values
  • id:77799
  • school:shadowflame
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77799
  • name:Fel Flame
  • school:shadowflame
  • tooltip:(null)
  • description:Deals $s1 Shadowflame damage to an enemy and increases the duration of $?s603[Doom]?s111546[Immolate][Corruption]$?s30108[ and Unstable Affliction][] by $s2 sec.$?s29722[ Generates Burning Embers. Critical strikes double this effect.][]$?a104315[ Generates 15 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.750000
  • base_dd_min:761.09
  • base_dd_max:841.21
hand_of_guldan 1888 (6572) 1.6% (5.5%) 29.6 15.26sec 99887 81499 12118 25316 14475 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.59 58.71 0.00 0.00 1.2256 0.0000 849757.87 849757.87 0.00 81498.70 81498.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.18 82.07% 12117.64 0 39171 12124.98 9179 15152 583787 583787 0.00
crit 10.51 17.90% 25316.30 0 80693 25347.99 0 62605 265971 265971 0.00
miss 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
life_tap 0 0.0% 14.8 28.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 0.00 0.00 1.2320 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 4140 3.5% 221.3 2.02sec 8423 10761 7115 14783 8476 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 221.34 219.95 0.00 0.00 0.7827 0.0000 1864298.07 1864298.07 0.00 10760.55 10760.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.58 82.10% 7115.11 4896 10969 7119.96 6729 7551 1284829 1284829 0.00
crit 39.20 17.82% 14783.39 10086 22597 14797.19 12661 17427 579469 579469 0.00
miss 0.17 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.083000
  • base_dd_min:84.23
  • base_dd_max:93.09
metamorphosis 0 0.0% 18.6 24.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.63 18.63 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 18.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felguard 0 (6675) 0.0% (5.6%) 4.3 120.89sec 696370 532161 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 1.3086 0.0000 0.00 0.00 0.00 532160.61 532160.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Felguard who attacks the target for $d. Felguard will stun their target when summoned.
shadow_bolt 7938 6.7% 156.2 6.60sec 22878 34886 19216 39984 22878 17.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.20 156.20 0.00 0.00 0.6558 0.0000 3573454.91 3573454.91 0.00 34886.46 34886.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.43 82.22% 19216.38 17616 31932 19225.76 18317 20442 2467944 2467944 0.00
crit 27.65 17.70% 39984.39 36289 65780 40015.82 36671 46560 1105511 1105511 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1281.84
  • base_dd_max:1281.84
shadowflame 4684 4.0% 29.3 15.27sec 71787 0 0 0 0 17.9% 0.0% 0.0% 0.0% 219.4 8032 16818 9599 17.8% 0.0% 37.4%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.34 29.34 219.41 219.41 0.0000 0.7679 2106199.81 2106199.81 0.00 12500.22 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.10 82.14% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.24 17.86% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.3 82.16% 8031.94 5921 20444 8040.28 7053 9063 1447900 1447900 0.00
crit 39.1 17.84% 16818.22 12197 42116 16832.35 13455 22568 658300 658300 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 15537 13.1% 73.5 5.91sec 95289 58263 0 96123 96053 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.51 72.93 0.00 0.00 1.6355 0.0000 7004879.15 7004879.15 0.00 58262.81 58262.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 72.87 99.93% 96123.09 74724 214301 96230.93 84498 107150 7004879 7004879 0.00
miss 0.05 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:672.97
  • base_dd_max:822.52
summon_doomguard 0 (2693) 0.0% (2.2%) 1.0 1.#Rsec 1195385 913205 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.3090 0.0000 0.00 0.00 0.00 913204.65 913204.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 19285 16.3% 126.0 3.53sec 68977 66548 57997 120290 69015 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.99 125.92 0.00 0.00 1.0365 0.0000 8690133.75 8690133.75 0.00 66547.72 66547.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.45 82.16% 57996.89 40066 89771 58040.13 53819 61623 5999789 5999789 0.00
crit 22.37 17.76% 120290.24 82537 184928 120378.47 96708 147461 2690345 2690345 0.00
miss 0.10 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.corruption.remains<20
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.666000
  • base_dd_min:675.85
  • base_dd_max:746.99
pet - doomguard 19923 / 2693
doom_bolt 19923 2.2% 20.8 2.83sec 57579 20231 48343 99425 57579 18.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.76 20.76 0.00 0.00 2.8460 0.0000 1195384.89 1195384.89 0.00 20231.27 20231.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.97 81.76% 48343.46 39650 71887 48333.16 42311 54636 820630 820630 0.00
crit 3.77 18.16% 99425.43 79299 143774 97985.39 0 143774 374755 374755 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 22151 / 22151
felstorm 5560 4.7% 10.3 45.75sec 242543 0 17863 35969 21057 17.7% 0.1% 0.0% 0.0% 71.7 27006 54484 31870 17.8% 0.1% 13.6%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.31 10.31 71.67 71.66 0.0000 0.8562 2501082.28 2501082.28 0.00 40760.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.48 82.20% 17862.92 15297 24823 17865.12 15827 22323 151415 151415 0.00
crit 1.83 17.72% 35969.41 30595 49645 30960.27 0 49645 65728 65728 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.9 82.14% 27006.04 22946 41194 27022.59 25498 28854 1589763 1589763 0.00
crit 12.7 17.78% 54484.09 45892 82387 54522.00 45892 71175 694176 694176 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 4985 4.2% 82.5 5.54sec 27182 26225 23022 46456 27182 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.52 82.52 0.00 0.00 1.0365 0.0000 2242958.70 2242958.70 0.00 26224.85 26224.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.74 82.10% 23022.02 19886 35701 23030.31 22027 23984 1559615 1559615 0.00
crit 14.71 17.83% 46456.31 39773 71402 46491.24 40654 55359 683344 683344 0.00
dodge 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 11606 9.8% 265.5 1.67sec 19678 13190 17562 35435 19678 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 265.53 265.53 0.00 0.00 1.4919 0.0000 5225113.57 5225113.57 0.00 13189.67 13189.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 154.43 58.16% 17561.58 15297 27462 17566.47 16959 18241 2712095 2712095 0.00
crit 47.19 17.77% 35435.25 30595 54925 35446.83 32873 39324 1672082 1672082 0.00
glance 63.71 23.99% 13198.94 11473 20597 13202.63 12275 14407 840936 840936 0.00
dodge 0.10 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.10 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - wild_imp 17477 / 12671
firebolt 17477 10.7% 355.0 1.25sec 16068 7311 15181 30594 17907 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 355.01 318.56 0.00 0.00 2.1977 0.0000 5704348.02 5704348.02 0.00 7311.26 7311.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 261.73 82.16% 15181.45 13216 23962 15185.24 14687 15800 3973397 3973397 0.00
crit 56.58 17.76% 30593.56 26432 47924 30605.30 28493 33346 1730951 1730951 0.00
miss 0.25 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47
pet - service_felguard 32641 / 6675
felstorm 13003 2.2% 4.3 120.90sec 277301 0 19824 39867 23455 18.2% 0.1% 0.0% 0.0% 29.9 30827 61902 36549 18.5% 0.1% 27.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 29.91 29.91 0.0000 0.8561 1194091.64 1194091.64 0.00 46635.10 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.52 81.72% 19823.65 15297 24801 19824.82 0 24576 69762 69762 0.00
crit 0.78 18.20% 39867.41 30595 49602 23052.67 0 49602 31237 31237 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.4 81.43% 30826.62 22946 41194 30834.88 27776 33907 750744 750744 0.00
crit 5.5 18.49% 61902.00 45892 82387 61749.63 0 79092 342350 342350 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 7483 1.3% 21.9 19.43sec 31488 30337 26457 53652 31488 18.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.85 21.85 0.00 0.00 1.0379 0.0000 688137.73 688137.73 0.00 30337.16 30337.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.78 81.34% 26456.67 19886 35701 26465.69 23520 29256 470320 470320 0.00
crit 4.06 18.58% 53651.91 39773 71402 52987.53 0 71402 217817 217817 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 12155 2.1% 48.9 8.45sec 22829 16043 20195 41081 22829 18.4% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.91 48.91 0.00 0.00 1.4229 0.0000 1116495.69 1116495.69 0.00 16043.45 16043.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.09 57.43% 20194.67 15297 27462 20201.39 18050 22523 567219 567219 0.00
crit 9.02 18.45% 41080.84 30595 54925 41106.48 0 53647 370636 370636 0.00
glance 11.76 24.04% 15192.13 11473 20597 15198.33 12282 19195 178641 178641 0.00
dodge 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.9sec 120.9sec 14.09% 14.09%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.98%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.9sec 80.9sec 26.41% 34.37%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 29.3 0.4 15.6sec 15.7sec 11.25% 11.63%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:11.2%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 7.5 0.0 63.0sec 63.0sec 32.72% 32.72%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.7%
jade_serpent_potion 2.0 0.0 369.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.2sec 54.2sec 22.74% 23.71%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.7%
metamorphosis 18.6 0.0 24.9sec 24.9sec 37.18% 60.36%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:37.2%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 20.1 60.8 17.6sec 5.4sec 59.04% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:24.2%
  • molten_core_2:11.5%
  • molten_core_3:5.7%
  • molten_core_4:3.5%
  • molten_core_5:2.7%
  • molten_core_6:2.3%
  • molten_core_7:2.1%
  • molten_core_8:1.8%
  • molten_core_9:1.5%
  • molten_core_10:1.2%
  • molten_core_11:0.9%
  • molten_core_12:0.6%
  • molten_core_13:0.4%
  • molten_core_14:0.3%
  • molten_core_15:0.2%
  • molten_core_16:0.1%
  • molten_core_17:0.1%
  • molten_core_18:0.0%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%
  • molten_core_24:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 9.0 0.0 52.2sec 52.2sec 29.46% 29.46%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.5%
synapse_springs_2 7.9 0.0 60.8sec 60.8sec 17.39% 17.39%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H
corruption Mana 1.0 3762.8 3750.0 3750.0 1042.5
dark_soul Mana 6.1 90868.8 15000.0 15000.0 0.0
doom Demonic Fury 9.2 554.1 60.0 60.0 8504.1
fel_flame Mana 17.7 265567.2 15000.0 15000.0 2.7
hand_of_guldan Mana 29.6 443894.1 15000.0 15000.0 6.7
shadow_bolt Mana 52.1 859530.2 16500.0 5502.8 4.2
soul_fire Mana 57.6 1295228.8 22505.4 17619.4 5.4
soul_fire Demonic Fury 16.0 1276.8 80.0 17.4 5486.3
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.9
touch_of_chaos Demonic Fury 126.0 5039.5 40.0 40.0 1724.4
pet - doomguard
doom_bolt Energy 20.8 726.6 35.0 35.0 1645.1
pet - felguard
felstorm Energy 10.3 618.7 60.0 60.0 4042.4
legion_strike Energy 82.5 4951.0 60.0 60.0 453.0
pet - wild_imp
firebolt Energy 355.0 355.0 1.0 1.0 16067.9
pet - service_felguard
felstorm Energy 4.3 258.4 60.0 60.0 4621.7
legion_strike Energy 21.9 1311.2 60.0 60.0 524.8
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 82.45 989.45 12.00 0.00 0.00%
wild_imp Demonic Fury 354.74 1773.68 5.00 0.00 0.00%
service_felguard Demonic Fury 21.84 262.04 12.00 0.00 0.00%
corruption Demonic Fury 287.30 1149.22 4.00 0.00 0.00%
metamorphosis Demonic Fury 161.71 -969.32 -5.99 -0.97 0.10%
shadowflame Demonic Fury 247.16 494.31 2.00 0.00 0.00%
soul_fire Demonic Fury 57.51 1725.31 30.00 0.00 0.00%
life_tap Mana 14.84 1091255.24 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 52.01 1300.31 25.00 0.00 0.00%
mp5_regen Mana 1801.50 1722215.52 955.99 61.81 0.00%
pet - doomguard
energy_regen Energy 240.00 708.47 2.95 146.75 17.16%
pet - felguard
energy_regen Energy 1801.50 5467.55 3.03 0.00 0.00%
pet - service_felguard
energy_regen Energy 367.15 1116.73 3.04 34.96 3.04%
Resource RPS-Gain RPS-Loss
Health 0.00 2422.33
Mana 6245.25 6734.44
Demonic Fury 17.08 17.40
Combat End Resource Mean Min Max
Health -600805.18 -980150.00 -245037.50
Mana 79051.47 6361.60 170803.24
Demonic Fury 54.95 0.00 290.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%
felhunter-Mana Cap 0.0%
succubus-Mana Cap 0.0%
infernal-Mana Cap 0.0%
observer-Mana Cap 0.0%
shivarra-Mana Cap 0.0%
abyssal-Mana Cap 0.0%
felguard-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
service_felguard-Mana Cap 0.0%
service_imp-Mana Cap 0.0%
service_voidwalker-Mana Cap 0.0%

Procs

Count Interval
hat_donor 97.5 4.5sec
wild_imp 36.4 12.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 118492.51
Minimum 110532.58
Maximum 128826.58
Spread ( max - min ) 18294.00
Range [ ( max - min ) / 2 * 100% ] 7.72%
Standard Deviation 2501.4199
5th Percentile 114653.84
95th Percentile 122862.40
( 95th Percentile - 5th Percentile ) 8208.56
Mean Distribution
Standard Deviation 25.0192
95.00% Confidence Intervall ( 118443.48 - 118541.55 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1711
0.1 Scale Factor Error with Delta=300 53414
0.05 Scale Factor Error with Delta=300 213656
0.01 Scale Factor Error with Delta=300 5341421
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 118492.51

Damage

Sample Data
Count 9996
Mean 33446350.86

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 413.14
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.91 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.31 blood_fury
A 6.06 dark_soul
B 4.31 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 18.56 melee
F 10.31 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=num_targets>5
I 1.00 summon_doomguard
J 1.00 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
K 9.24 doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
L 18.63 metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
M 13.98 cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
N 29.59 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O 44.14 touch_of_chaos,if=dot.corruption.remains<20
P 74.82 soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Q 81.85 touch_of_chaos
R 14.84 life_tap,if=mana.pct<50
S 53.90 shadow_bolt
T 17.70 fel_flame,moving=1
U 0.00 life_tap

Sample Sequence

79ABFIJLEKKOKNSSPNLEOOOOQQMSSNSSSSSRPSSSNSLEOOOOFMTTTTRPNPSS7PRSSLEOOOQQMNSSSALEKOQQQQQQQQFQQQQQQQQQQMNPPNSSSSSN9BR7SLEOOOMPSTNTTTFSPRSSSNSSLEKOOQQMPSSALEQQQQQQQQKQQQQQQQQQQ7FQMNPSNSPRSSNSPSRLEOOOOMPSNTTTTTPPPRFSNSPLEOOQQQ9BMP7ANRLEKQQQQQQQQQQQQQQQQMNPPPPPPFNRPSSPPLEOOOMPNPPRSLEOOQQQMT7NTSSRSLEQQQQFQMNSSALEKQQQQQQQQQQQPPPOPNPPNPPPPP8P9BPFN7LEOOOMPPPPPPRNPPLEOOOOMPPPRNPPLEOKOPMPAPRNFLEOPPOPPPPOPP7PONPPPPPNLEOOPPPP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 543 543 343
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 32587 27225 7907
Spell Hit 14.92% 14.92% 5074
Spell Crit 19.90% 13.95% 2773
Spell Haste 17.77% 12.16% 5170
Mana Per 5 17666 16825 0
Attack Power 315 270 0
Melee Hit 14.92% 14.92% 5074
Melee Crit 12.45% 7.44% 2773
Melee Haste 12.16% 12.16% 5170
Swing Speed 23.38% 12.16% 5170
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 22.30% 17.30% 5581

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_mastery
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160mastery_80int_160mastery_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160mastery_80int_160hit_160int_120haste,reforge=haste_mastery
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit,reforge=haste_mastery
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160mastery_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_mastery
Finger1 seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
glyphs=shadow_bolt

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/wrathguard:wrathstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
actions+=/touch_of_chaos,if=dot.corruption.remains<20
actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int
chest=shaskin_robes,id=87190,gems=80int_160mastery_80int_160mastery_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160mastery_80int_160hit_160int_120haste,reforge=haste_mastery
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit,reforge=haste_mastery
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160mastery_60mastery,enchant=140mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=343
# gear_spell_power=7907
# gear_hit_rating=5074
# gear_crit_rating=2773
# gear_haste_rating=5170
# gear_mastery_rating=5581
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felguard

Warlock_Destruction_T14H : 106871 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
106871.4 106871.4 33.70 / 0.03% 2823 / 2.6% 3.0 27602.7 27311.8 Mana 5.36% 45.3 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
Glyphs
  • conflagrate
  • burning_embers

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:984916|351783|150802|150131|85009|64327&chds=0,1969833&chco=C79C6E,9482C9,9482C9,C41F3B,C41F3B,C41F3B&chm=t++984916++summon_terrorguard,C79C6E,0,0,15|t++351783++shadowburn,9482C9,1,0,15|t++150802++chaos_bolt,9482C9,2,0,15|t++150131++immolate,C41F3B,3,0,15|t++85009++conflagrate,C41F3B,4,0,15|t++64327++incinerate,C41F3B,5,0,15&chtt=Warlock_Destruction_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:48,25,17,13,9,8,5,3&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C79C6E,C41F3B,C41F3B,9482C9,9482C9,9482C9&chl=incinerate|chaos_bolt|observer: melee|immolate|conflagrate|observer: tongue_lash|shadowburn|terrorguard: doom_bolt&chtt=Warlock_Destruction_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vtvvvwxx0113455582430z0yxwvutqpnnmmmmkjgeedcbaaZYYZYXXYXYXXYYZZbbcdddeebcdddddffffgggggggghhihhhggfeeeedddcbbbaaaaabbbbbbccaZZYXXWWWVVWVVUVVVUUUVWWXYZbbbbcbbcbccceefffffhhhhhiiihhhgggffeeeeecbbbaZZZaaaZZaaaZYXXWVVVUTTUUUUUVVVVUVVWWXZabcdddedeeeefgihiiiiijihhhhgggfeedccccccbbaabaaaaccccccbccbaaZZXXWVVUUUVVVVVVUUUVVWXYacdddeeeeeefhhiijjjjjiihiiihggggfeddeeddccccccccdedddcdddccccccccccccbbbcccbbbcddddegghgghhiiiiikllkjjjjjhhhhihgfffeeddcdeddcccccbbbccccbccbbbaabbbbabbbbaaabcccccdefffgijkjjkkllkkkllljjihhgfedeedcbbbbbaaZabaZZZZZZZYYZaZZYYXXXXWWXXXWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=106871|max=212614&chxp=1,1,50,100&chtt=Warlock_Destruction_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,1,1,0,13,10,9,21,38,46,65,90,132,186,220,292,374,408,490,566,616,631,644,645,621,603,548,469,423,363,314,242,222,188,125,107,86,61,37,29,23,11,6,7,2,2,2,1,1,2&chds=0,645&chbh=5&chxt=x&chxl=0:|min=100456|avg=106871|max=114159&chxp=0,1,47,100&chtt=Warlock_Destruction_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:62.7,13.7,8.9,7.2,1.2,0.3,5.4&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,9482C9,C79C6E,ffffff&chl=incinerate 282.5s|chaos_bolt 61.8s|conflagrate 40.1s|immolate 32.3s|shadowburn 5.6s|summon_terrorguard 1.2s|waiting 24.1s&chtt=Warlock_Destruction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Destruction_T14H 106871
blood_fury 0 0.0% 4.3 120.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
chaos_bolt 20687 19.4% 27.1 13.76sec 343401 150802 0 343401 343401 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.12 27.12 0.00 0.00 2.2772 0.0000 9313848.33 9313848.33 0.00 150802.25 150802.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 27.12 100.00% 343401.24 294151 521032 343520.49 330010 357361 9313848 9313848 0.00
DPS Timeline Chart

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react&(buff.backdraft.stack<3|level<86)
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:(null)
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100)} Shadow damage. Chaos Bolt always critically strikes. In addition, the damage is increased by your critical strike chance.$?s116858[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.250000
  • base_dd_min:2163.11
  • base_dd_max:2643.80
conflagrate 7569 7.1% 38.7 11.71sec 88113 85009 67023 141557 88113 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.65 38.65 0.00 0.00 1.0365 0.0000 3405969.99 3405969.99 0.00 85008.98 85008.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.72 71.70% 67022.81 61951 90176 67028.65 64417 70037 1857677 1857677 0.00
crit 10.94 28.30% 141557.25 127619 185763 141699.81 127619 165886 1548293 1548293 0.00
DPS Timeline Chart

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.down
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by $s2%.
  • description:Target enemy instantly explodes, dealing $s1 Fire damage$?s56235[ and reducing their movement speed by $s2% for $d.][. If the target is afflicted by Immolate, their movement speed is reduced by $s2% for $17962d.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1522.19
  • base_dd_max:1682.42
dark_soul 0 0.0% 6.1 80.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.06 6.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
immolate 10773 10.1% 27.3 16.46sec 177863 150131 16489 34789 21522 27.5% 0.0% 0.0% 0.0% 197.6 16460 34773 21580 28.0% 0.0% 96.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.27 27.27 197.57 197.57 1.1847 2.2043 4850587.64 4850587.64 0.00 10368.49 150131.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.77 72.50% 16489.40 15322 22303 16490.09 15322 17425 326035 326035 0.00
crit 7.50 27.50% 34789.39 31564 45945 34835.71 31564 41926 260889 260889 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.3 72.04% 16459.97 15322 22303 16463.11 15995 17020 2342697 2342697 0.00
crit 55.2 27.96% 34772.77 31564 45945 34795.28 33081 37232 1920966 1920966 0.00
DPS Timeline Chart

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:36000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain=5&miss_react
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Burns the enemy for ${$m1*$<mastery>} Fire damage and then an additional ${(($m2+($SP*0.3))*$<mastery>)*5} Fire damage over $d.$?s108647[ Critical strikes have a chance to generate Burning Embers.][]$?s348[][ Replaces Corruption.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.371000
  • base_dd_min:396.30
  • base_dd_max:396.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.371000
  • base_td:396.30
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
incinerate 40307 37.8% 215.3 2.07sec 84392 64327 65238 136645 84876 27.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 215.33 214.11 0.00 0.00 1.3119 0.0000 18172541.32 18172541.32 0.00 64327.35 64327.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 155.22 72.50% 65238.29 60712 88372 65250.95 63860 66827 10126574 10126574 0.00
crit 58.88 27.50% 136645.26 125066 182047 136703.03 130569 143510 8045967 8045967 0.00
DPS Timeline Chart

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to an enemy.$?s108647[ Generates Burning Embers. Critical strikes double this effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:1420.71
  • base_dd_max:1570.26
shadowburn 4343 4.1% 6.9 11.70sec 282554 351783 215849 447609 282554 28.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 0.8032 0.0000 1962243.05 1962243.05 0.00 351782.55 351782.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.95 71.22% 215848.88 194944 283762 215899.90 0 255890 1067562 1067562 0.00
crit 2.00 28.78% 447609.05 401585 584549 404561.99 0 560661 894681 894681 0.00
DPS Timeline Chart

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react
Spelldata
  • id:17877
  • name:Shadowburn
  • school:shadow
  • tooltip:(null)
  • description:Instantly blasts the target for ${$17877m2*(1+$77220m1*0.01)} Shadow damage. Only usable on enemies that have less than 20% health. Restores $125882m1% of your total mana after $29341d. If the target dies within $29341d, and yields experience or honor, the caster gains a Burning Ember instead.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.500000
  • base_dd_min:3364.84
  • base_dd_max:4112.58
summon_terrorguard 0 (2749) 0.0% (2.5%) 1.0 1.#Rsec 1220311 984916 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2390 0.0000 0.00 0.00 0.00 984916.35 984916.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:37500.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Terrorguard to attack the target for $112926d. The Terrorguard casts Doom Bolt until it departs. $@spelltooltip85692
pet - observer 20443 / 20443
melee 13858 13.0% 316.1 1.42sec 19738 13873 16066 32825 19738 27.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 316.09 316.09 0.00 0.00 1.4228 0.0000 6238851.05 6238851.05 0.00 13872.56 13872.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.22 48.48% 16065.83 15010 21638 16068.24 15778 16429 2461672 2461672 0.00
crit 87.01 27.53% 32825.38 30019 43276 32840.04 31775 34259 2856084 2856084 0.00
glance 75.85 24.00% 12143.22 11257 16228 12145.89 11697 12578 921095 921095 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tongue_lash 6584 6.2% 97.6 4.68sec 30368 29298 23583 48161 30368 27.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tongue_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.58 97.58 0.00 0.00 1.0365 0.0000 2963275.52 2963275.52 0.00 29298.46 29298.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.64 72.40% 23583.07 21874 31846 23587.08 23024 24288 1665994 1665994 0.00
crit 26.94 27.60% 48160.59 43747 63691 48193.03 45070 52320 1297281 1297281 0.00
DPS Timeline Chart

Action details: tongue_lash

Static Values
  • id:115778
  • school:shadow
  • resource:energy
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115778
  • name:Tongue Lash
  • school:shadow
  • tooltip:(null)
  • description:Lick the enemy, causing $s1 Shadow damage.$?s104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - terrorguard 20339 / 2749
doom_bolt 20339 2.5% 21.3 2.76sec 57409 20683 42300 92913 57409 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 2.7756 0.0000 1220311.35 1220311.35 0.00 20683.24 20683.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.91 70.15% 42300.12 38904 56641 42253.03 38904 46070 630740 630740 0.00
crit 6.35 29.85% 92912.66 77808 113282 93201.75 0 110966 589572 589572 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 38.7 0.0 11.7sec 11.7sec 48.85% 44.55%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • backdraft_1:11.7%
  • backdraft_2:16.0%
  • backdraft_3:21.2%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by $s1%.$?$W3>0[ Chaos Bolt's cast time reduced by $s3%][]
  • description:When you cast Conflagrate, the cast time for your next three Incinerate$?s123686[ or one Chaos Bolt][] is reduced by $117828s1%. Lasts $117828d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
blood_fury 4.3 0.0 120.9sec 120.9sec 14.11% 14.11%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.96%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.8sec 80.8sec 26.42% 27.26%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 7.2 0.0 66.2sec 66.2sec 31.14% 31.14%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:31.1%
jade_serpent_potion 2.0 0.0 369.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.0 0.0 58.7sec 58.7sec 20.95% 21.02%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.0%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
relic_of_yulon 8.6 0.0 54.4sec 54.4sec 28.29% 28.29%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.3%
synapse_springs_2 7.9 0.0 60.8sec 60.7sec 17.39% 17.39%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Destruction_T14H
chaos_bolt Burning Ember 27.1 27.1 1.0 1.0 343401.2
conflagrate Mana 38.7 463855.9 12000.0 12000.0 7.3
dark_soul Mana 6.1 90904.9 15000.0 15000.0 0.0
immolate Mana 27.3 981774.3 36000.0 36000.0 4.9
incinerate Mana 215.3 10860904.0 50437.5 50437.5 1.7
shadowburn Burning Ember 6.9 6.9 1.0 1.0 282553.5
summon_terrorguard Mana 1.0 37500.0 37500.0 37500.0 32.5
pet - observer
tongue_lash Energy 97.6 5854.8 60.0 60.0 506.1
pet - terrorguard
doom_bolt Energy 21.3 744.0 35.0 35.0 1640.3
Resource Gains Type Count Total Average Overflow
shadowburn Mana 6.53 291853.94 44723.70 1803.03 0.61%
immolate Burning Ember 62.74 6.27 0.10 0.00 0.00%
incinerate Burning Ember 214.11 27.30 0.13 0.00 0.00%
mp5_regen Mana 1801.50 12012037.50 6667.79 1132354.94 8.61%
pet - observer
energy_regen Energy 1801.50 5755.62 3.19 0.00 0.00%
pet - terrorguard
energy_regen Energy 239.00 726.73 3.04 172.35 19.17%
Resource RPS-Gain RPS-Loss
Mana 27311.77 27602.66
Burning Ember 0.07 0.08
Combat End Resource Mean Min Max
Health 490075.00 490075.00 490075.00
Mana 169400.19 39674.71 294504.31
Burning Ember 0.50 0.00 1.20
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 8.6%
felhunter-Mana Cap 8.6%
succubus-Mana Cap 8.6%
infernal-Mana Cap 8.6%
observer-Mana Cap 8.6%
shivarra-Mana Cap 8.6%
abyssal-Mana Cap 8.6%
service_felguard-Mana Cap 8.6%
service_imp-Mana Cap 8.6%
service_voidwalker-Mana Cap 8.6%

Procs

Count Interval
hat_donor 55.2 8.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 106871.40
Minimum 100456.28
Maximum 114158.90
Spread ( max - min ) 13702.62
Range [ ( max - min ) / 2 * 100% ] 6.41%
Standard Deviation 1718.9409
5th Percentile 104130.93
95th Percentile 109775.94
( 95th Percentile - 5th Percentile ) 5645.01
Mean Distribution
Standard Deviation 17.1928
95.00% Confidence Intervall ( 106837.70 - 106905.10 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 9
0.1% Error 993
0.1 Scale Factor Error with Delta=300 25223
0.05 Scale Factor Error with Delta=300 100894
0.01 Scale Factor Error with Delta=300 2522351
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 106871.40

Damage

Sample Data
Count 9996
Mean 37705190.33

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 340.29
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.91 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.31 blood_fury
A 6.06 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>2
F 1.00 summon_doomguard
G 0.00 havoc,target=2,if=num_targets>1
H 6.94 shadowburn,if=ember_react
I 27.75 chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
J 38.65 conflagrate,if=buff.backdraft.down
K 27.74 immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
L 218.92 incinerate

Sample Sequence

79AFIJKLLLJLLLLKIJLLLLLLLILJLLKLILLLLJLLLLJKLILLL7LLJKLILLLLLJKLAILLLLLJLLLILKLJLILLLLLJLKLLLI79LLJLLLLJKLILLLLLJKLILLLLLAJLIKLLLLLIJLLLLI7JKLLLLILLJKLLLLLLLIJKLLLLJLKLLLLIJLLLLAL9L7JLIKLLLLJLIKLLLLLJLLLILKLJLLLLLLILJKLLLLLJ7LLLIKLJLLLLALLIKJLLLLLLIJKLLLLLLIJLLLLLK8LL9L7HJLLLLLLLHJKLLLLLLJLLHLKLLLJLALLLHLKLLJLHLLLLLLLJL7LHKLLLLLJHLLLLKLLJL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Burning Ember 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 21.66% 15.71% 3831
Spell Haste 24.62% 18.68% 7940
Mana Per 5 135520 129067 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.22% 9.21% 3831
Melee Haste 18.68% 18.68% 7940
Swing Speed 30.55% 18.68% 7940
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.61% 32.61% 1720

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_haste
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery,reforge=mastery_crit
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Destruction_T14H"
origin="unknown"
level=90
race=orc
spec=destruction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
glyphs=conflagrate/burning_embers

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>2
actions+=/summon_doomguard
actions+=/havoc,target=2,if=num_targets>1
actions+=/shadowburn,if=ember_react
actions+=/chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
actions+=/conflagrate,if=buff.backdraft.down
actions+=/immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
actions+=/incinerate

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/rain_of_fire,if=!ticking&!in_flight
actions.aoe+=/fire_and_brimstone,if=ember_react&buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!ticking
actions.aoe+=/conflagrate,if=ember_react&buff.fire_and_brimstone.up
actions.aoe+=/incinerate,if=buff.fire_and_brimstone.up
actions.aoe+=/immolate,cycle_targets=1,if=!ticking

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3831
# gear_haste_rating=7940
# gear_mastery_rating=1720
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warrior_Arms_T14H : 109488 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
109488.2 109488.2 63.83 / 0.06% 5339 / 4.9% 16745.4 6.5 6.6 Rage 4.41% 49.1 100.0%
Origin http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:183962|134429|70506|60524|52712|44908|25771|14662|12904&chds=0,367924&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++183962++execute,C79C6E,0,0,15|t++134429++dragon_roar,C79C6E,1,0,15|t++70506++mortal_strike,C79C6E,2,0,15|t++60524++slam,C79C6E,3,0,15|t++52712++overpower,C79C6E,4,0,15|t++44908++colossus_smash,C79C6E,5,0,15|t++25771++impending_victory,C79C6E,6,0,15|t++14662++melee_main_hand,C79C6E,7,0,15|t++12904++heroic_throw,C79C6E,8,0,15&chtt=Warrior_Arms_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,12,12,9,9,7,5,5,5,3,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=mortal_strike|overpower|melee_main_hand|execute|opportunity_strike|slam|heroic_strike|deep_wounds|bloodbath|colossus_smash|dragon_roar|heroic_leap|heroic_throw|impending_victory&chtt=Warrior_Arms_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:856634423100xywsrpnonlmkjjjghgfffggeecaaYWWVUVVTVVTWWVYYYbefhiklknnmonmonlmkijighffgeffcddbdcbcccddcdccdcddbcdbdeddfefgfgfedccabcbacbbbbZaZYaYabbdefffghghhhijijjhjjiihhhghhfggfggfghgihgiijkjkkikkikjijihhgffcbZXWVUVUUVTUVUUVTUVVWYZabddceeeffehhgihhjkikjjkjkkiiihihfgfefededdedeecdecddcdecddccaZYWVUTVUUXWXZYZbabdegjjmnppoqpnpomonlmmkmljlkkljkljkljkkjkkikjjlkkljmnlmnlopopqoqqpqpppoppnppmoolnnlnnlnmlmmmmlmmlnlkmmkmljmlkmlkmlmmlmmmoonoooqqpqpqsqrrprsqsrprtrtsrtuuvuvwvyzwyzx00xzywzywxwwxwxvuwwuwusuusutqssqrpppooomnmlnmkmlkmlklklmkllklmkmljkljkijjijjhjj&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109488|max=192536&chxp=1,1,57,100&chtt=Warrior_Arms_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,6,9,7,16,23,35,50,83,112,146,190,252,311,338,450,485,543,581,608,631,630,572,627,552,494,451,365,327,259,200,188,130,91,52,56,28,30,28,15,9,4,3,2,1,0,1,0,1&chds=0,631&chbh=5&chxt=x&chxl=0:|min=98005|avg=109488|max=123788&chxp=0,1,45,100&chtt=Warrior_Arms_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.2,24.1,16.3,12.2,7.0,3.1,2.4,1.3,0.1,4.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=overpower 131.4s|mortal_strike 108.7s|slam 73.6s|colossus_smash 54.8s|execute 31.7s|heroic_throw 13.8s|dragon_roar 11.0s|battle_shout 6.0s|impending_victory 0.3s|waiting 19.8s&chtt=Warrior_Arms_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Arms_T14H 109488
battle_shout 0 0.0% 3.9 99.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.92 3.92 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 14.8 31.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.85 14.85 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.enrage.up
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 5711 5.2% 7.9 60.71sec 324875 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.4 20354 0 20354 0.0% 0.0% 28.1%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 120.70 126.42 126.42 0.0000 1.0000 2573132.14 2573132.14 0.00 20353.68 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.78 93.44% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.92 6.56% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.4 100.00% 20353.63 657 82854 20365.48 13917 28519 2573132 2573132 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:26181.35
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
colossus_smash 5469 5.0% 35.7 12.69sec 69002 44908 51634 107753 69002 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.69 35.69 0.00 0.00 1.5365 0.0000 2463000.15 2463000.15 0.00 44908.38 44908.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.57 68.84% 51633.53 44862 85078 51595.25 46632 59228 1268679 1268679 0.00
crit 11.08 31.05% 107752.51 92415 175262 107679.85 92415 143724 1194322 1194322 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.remains<=1.5
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 60.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.83 7.83 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 5910 5.4% 70.7 6.42sec 37653 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 13541 27782 17783 29.8% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.68 70.68 149.66 149.66 0.0000 3.0000 2661435.81 2661435.81 0.00 5927.58 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.1 70.21% 13541.25 11512 18442 13543.85 12996 14069 1423002 1423002 0.00
crit 44.6 29.79% 27781.51 23024 36885 27802.34 25843 29939 1238434 1238434 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3275 3.0% 7.1 65.40sec 206532 134429 0 206758 206532 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.13 7.13 0.00 0.00 1.5364 0.0000 1473077.49 1473077.49 0.00 134429.41 134429.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.12 99.89% 206757.88 169854 273644 206891.12 182607 233188 1473077 1473077 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 12946 11.8% 20.6 3.98sec 282659 183962 204751 444482 282659 32.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.61 20.61 0.00 0.00 1.5365 0.0000 5824235.38 5824235.38 0.00 183961.95 183961.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.87 67.29% 204750.78 137435 320425 204806.96 154847 264138 2838879 2838879 0.00
crit 6.72 32.60% 444481.86 283116 660076 445383.96 0 640918 2985356 2985356 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2314 2.1% 13.8 33.76sec 75552 0 56124 118776 75552 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.79 13.79 0.00 0.00 0.0000 0.0000 1041656.33 1041656.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.49 68.83% 56123.76 47025 75806 56116.39 49775 64707 532603 532603 0.00
crit 4.29 31.09% 118776.34 96871 156160 118613.19 0 156160 509053 509053 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 7614 7.0% 34.1 10.71sec 100506 0 76378 154938 100506 30.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.12 34.12 0.00 0.00 0.0000 0.0000 3429509.99 3429509.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.57 69.06% 76378.11 41918 323482 76331.13 51779 110612 1799974 1799974 0.00
crit 10.52 30.82% 154938.48 86350 666372 154631.17 91394 274564 1629536 1629536 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 397 0.4% 9.0 47.92sec 19826 12904 15078 31291 19828 29.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.5364 0.0000 178421.75 178421.75 0.00 12903.87 12903.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.34 70.48% 15077.82 13147 25165 15099.49 0 22318 95624 95624 0.00
crit 2.65 29.41% 31290.95 27084 51839 29773.24 0 51839 82798 82798 0.00
dodge 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 20 0.0% 0.2 108.15sec 39571 25771 30983 62909 39571 27.1% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.23 0.23 0.00 0.00 1.5355 0.0000 8994.03 8994.03 0.00 25770.85 25770.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.17 72.76% 30983.40 26344 46842 4682.75 0 46842 5124 5124 0.00
crit 0.06 27.07% 62908.51 54269 100812 3742.14 0 100812 3870 3870 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.13% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 13550 12.4% 141.0 3.18sec 43309 14662 35751 73674 43309 25.7% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.02 141.02 0.00 0.00 2.9539 0.0000 6107314.36 6107314.36 0.00 14661.59 14661.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.85 50.24% 35751.28 26295 50329 35763.44 32265 39577 2532833 2532833 0.00
crit 36.21 25.68% 73673.83 54167 103678 73697.58 63735 84184 2668097 2668097 0.00
glance 33.81 23.97% 26811.74 19721 37747 26823.76 22815 30768 906385 906385 0.00
dodge 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 17013 15.5% 70.8 6.42sec 108331 70506 81666 171225 108331 29.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.76 70.76 0.00 0.00 1.5365 0.0000 7665885.91 7665885.91 0.00 70506.46 70506.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.54 70.01% 81666.13 61811 116522 81668.39 74148 91098 4045807 4045807 0.00
crit 21.14 29.88% 171224.81 127331 240036 171305.28 137645 199670 3620079 3620079 0.00
dodge 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:Healing effects on you are increased by $s5%
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. Generates 10 Rage.$?s58368[ When your Mortal Strike is affecting a target, healing effects on you are increased by $s5%. ][] |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1460.66
  • base_dd_max:1460.66
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.85
opportunity_strike 10022 9.2% 179.6 2.51sec 25141 0 19156 39185 25141 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.61 179.61 0.00 0.00 0.0000 0.0000 4515569.66 4515569.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.58 69.92% 19155.65 13992 26564 19159.09 17572 20786 2405485 2405485 0.00
crit 53.85 29.98% 39185.12 27983 53129 39202.30 34191 44212 2110085 2110085 0.00
dodge 0.04 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.15 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76858
  • name:Opportunity Strike
  • school:physical
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.55
overpower 15365 14.0% 85.5 5.25sec 80992 52712 41322 86718 80992 87.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.54 85.54 0.00 0.00 1.5365 0.0000 6928420.80 6928420.80 0.00 52712.06 52712.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.67 12.47% 41322.02 31554 60395 41326.69 31554 54494 440938 440938 0.00
crit 74.81 87.45% 86718.28 65000 124414 86757.43 79275 96753 6487483 6487483 0.00
miss 0.06 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.overpower.up
Spelldata
  • id:7384
  • name:Overpower
  • school:physical
  • tooltip:(null)
  • description:Instantly overpower the enemy causing $m1% weapon damage. Cannot be blocked, dodged or parried. Overpower has a $s3% increased chance to be a critical strike. Only usable after the target dodges$?s56638[ or when activated by Taste for Blood][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
recklessness 0 0.0% 3.4 167.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 3.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
slam 9882 9.0% 47.9 7.36sec 92995 60524 71028 148420 92995 28.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.91 47.91 0.00 0.00 1.5365 0.0000 4455711.82 4455711.82 0.00 60523.94 60523.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.22 71.42% 71027.77 56587 106908 71069.17 63502 81609 2430541 2430541 0.00
crit 13.64 28.48% 148420.08 116569 220230 148594.27 118414 194515 2025171 2025171 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:(null)
  • description:Slams the opponent, causing $1464m2% weapon damage plus $1464m1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:997.04
  • base_dd_max:997.04
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 14.8 0.0 31.4sec 31.4sec 19.66% 19.66%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:19.7%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 7.9 0.0 60.6sec 60.7sec 20.88% 22.40%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.9%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.57%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 14.4 23.1 31.5sec 11.8sec 63.88% 63.02%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:63.9%
darkmist_vortex 7.4 0.0 64.8sec 64.8sec 32.16% 32.16%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.2%
deadly_calm 7.8 0.0 60.7sec 60.7sec 11.78% 39.81%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:2.2%
  • deadly_calm_2:2.4%
  • deadly_calm_3:7.2%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 33.5 13.6 13.6sec 9.8sec 52.07% 52.43%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:52.1%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 393.8sec 0.0sec 10.08% 10.08%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
overpower 61.1 35.2 7.4sec 4.7sec 49.27% 49.27%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_overpower
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • overpower_1:49.3%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
recklessness 3.4 0.0 162.4sec 167.9sec 13.58% 14.58%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.6 0.0 49.1sec 49.1sec 31.52% 31.52%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.5%
taste_for_blood 18.1 7.5 23.6sec 16.7sec 27.98% 45.13%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_taste_for_blood
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • taste_for_blood_1:19.0%
  • taste_for_blood_2:6.1%
  • taste_for_blood_3:2.1%
  • taste_for_blood_4:0.6%
  • taste_for_blood_5:0.3%

Spelldata details

  • id:125831
  • name:Taste for Blood
  • tooltip:Your next Heroic Strike or Cleave will hit for $w1% additional damage.
  • description:$@spelldesc56638
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T14H
execute Rage 20.6 618.2 30.0 30.0 9422.0
heroic_strike Rage 34.1 887.8 26.0 26.0 3862.8
impending_victory Rage 0.2 2.3 10.0 10.0 3957.1
slam Rage 47.9 1437.4 30.0 30.0 3099.8
Resource Gains Type Count Total Average Overflow
battle_shout Rage 3.92 78.42 20.00 0.00 0.00%
enrage Rage 47.15 455.08 9.65 16.44 3.49%
melee_main_hand Rage 140.90 1741.91 12.36 33.43 1.88%
mortal_strike Rage 70.76 698.62 9.87 9.01 1.27%
Resource RPS-Gain RPS-Loss
Rage 6.60 6.54
Combat End Resource Mean Min Max
Health 460269.00 460269.00 460269.00
Rage 28.81 0.20 92.40
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 2.0%

Procs

Count Interval
hat_donor 205.9 2.5sec
strikes_of_opportunity 179.6 2.5sec
sudden_death 28.3 15.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 109488.23
Minimum 98004.63
Maximum 123788.15
Spread ( max - min ) 25783.52
Range [ ( max - min ) / 2 * 100% ] 11.77%
Standard Deviation 3255.9743
5th Percentile 104211.54
95th Percentile 114888.81
( 95th Percentile - 5th Percentile ) 10677.27
Mean Distribution
Standard Deviation 32.5663
95.00% Confidence Intervall ( 109424.40 - 109552.06 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3397
0.1 Scale Factor Error with Delta=300 90499
0.05 Scale Factor Error with Delta=300 361997
0.01 Scale Factor Error with Delta=300 9049938
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 109488.23

Damage

Sample Data
Count 9996
Mean 49326365.61

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 368.73
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 5.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.43 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.92 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 14.85 berserker_rage,use_off_gcd=1,if=!buff.enrage.up
B 13.79 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.83 deadly_calm,use_off_gcd=1,if=rage>=40
D 34.12 heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
E 70.76 mortal_strike
F 35.69 colossus_smash,if=debuff.colossus_smash.remains<=1.5
G 20.61 execute
H 0.00 storm_bolt,if=talent.storm_bolt.enabled
I 85.54 overpower,if=buff.overpower.up
J 0.00 shockwave,if=talent.shockwave.enabled
K 7.13 dragon_roar,if=talent.dragon_roar.enabled
L 44.53 slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
M 9.00 heroic_throw
N 3.78 battle_shout,if=rage<70&!debuff.colossus_smash.up
O 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
P 3.39 slam,if=target.health.pct>=20
Q 0.23 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
R 0.14 battle_shout,if=rage<70

Sample Sequence

579AEFBCDIDIDEFIIEFIIDEDIKLEILLAEILFBEDIDIMEI5EIIFDEDI9LCDNAEILLEILLEFBILEIIKEIIIAEIFDIEDIDIIEIILEFBDILE9ICLMAEIL5EFILEFBDIIDEIIIAEII7FDEDIFIEDIKLEIIIE9ICIALEFBDIDLEIFLEIFLEFDIIDEILMA5EIIFBDEDIKLEILLE9ICLNEAFDIDLEFIBLEFILEILLEIMLAEILFEILBLEFIKEIL9CM5EILFAEDILBLEILNEILLEFILEILLAEFIBLEILKEILG796CEGGFEGGIAEFBGGEGIIEGIIEGIFEGIGAEGIMEGIKEFBG9ICEFGGEGINAEGGIEGIFEB

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20442 18104 17034
Agility 226 215 80
Stamina 22419 20381 20193
Intellect 121 115 80
Spirit 146 146 80
Health 460269 431737 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 14.89% 14.89% 2522
Spell Crit 23.65% 18.65% 10584
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 45214 36428 0
Melee Hit 7.42% 7.42% 2522
Melee Crit 28.66% 23.66% 10584
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.48% 7.48% 2542
Armor 34135 34135 34135
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.88% 10.25% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.51% 33.51% 4338

Gear

Average Item Level: 506.33
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck shackle_of_eversparks,id=90508,reforge=hit_crit
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=80str_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
Wrists bracers_of_defiled_earth,id=87145,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_mastery
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Arms_T14H"
origin="http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html"
level=90
race=worgen
spec=arms
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!buff.enrage.up
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
actions+=/mortal_strike
actions+=/colossus_smash,if=debuff.colossus_smash.remains<=1.5
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/overpower,if=buff.overpower.up
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/slam,if=target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_mastery
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=87145,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=80str_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel

# Gear Summary
# gear_strength=17034
# gear_agility=80
# gear_stamina=20193
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2542
# gear_hit_rating=2522
# gear_crit_rating=10584
# gear_haste_rating=784
# gear_mastery_rating=4338
# gear_armor=34135
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Warrior_Fury_1h_T14H : 117739 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
117739.0 117739.0 79.31 / 0.07% 6619 / 5.6% 13023.2 9.0 9.1 Rage 9.09% 56.5 100.0%
Origin http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://7.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:232309|172197|97335|49832|34977|34304|19882|15513|13088|10742&chds=0,464619&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++232309++execute,C79C6E,0,0,15|t++172197++dragon_roar,C79C6E,1,0,15|t++97335++raging_blow,C79C6E,2,0,15|t++49832++wild_strike,C79C6E,3,0,15|t++34977++bloodthirst,C79C6E,4,0,15|t++34304++colossus_smash,C79C6E,5,0,15|t++19882++impending_victory,C79C6E,6,0,15|t++15513++melee_main_hand,C79C6E,7,0,15|t++13088++melee_off_hand,C79C6E,8,0,15|t++10742++heroic_throw,C79C6E,9,0,15&chtt=Warrior_Fury_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,12,10,9,9,8,8,7,6,5,3,3,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|melee_main_hand|melee_off_hand|bloodthirst|raging_blow_mh|heroic_strike|deep_wounds|raging_blow_oh|wild_strike|bloodbath|dragon_roar|heroic_leap|colossus_smash|impending_victory|heroic_throw&chtt=Warrior_Fury_1h_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:855423211zyywwtssplljihgffccbaaaZaaYXVUTSQQRQQRQRQQQRRRRSVXZabcdcdddfeefeeddddcbbbaaZZZZYYYYYYYYYYXXXXXXYYXXXXXXXXYYYYYZYYXWWVUUVVWWVWWVVVVUUUVWXYYaaZaabcccddeeefffffffeeeeeedeedddddccccdccdddccccbbbbbbaaaZYWVUTSSTSTTSTSSSSRRRRTTUVVXXWXXXYXXZZZaabcccccdcccccccccbbbaaaZZZZZYZZYYYYYXXXXXXXXYWVUUTSRRTSUVUWXXXZZaabdfghijkijihjihiihihhihhhhiihiiiiiiiihiihhhhhhiiijjiiiijijjjjkkkkkkkklkkllllllllllllllllkkkkkkjjiiihhhhhhhhhiiijjjkkllmmnnoopppppppppppqqpqqqrrsstuvwxyyz0011122111100zzyyxxwvvvuuutttsrrqqqppooonnmmmmlllllllllllllllllllllkkkkkjjihhgggfffeeed&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117739|max=235909&chxp=1,1,50,100&chtt=Warrior_Fury_1h_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,2,5,3,10,15,16,27,51,55,98,106,158,182,268,306,398,395,486,501,549,569,623,632,604,556,541,530,431,405,324,275,203,180,140,110,76,54,29,21,19,12,12,5,2,2,1,2,1,3&chds=0,632&chbh=5&chxt=x&chxl=0:|min=103195|avg=117739|max=134451&chxp=0,1,47,100&chtt=Warrior_Fury_1h_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.0,19.3,14.3,8.1,7.2,3.9,2.9,2.4,1.9,9.1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 139.9s|raging_blow 86.8s|wild_strike 64.3s|execute 36.5s|colossus_smash 32.4s|heroic_throw 17.7s|impending_victory 13.2s|dragon_roar 10.8s|battle_shout 8.8s|waiting 41.0s&chtt=Warrior_Fury_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T14H 117739
battle_shout 0 0.0% 5.7 72.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.70 5.70 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 13.3 35.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.29 13.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 5327 4.5% 7.9 60.57sec 301924 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.5 18942 0 18942 0.0% 0.0% 28.1%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 116.49 126.51 126.51 0.0000 1.0000 2396390.94 2396390.94 0.00 18941.86 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.55 93.19% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.94 6.81% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.5 100.00% 18941.84 428 112436 18984.29 11900 29284 2396391 2396391 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2153.27
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 10854 9.2% 91.0 4.98sec 53741 34977 32430 69472 53741 57.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.03 91.03 0.00 0.00 1.5365 0.0000 4892253.14 4892253.14 0.00 34976.64 34976.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.66 42.47% 32430.42 22138 56799 32479.39 28615 37092 1253798 1253798 0.00
crit 52.37 57.53% 69472.30 45605 117006 69432.29 63378 75930 3638455 3638455 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 0 0.0% 91.0 4.98sec 0 0 0 0 0 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 91.03 91.03 0.00 0.00 0.0000 0.0000 0.00 139769.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.89 76.78% 0.00 0 0 0.00 0 0 0 87087 100.00
crit 21.14 23.22% 0.00 0 0 0.00 0 0 0 52682 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 2468 2.1% 21.1 21.80sec 52707 34304 39513 83884 52707 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.09 21.09 0.00 0.00 1.5365 0.0000 1111577.77 1111577.77 0.00 34303.72 34303.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.82 70.26% 39513.33 29285 51586 39505.30 33029 44959 585533 585533 0.00
crit 6.27 29.74% 83883.80 60327 106267 83961.88 0 106267 526044 526044 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 61.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.81 7.81 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 9705 8.2% 91.0 4.98sec 48013 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 22207 46034 29204 29.4% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.03 91.03 149.67 149.67 0.0000 3.0000 4370829.61 4370829.61 0.00 9734.57 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.7 70.63% 22206.78 15251 33529 22209.32 20233 23902 2347634 2347634 0.00
crit 44.0 29.37% 46033.74 30502 67058 46070.58 40231 52230 2023196 2023196 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 4120 3.5% 7.0 66.40sec 264567 172197 0 264567 264567 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.00 7.00 0.00 0.00 1.5364 0.0000 1852495.41 1852495.41 0.00 172197.01 172197.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.00 100.00% 264566.58 179952 398219 264740.96 191145 324186 1852495 1852495 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 18836 16.0% 23.8 3.43sec 356944 232309 257600 564679 356944 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.77 23.77 0.00 0.00 1.5365 0.0000 8485098.23 8485098.23 0.00 232309.33 232309.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.08 67.65% 257600.25 145759 465505 257820.57 198196 331425 4142504 4142504 0.00
crit 7.69 32.35% 564679.08 300263 958941 566758.59 0 841012 4342595 4342595 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2958 2.5% 10.8 43.58sec 123194 0 91620 196270 123194 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.81 10.81 0.00 0.00 0.0000 0.0000 1331581.64 1331581.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.55 69.83% 91620.15 62273 137904 91532.11 62273 111675 691523 691523 0.00
crit 3.26 30.17% 196270.45 128282 284082 192899.09 0 284082 640058 640058 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 9713 8.3% 67.5 5.44sec 64863 0 49009 103396 64863 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.47 67.47 0.00 0.00 0.0000 0.0000 4376509.55 4376509.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.80 70.85% 49009.44 26177 67691 48993.15 43462 54567 2342883 2342883 0.00
crit 19.67 29.15% 103395.82 53926 139443 103460.02 84057 121693 2033627 2033627 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 423 0.4% 11.5 37.38sec 16504 10742 12561 26423 16506 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.52 11.52 0.00 0.00 1.5364 0.0000 190152.46 190152.46 0.00 10741.86 10741.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.24 71.54% 12560.81 8563 20677 12572.93 8780 18091 103527 103527 0.00
crit 3.28 28.46% 26422.88 17640 43491 25851.27 0 42594 86625 86625 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 581 0.5% 8.6 41.81sec 30549 19882 23285 49112 30549 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.57 8.57 0.00 0.00 1.5365 0.0000 261732.51 261732.51 0.00 19882.45 19882.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.16 71.87% 23284.91 17180 41465 23265.81 17180 33904 143385 143385 0.00
crit 2.41 28.13% 49111.53 35391 85417 45841.75 0 85417 118347 118347 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 8.6 41.81sec 0 0 0 0 0 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.57 8.57 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.57 76.66% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.00 23.34% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 14590 12.4% 213.8 2.10sec 30758 15513 30148 62142 30758 25.2% 18.7% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 213.76 213.76 0.00 0.00 1.9827 0.0000 6574851.51 6574851.51 0.00 15513.20 15513.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.42 32.01% 30147.84 18839 49427 30157.31 26808 34090 2062714 2062714 0.00
crit 53.91 25.22% 62142.08 38809 101819 62156.39 54671 71596 3350015 3350015 0.00
glance 51.36 24.03% 22628.41 14130 37070 22633.89 19608 25564 1162122 1162122 0.00
miss 40.08 18.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 12311 10.5% 213.8 2.10sec 25954 13088 25440 52428 25954 25.3% 18.8% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 213.76 213.76 0.00 0.00 1.9831 0.0000 5547911.09 5547911.09 0.00 13087.54 13087.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.29 31.95% 25440.17 15896 41704 25445.86 22441 28097 1737350 1737350 0.00
crit 53.99 25.26% 52427.68 32745 85910 52442.97 45825 59722 2830371 2830371 0.00
glance 51.35 24.02% 19089.66 11922 31278 19095.03 16336 21779 980190 980190 0.00
miss 40.13 18.77% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (18740) 0.0% (15.9%) 56.5 7.93sec 149555 97335 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.49 56.49 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 97335.26 97335.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 10164 8.6% 56.5 7.93sec 81119 0 60475 127173 81119 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.49 56.49 0.00 0.00 0.0000 0.0000 4582600.47 4582600.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.01 69.05% 60475.24 35523 92372 60476.51 54137 67023 2358976 2358976 0.00
crit 17.49 30.95% 127172.58 73178 190286 127258.40 104146 156364 2223625 2223625 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 8575 7.3% 56.5 7.93sec 68436 0 51018 107340 68436 30.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.49 56.49 0.00 0.00 0.0000 0.0000 3866099.94 3866099.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.02 69.07% 51018.09 29973 77939 51022.12 45547 56435 1990829 1990829 0.00
crit 17.47 30.93% 107340.00 61744 160553 107446.96 88204 130003 1875271 1875271 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.4 166.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 3.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 7114 6.0% 53.9 6.56sec 59482 49832 45464 95781 59482 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.90 53.90 0.00 0.00 1.1936 0.0000 3206058.25 3206058.25 0.00 49832.26 49832.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.88 72.14% 45463.72 31455 81386 45478.56 37473 54181 1767796 1767796 0.00
crit 15.02 27.86% 95780.69 64796 167655 95809.18 70096 125905 1438263 1438263 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 13.3 0.0 35.2sec 35.3sec 17.59% 17.59%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.6%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 7.9 0.0 60.5sec 60.6sec 20.89% 23.38%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.9%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 12.04%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 14.6 3.6 29.8sec 23.8sec 29.17% 68.57%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:7.9%
  • bloodsurge_2:4.4%
  • bloodsurge_3:16.9%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 12.7 9.7 35.1sec 19.4sec 45.23% 44.25%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:45.2%
dancing_steel_oh 9.1 3.5 46.3sec 32.4sec 28.61% 28.49%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:28.6%
darkmist_vortex 7.5 0.0 64.0sec 64.0sec 32.50% 32.50%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.5%
deadly_calm 7.8 0.0 61.2sec 61.2sec 9.01% 28.54%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:3.1%
  • deadly_calm_2:3.0%
  • deadly_calm_3:3.0%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 29.1 42.8 15.7sec 6.4sec 74.75% 76.11%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:74.8%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 48.8 24.2 9.2sec 6.1sec 36.57% 42.76%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:16.7%
  • flurry_2:5.4%
  • flurry_3:14.5%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 393.0sec 0.0sec 10.09% 10.09%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
raging_blow 57.3 14.7 7.9sec 6.4sec 36.73% 36.73%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:27.4%
  • raging_blow_2:9.3%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
recklessness 3.4 0.0 161.7sec 166.4sec 13.62% 14.94%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.7 0.0 48.5sec 48.5sec 31.94% 31.94%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.9%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_1h_T14H
execute Rage 23.8 713.1 30.0 30.0 11898.1
heroic_strike Rage 67.5 1831.7 27.1 27.1 2389.4
impending_victory Rage 8.6 85.7 10.0 10.0 3054.9
raging_blow Rage 56.5 564.9 10.0 10.0 14955.5
wild_strike Rage 53.9 877.8 16.3 16.3 3652.4
Resource Gains Type Count Total Average Overflow
battle_shout Rage 5.70 114.06 20.00 0.00 0.00%
bloodthirst Rage 91.03 910.33 10.00 0.01 0.00%
enrage Rage 71.93 716.36 9.96 2.98 0.41%
melee_main_hand Rage 173.69 1580.53 9.10 0.01 0.00%
melee_off_hand Rage 173.62 780.12 4.49 1.19 0.15%
Resource RPS-Gain RPS-Loss
Rage 9.10 9.04
Combat End Resource Mean Min Max
Health 455691.00 455691.00 455691.00
Rage 28.31 0.00 87.40
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 151.9 3.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 117739.01
Minimum 103194.73
Maximum 134451.41
Spread ( max - min ) 31256.68
Range [ ( max - min ) / 2 * 100% ] 13.27%
Standard Deviation 4045.5851
5th Percentile 111158.03
95th Percentile 124395.09
( 95th Percentile - 5th Percentile ) 13237.07
Mean Distribution
Standard Deviation 40.4639
95.00% Confidence Intervall ( 117659.70 - 117818.32 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4535
0.1 Scale Factor Error with Delta=300 139716
0.05 Scale Factor Error with Delta=300 558864
0.01 Scale Factor Error with Delta=300 13971606
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 117739.01

Damage

Sample Data
Count 9996
Mean 53046142.51

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 424.28
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 5.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.43 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.94 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 13.29 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 10.81 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.81 deadly_calm,use_off_gcd=1,if=rage>=40
D 67.47 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 91.03 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 12.69 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 28.45 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 21.09 colossus_smash
I 23.77 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 56.49 raging_blow,if=buff.raging_blow.react
L 24.14 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 7.00 dragon_roar,if=talent.dragon_roar.enabled
O 11.52 heroic_throw
P 4.98 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 4.35 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 8.57 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 12.72 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.73 battle_shout,if=rage<70

Sample Sequence

579AEHBCDKEDKDNEOKEKSEDTHDEDKDREKPEKLFEADKLGEDHBDO5EKSDGETT9ECDLDHDFEKLGEKNEALKFEDLOGEDHBDKDEDKLFELLFEPSETAHDGEDKDRELLLEO9GECDKDDGEHBDN5EKSETKGEATHD7EDKDOEKGEKTETKGEHBDKDGEDSPAEK9TCDGEKDLDFEKHDEDLLFEKNGEOTEKSEAHBDKD5ETGETTGELHDFEKDLG9EKLFECDKDLGEDAOPEHBDKDEDNSGEKTETTEKHDEDLLALEKOEKTESTGEHBD9C5DEKDLFEDKLGEKHDEDAKDNGEOPEKSEDTTEHBDRGEDKGEKTGEATKEO796IEHICIEIIGEIKEIGEIHBIAEIKEINEIOEIPGEHIIEIIGEIK9GEAIKEHBCIEIOEIGEIIGEIK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20050 17730 16678
Agility 226 215 80
Stamina 22092 20084 19896
Intellect 121 115 80
Spirit 146 146 80
Health 455691 427579 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.25% 15.25% 2633
Spell Crit 23.26% 18.25% 10346
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 44352 35680 0
Melee Hit 7.74% 7.74% 2633
Melee Crit 28.27% 23.26% 10346
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.77% 10.15% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 28.66% 21.66% 4484

Gear

Average Item Level: 506.50
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
Main Hand kilrak_jaws_of_terror,id=87173,gems=500str,enchant=dancing_steel,reforge=hit_crit
Off Hand kilrak_jaws_of_terror,id=87173,enchant=dancing_steel,reforge=hit_crit
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_1h_T14H"
origin="http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=dancing_steel,reforge=hit_crit
off_hand=kilrak_jaws_of_terror,id=87173,enchant=dancing_steel,reforge=hit_crit

# Gear Summary
# gear_strength=16678
# gear_agility=80
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2633
# gear_crit_rating=10346
# gear_haste_rating=784
# gear_mastery_rating=4484
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel

Warrior_Fury_2h_T14H : 114301 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114301.2 114301.2 77.28 / 0.07% 6496 / 5.7% 12459.9 9.2 9.2 Rage 8.66% 56.8 100.0%
Origin http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:191745|141772|110656|48184|44735|44549|25838|14790|14070|9236&chds=0,383489&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++191745++execute,C79C6E,0,0,15|t++141772++dragon_roar,C79C6E,1,0,15|t++110656++raging_blow,C79C6E,2,0,15|t++48184++wild_strike,C79C6E,3,0,15|t++44735++bloodthirst,C79C6E,4,0,15|t++44549++colossus_smash,C79C6E,5,0,15|t++25838++impending_victory,C79C6E,6,0,15|t++14790++melee_main_hand,C79C6E,7,0,15|t++14070++heroic_throw,C79C6E,8,0,15|t++9236++melee_off_hand,C79C6E,9,0,15&chtt=Warrior_Fury_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,12,12,12,8,8,7,7,6,5,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|melee_main_hand|bloodthirst|raging_blow_mh|heroic_strike|melee_off_hand|raging_blow_oh|deep_wounds|wild_strike|bloodbath|dragon_roar|colossus_smash|heroic_leap|impending_victory|heroic_throw&chtt=Warrior_Fury_2h_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:855423211zyywxustpmmkjihggdccbbbabbZXWUTSRRRRRRRSRRRSSSSTWYZbcdeefefgffgffeeeedccccbbbaaaZaaZZZZZZYZZZYYZZZYYYYYYZZZZZaaaZYXWVVVWVWWWXWWWWVVUVWXYZabcbcccdddfffgfghgggghgfgffffffeeeefedeeeeeeeeedddccccccbbbaZXWVTSSTSTTTTTTSTSSSSUVVWXYZYYYYZZZabbbccdddeeeedeeedddddccccbaaaaaaaaaZZZZZYZZZZYZZYXWVUTSSTTUVVXXXYZaaabefghikkjkiijihiihhhhhhghhhhghhhhhhihhhhhhghhhhhiiiiiiiiiijjjjjkkjkjjjjjjjjjjjjjjjjjjjjjjjijiiihhhggggggggggghhhhiiijjkkkllmmmmmmmmmmmmmmmmnnnoopqqrstuuvwwxxxxxxxxwwvvuuttssrrrrqqqqppoonnnmmmmllkkkjjjjjiiiiiiiiiijiiiiiiiiiiiihhhgeeeddcccbbb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114301|max=226890&chxp=1,1,50,100&chtt=Warrior_Fury_2h_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,4,6,5,7,8,17,28,44,60,84,120,133,184,249,273,346,375,508,473,549,619,642,636,608,627,601,519,446,382,341,261,203,200,114,107,62,43,38,26,19,9,9,3,5,1,0,1&chds=0,642&chbh=5&chxt=x&chxl=0:|min=98470|avg=114301|max=129689&chxp=0,1,51,100&chtt=Warrior_Fury_2h_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.0,20.1,13.8,8.3,7.2,3.9,2.9,2.4,1.9,8.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 139.8s|raging_blow 90.5s|wild_strike 62.4s|execute 37.3s|colossus_smash 32.4s|heroic_throw 17.5s|impending_victory 12.9s|dragon_roar 10.7s|battle_shout 8.6s|waiting 39.0s&chtt=Warrior_Fury_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T14H 114301
battle_shout 0 0.0% 5.6 72.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.62 5.62 0.00 0.00 1.5366 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 13.0 36.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 12.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 5462 4.8% 7.9 60.57sec 309614 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.7 19407 0 19407 0.0% 0.0% 28.1%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 117.67 126.69 126.69 0.0000 1.0000 2458606.16 2458606.16 0.00 19407.09 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.73 93.25% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.94 6.75% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 100.00% 19406.98 539 89105 19437.59 13018 27458 2458606 2458606 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:18791.09
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 13875 12.1% 91.0 4.98sec 68734 44735 40519 86043 68734 62.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.99 90.99 0.00 0.00 1.5365 0.0000 6254333.97 6254333.97 0.00 44734.53 44734.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.59 38.02% 40519.49 27156 68282 40584.95 35708 47434 1401611 1401611 0.00
crit 56.40 61.98% 86042.77 55941 140661 85982.92 77758 92913 4852723 4852723 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 0 0.0% 91.0 4.98sec 0 0 0 0 0 25.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 90.99 90.99 0.00 0.00 0.0000 0.0000 0.00 142446.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.66 74.36% 0.00 0 0 0.00 0 0 0 84300 100.00
crit 23.33 25.64% 0.00 0 0 0.00 0 0 0 58147 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 3202 2.8% 21.1 21.82sec 68447 44549 50421 106406 68447 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.08 21.08 0.00 0.00 1.5365 0.0000 1442617.41 1442617.41 0.00 44548.60 44548.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.29 67.80% 50421.35 36752 63109 50410.32 40265 56288 720472 720472 0.00
crit 6.79 32.20% 106405.81 75710 130004 106521.28 0 126561 722146 722146 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 61.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 8100 7.1% 91.0 4.98sec 40094 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 18212 37543 24375 31.9% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.99 90.99 149.66 149.66 0.0000 3.0000 3648127.34 3648127.34 0.00 8125.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.9 68.12% 18212.07 12251 26509 18212.96 16681 19590 1856645 1856645 0.00
crit 47.7 31.88% 37542.65 24503 53018 37567.95 33479 42524 1791482 1791482 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3380 3.0% 7.0 66.56sec 217838 141772 0 217838 217838 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.98 6.98 0.00 0.00 1.5365 0.0000 1520220.71 1520220.71 0.00 141771.96 141771.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 6.98 100.00% 217837.50 144767 315036 217960.91 162602 265256 1520221 1520221 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 15890 13.9% 24.3 3.38sec 294610 191745 208786 454285 294610 35.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.30 24.30 0.00 0.00 1.5365 0.0000 7158591.43 7158591.43 0.00 191744.56 191744.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.80 65.04% 208785.54 116747 367576 208970.17 159498 261873 3299442 3299442 0.00
crit 8.49 34.96% 454284.88 240500 757206 455074.70 0 717265 3859149 3859149 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2474 2.2% 10.8 43.60sec 103153 0 75291 160172 103153 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 10.80 0.00 0.00 0.0000 0.0000 1114054.80 1114054.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.25 67.17% 75291.28 50105 109105 75223.60 51145 91707 546178 546178 0.00
crit 3.55 32.83% 160171.99 103217 224756 158560.22 0 224756 567877 567877 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 9141 8.0% 69.3 5.29sec 59476 0 44157 92698 59476 31.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.27 69.27 0.00 0.00 0.0000 0.0000 4119652.48 4119652.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.41 68.44% 44157.43 23317 58864 44146.04 38721 49725 2093303 2093303 0.00
crit 21.86 31.56% 92697.76 48032 121260 92725.16 76882 108109 2026349 2026349 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 549 0.5% 11.4 37.61sec 21618 14070 16141 33820 21619 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.42 11.42 0.00 0.00 1.5365 0.0000 246832.07 246832.07 0.00 14070.12 14070.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.88 69.01% 16140.70 10787 26786 16154.29 11005 24033 127165 127165 0.00
crit 3.54 30.99% 33820.25 22221 55180 33300.72 0 52932 119667 119667 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 742 0.6% 8.4 42.47sec 39700 25838 29684 62637 39700 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.42 8.42 0.00 0.00 1.5365 0.0000 334168.06 334168.06 0.00 25838.40 25838.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.86 69.60% 29683.73 21613 51473 29652.73 0 51473 173892 173892 0.00
crit 2.56 30.40% 62636.79 44523 106035 59179.52 0 106035 160276 160276 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 8.4 42.47sec 0 0 0 0 0 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.42 8.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.24 74.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 25.88% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 13910 12.2% 156.0 2.88sec 40202 14790 38460 79316 40202 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 155.96 155.96 0.00 0.00 2.7182 0.0000 6269703.51 6269703.51 0.00 14789.72 14789.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.54 29.20% 38459.88 23731 60618 38466.84 31826 43602 1751421 1751421 0.00
crit 43.33 27.78% 79316.07 48886 124872 79328.08 68462 91452 3436934 3436934 0.00
glance 37.47 24.03% 28857.65 17798 45463 28862.11 24569 33979 1081348 1081348 0.00
miss 29.61 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 8688 7.6% 155.9 2.88sec 25111 9236 24046 49547 25111 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 155.95 155.95 0.00 0.00 2.7189 0.0000 3916079.65 3916079.65 0.00 9235.71 9235.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.48 29.16% 24046.26 14832 37886 24051.61 20995 27087 1093660 1093660 0.00
crit 43.31 27.77% 49547.10 30554 78045 49559.04 42846 57767 2145663 2145663 0.00
glance 37.50 24.05% 18046.33 11124 28415 18048.88 15466 20696 676757 676757 0.00
miss 29.66 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (22220) 0.0% (19.5%) 58.9 7.55sec 170024 110656 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.93 58.93 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 110656.02 110656.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 13669 12.0% 58.9 7.55sec 104597 0 76749 160697 104597 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.93 58.93 0.00 0.00 0.0000 0.0000 6163400.48 6163400.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.38 66.83% 76749.48 44816 113454 76753.86 68910 87023 3022260 3022260 0.00
crit 19.55 33.17% 160697.46 92321 233714 160787.06 135556 189729 3141140 3141140 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 8551 7.5% 58.9 7.55sec 65432 0 47938 100557 65432 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.93 58.93 0.00 0.00 0.0000 0.0000 3855617.15 3855617.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.33 66.75% 47938.36 28010 70908 47940.24 42622 53575 1885619 1885619 0.00
crit 19.59 33.25% 100556.63 57700 146071 100617.70 84501 120110 1969999 1969999 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.4 166.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 3.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 6668 5.8% 52.4 6.75sec 57345 48184 42927 90153 57345 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.41 52.41 0.00 0.00 1.1901 0.0000 3005227.13 3005227.13 0.00 48183.86 48183.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.40 69.47% 42927.30 29242 73783 42933.86 35371 49922 1562745 1562745 0.00
crit 16.00 30.53% 90152.87 60239 151994 90176.80 70173 118025 1442482 1442482 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 13.0 0.0 36.1sec 36.2sec 17.18% 17.18%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.2%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 7.9 0.0 60.5sec 60.6sec 20.89% 23.24%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.9%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.93%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 14.4 3.7 30.2sec 23.9sec 29.66% 69.28%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:8.1%
  • bloodsurge_2:4.5%
  • bloodsurge_3:17.1%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 13.8 14.6 32.6sec 15.4sec 53.61% 52.33%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:53.6%
dancing_steel_oh 10.1 4.7 42.1sec 27.9sec 32.75% 32.63%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:32.7%
darkmist_vortex 7.4 0.0 64.5sec 64.5sec 32.27% 32.27%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.3%
deadly_calm 7.8 0.0 61.0sec 61.0sec 9.04% 27.81%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:3.1%
  • deadly_calm_2:3.0%
  • deadly_calm_3:3.0%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 28.3 47.8 16.1sec 6.1sec 78.25% 79.38%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:78.2%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 39.5 25.8 11.3sec 6.8sec 43.14% 47.21%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:20.1%
  • flurry_2:5.2%
  • flurry_3:17.8%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 392.8sec 0.0sec 10.09% 10.09%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
raging_blow 59.8 16.4 7.5sec 6.1sec 38.90% 38.90%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:28.3%
  • raging_blow_2:10.6%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raid_movement_1:6.3%
recklessness 3.4 0.0 161.6sec 166.3sec 13.62% 14.77%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.7 0.0 48.8sec 48.8sec 31.71% 31.71%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.7%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_2h_T14H
execute Rage 24.3 729.0 30.0 30.0 9820.3
heroic_strike Rage 69.3 1885.4 27.2 27.2 2185.1
impending_victory Rage 8.4 84.2 10.0 10.0 3970.0
raging_blow Rage 58.9 589.3 10.0 10.0 17002.4
wild_strike Rage 52.4 846.1 16.1 16.1 3551.9
Resource Gains Type Count Total Average Overflow
battle_shout Rage 5.62 112.41 20.00 0.00 0.00%
bloodthirst Rage 90.99 909.90 10.00 0.00 0.00%
enrage Rage 76.16 757.72 9.95 3.85 0.51%
melee_main_hand Rage 126.34 1591.39 12.60 0.53 0.03%
melee_off_hand Rage 126.29 790.73 6.26 4.89 0.61%
Resource RPS-Gain RPS-Loss
Rage 9.24 9.18
Combat End Resource Mean Min Max
Health 492161.00 492161.00 492161.00
Rage 29.13 0.10 89.70
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 165.3 3.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 114301.16
Minimum 98470.30
Maximum 129688.77
Spread ( max - min ) 31218.47
Range [ ( max - min ) / 2 * 100% ] 13.66%
Standard Deviation 3942.1183
5th Percentile 107737.27
95th Percentile 120728.68
( 95th Percentile - 5th Percentile ) 12991.41
Mean Distribution
Standard Deviation 39.4291
95.00% Confidence Intervall ( 114223.88 - 114378.44 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4569
0.1 Scale Factor Error with Delta=300 132660
0.05 Scale Factor Error with Delta=300 530643
0.01 Scale Factor Error with Delta=300 13266091
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 114301.16

Damage

Sample Data
Count 9996
Mean 51507232.35

DTPS

Sample Data
Count 9996
Mean 0.00

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 426.16
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 5.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.43 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.94 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 12.97 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 10.80 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.82 deadly_calm,use_off_gcd=1,if=rage>=40
D 69.27 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 90.99 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 12.78 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 27.80 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 21.08 colossus_smash
I 24.30 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 58.93 raging_blow,if=buff.raging_blow.react
L 23.41 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 6.98 dragon_roar,if=talent.dragon_roar.enabled
O 11.42 heroic_throw
P 4.94 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 4.01 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 8.42 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 12.22 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.68 battle_shout,if=rage<70

Sample Sequence

579AEHBCDKGEDKDNEKLFEKLGEKDHDGEDLLFDELAKFEKLGELLFEDHBDO5EKLFELS9ADGCEDKDHDEDKDNDEKPEKODGETTEHBDKDGEDSKEAKEKTGEKHDFDEDKDLGEKOGEK9SCDEDLLDAKEHBDNU5EKTGELKFEKHD7FDEDKODGEKSELKFEKLFEHBDKDFDEAK9GCDEDDOESELHDFDELDNGELLLEKPEDKGOA5EHBDKDGEDSGEKGEKLF9EDCKDHDFDEADKLFELOGELLFENSEHBDKDFDEDKLFEALPGEDKTGEODHDGEKDRDEKSE9C5DEKDHBDEDKREALKFEKLGEKNEDHDKDEDKDOEKLFEKLGEADSHBDEDKDUDEIKGECIKE796IOEHIIEKIGEIKEAIIEIHBIEIKEINEIIEIKEHIGEAIKECI9OGEIIEIKEHBIIEIK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21788 19385 18254
Agility 226 215 80
Stamina 24697 22452 22264
Intellect 121 115 80
Spirit 146 146 80
Health 492161 460731 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2549
Spell Crit 25.79% 20.79% 11866
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 48176 38990 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 30.80% 25.80% 11866
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 11.23% 10.59% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.24% 23.24% 5158

Gear

Average Item Level: 506.50
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_hit
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_hit
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158,reforge=hit_mastery
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
Off Hand shinka_execution_of_dominion,id=87176,enchant=dancing_steel
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_2h_T14H"
origin="http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_hit
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_hit
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
off_hand=shinka_execution_of_dominion,id=87176,enchant=dancing_steel

# Gear Summary
# gear_strength=18254
# gear_agility=80
# gear_stamina=22264
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2549
# gear_crit_rating=11866
# gear_haste_rating=784
# gear_mastery_rating=5158
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel
# off_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Healing Target : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active
8391.0 132535.6 Health 0.00% 0.0 100.0%

Charts

http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-1,100&chtt=Healing%20Target DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Healing Target 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
divine_aegis 36.5 54.7 12.3sec 4.9sec 62.92% 85.34%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_divine_aegis
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • divine_aegis_1:62.9%

Spelldata details

  • id:47753
  • name:Divine Aegis
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
grace 1.0 262.0 0.0sec 1.7sec 99.60% 99.54%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_grace
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grace_1:0.2%
  • grace_2:0.2%
  • grace_3:99.3%
health_decade_10__20 0.0 0.0 0.0sec 2.0sec 2.17% 2.17%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:2.2%
health_decade_20__30 0.1 0.0 0.0sec 2.2sec 8.01% 8.01%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:8.0%
health_decade_30__40 0.1 0.0 0.0sec 2.1sec 4.98% 4.98%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:5.0%
health_decade_40__50 0.1 0.0 0.0sec 2.2sec 3.24% 3.24%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:3.2%
health_decade_50__60 0.1 0.0 0.0sec 2.1sec 0.93% 0.93%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_50__60
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_50__60_1:0.9%
health_decade_60__70 0.0 0.0 0.0sec 2.1sec 0.19% 0.19%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_60__70
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_60__70_1:0.2%
power_word_shield 32.7 0.0 13.9sec 14.1sec 36.74% 100.00%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_power_word_shield
  • max_stacks:1
  • duration:15.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • power_word_shield_1:36.7%

Spelldata details

  • id:17
  • name:Power Word: Shield
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
  • max_stacks:
  • duration:15.00
  • cooldown:6.00
  • default_chance:0.00%
weakened_soul 32.7 0.0 13.9sec 14.1sec 82.65% 76.24%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_soul
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • weakened_soul_1:82.7%

Spelldata details

  • id:6788
  • name:Weakened Soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • description:The target's soul is weakened by the force of Power Word: Shield, and cannot be shielded again for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
health_decade_90__100

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Healing Target
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 132535.65 8390.96
Combat End Resource Mean Min Max
Health 65951406.56 53131598.58 80180342.76
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 0.00

Damage

Sample Data
Count 9996
Mean 0.00

DTPS

Sample Data
Count 9996
Mean 8363.83

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 132703.29

#Executed Foreground Actions

Sample Data
Count 9996
Mean 0.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 100000000 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% -1.#J% 0
Spell Haste 1.#J% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% -1.#J% 0
Melee Haste 1.#J% 0.00% 0
Swing Speed 1.#J% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 0 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

unknown="Healing Target"
origin="unknown"
level=90
race=humanoid
spec=unknown
role=tank
position=back


# Gear Summary

Simulation & Raid Information

Iterations: 9996
Threads: 7
Confidence: 95.00
Fight Length: 352 - 551 ( 450.5 )

Performance:
Total Events Processed: 1137087158
Max Event Queue: 736
Sim Seconds: 4503176
CPU Seconds: 582.7570
Speed Up: 7727

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
RNG global_deterministic
RNG global_deterministic: Actual ( Confidence Interval ): Roll=nan Range=nan nan

Simulation Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%
Standard Deviation 54.6643
5th Percentile 368.24
95th Percentile 536.34
( 95th Percentile - 5th Percentile ) 168.10
Mean Distribution
Standard Deviation 0.5468
95.00% Confidence Intervall ( 449.43 - 451.57 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 565
0.1% Error 56561
0.1 Scale Factor Error with Delta=300 25
0.05 Scale Factor Error with Delta=300 102
0.01 Scale Factor Error with Delta=300 2550
Distribution Chart
Timeline Distribution Chart Gear Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Ability Id Total Hit Crit Count Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Interval Duration
Death_Knight_Frost_1h_T14H blood_fury 20572 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.51sec 450.50sec
Death_Knight_Frost_1h_T14H blood_plague 55078 1250120 0 0 66.5 0.0% 0.0% 0.0% 0.0% 126.5 9308 18602 6.2% 0.0% 12.49sec 450.50sec
Death_Knight_Frost_1h_T14H death_and_decay 43265 465811 0 0 9.6 6.3% 0.0% 0.0% 0.0% 104.3 4193 8641 6.1% 0.0% 43.47sec 450.50sec
Death_Knight_Frost_1h_T14H empower_rune_weapon 47568 0 0 0 1.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 330.63sec 450.50sec
Death_Knight_Frost_1h_T14H frost_fever 55095 2158681 0 0 139.3 0.0% 0.0% 0.0% 0.0% 136.3 14931 29854 6.1% 0.0% 3.23sec 450.50sec
Death_Knight_Frost_1h_T14H frost_strike 49143 13830143 58694 120942 154.5 49.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.89sec 450.50sec
Death_Knight_Frost_1h_T14H frost_strike_offhand 66196 6917727 29349 60487 154.5 49.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.89sec 450.50sec
Death_Knight_Frost_1h_T14H horn_of_winter 57330 0 0 0 11.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 40.34sec 450.50sec
Death_Knight_Frost_1h_T14H howling_blast 49184 10383843 73280 150968 133.1 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.36sec 450.50sec
Death_Knight_Frost_1h_T14H melee_main_hand 0 3381311 15213 31324 253.9 11.1% 18.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.77sec 450.50sec
Death_Knight_Frost_1h_T14H melee_off_hand 0 1689958 7605 15668 253.9 11.1% 18.3% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.77sec 450.50sec
Death_Knight_Frost_1h_T14H obliterate 49020 1901888 46612 95516 31.2 29.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.02sec 450.50sec
Death_Knight_Frost_1h_T14H obliterate_offhand 66198 950390 23306 47764 31.2 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.02sec 450.50sec
Death_Knight_Frost_1h_T14H outbreak 77575 0 0 0 6.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 78.04sec 450.50sec
Death_Knight_Frost_1h_T14H pillar_of_frost 51271 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.58sec 450.50sec
Death_Knight_Frost_1h_T14H plague_leech 123693 0 0 0 17.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.09sec 450.50sec
Death_Knight_Frost_1h_T14H plague_strike 45462 500235 14857 30594 30.1 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.93sec 450.50sec
Death_Knight_Frost_1h_T14H plague_strike_offhand 66216 250294 7428 15297 30.1 11.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.93sec 450.50sec
Death_Knight_Frost_1h_T14H raise_dead 46584 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.53sec 450.50sec
Death_Knight_Frost_1h_T14H razorice 50401 295171 663 0 445.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.01sec 450.50sec
Death_Knight_Frost_1h_T14H soul_reaper 130735 3120332 15285 31469 21.6 11.1% 0.0% 0.0% 0.0% 20.9 117629 242557 11.0% 0.0% 7.38sec 450.50sec
Death_Knight_Frost_1h_T14H_ghoul claw 91776 674313 7542 15093 80.5 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.88sec 239.23sec
Death_Knight_Frost_1h_T14H_ghoul melee 0 1218239 6055 12109 191.4 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.30sec 239.23sec
Death_Knight_Frost_1h_T14H_army_of_the_dead claw 91776 723772 5428 10865 120.0 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.58sec 35.00sec
Death_Knight_Frost_1h_T14H_army_of_the_dead melee 0 1264234 4356 8709 276.1 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.99sec 35.00sec
Death_Knight_Frost_2h_T14H blood_fury 20572 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.49sec 450.50sec
Death_Knight_Frost_2h_T14H blood_plague 55078 1480573 0 0 15.4 0.0% 0.0% 0.0% 0.0% 139.5 9694 19412 9.4% 0.0% 30.15sec 450.50sec
Death_Knight_Frost_2h_T14H empower_rune_weapon 47568 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 309.97sec 450.50sec
Death_Knight_Frost_2h_T14H frost_fever 55095 2069925 0 0 55.3 0.0% 0.0% 0.0% 0.0% 142.7 13254 26511 9.5% 0.0% 8.14sec 450.50sec
Death_Knight_Frost_2h_T14H frost_strike 49143 12955018 60506 124681 160.8 31.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.78sec 450.50sec
Death_Knight_Frost_2h_T14H horn_of_winter 57330 0 0 0 15.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.46sec 450.50sec
Death_Knight_Frost_2h_T14H howling_blast 49184 3350302 64199 132066 47.4 9.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.38sec 450.50sec
Death_Knight_Frost_2h_T14H melee_main_hand 0 5627750 27002 55614 190.7 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.36sec 450.50sec
Death_Knight_Frost_2h_T14H obliterate 49020 16334726 114270 235066 105.7 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.25sec 450.50sec
Death_Knight_Frost_2h_T14H outbreak 77575 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.86sec 450.50sec
Death_Knight_Frost_2h_T14H pillar_of_frost 51271 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.92sec 450.50sec
Death_Knight_Frost_2h_T14H plague_leech 123693 0 0 0 6.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.99sec 450.50sec
Death_Knight_Frost_2h_T14H plague_strike 45462 215550 24879 51290 7.5 14.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 59.62sec 450.50sec
Death_Knight_Frost_2h_T14H raise_dead 46584 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.56sec 450.50sec
Death_Knight_Frost_2h_T14H soul_reaper 130735 3870182 27139 55899 21.9 14.4% 0.0% 0.0% 0.0% 21.2 130955 269928 14.4% 0.6% 7.26sec 450.50sec
Death_Knight_Frost_2h_T14H_ghoul claw 91776 737194 7639 15276 84.4 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.59sec 239.15sec
Death_Knight_Frost_2h_T14H_ghoul melee 0 1328809 6143 12279 199.6 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.20sec 239.15sec
Death_Knight_Frost_2h_T14H_army_of_the_dead claw 91776 796230 5438 10881 127.8 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.49sec 35.00sec
Death_Knight_Frost_2h_T14H_army_of_the_dead melee 0 1371730 4397 8790 287.6 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.95sec 35.00sec
Death_Knight_Unholy_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.58sec 450.50sec
Death_Knight_Unholy_T14H blood_plague 55078 3777757 0 0 7.9 0.0% 0.0% 0.0% 0.0% 142.3 23541 47090 12.8% 0.0% 60.60sec 450.50sec
Death_Knight_Unholy_T14H blood_tap 45529 0 0 0 45.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.61sec 450.50sec
Death_Knight_Unholy_T14H dark_transformation 63560 0 0 0 8.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 51.06sec 450.50sec
Death_Knight_Unholy_T14H death_coil 47541 7111341 53944 111122 115.9 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.85sec 450.50sec
Death_Knight_Unholy_T14H empower_rune_weapon 47568 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 308.16sec 450.50sec
Death_Knight_Unholy_T14H festering_strike 85948 2064421 49154 101276 35.3 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.83sec 450.50sec
Death_Knight_Unholy_T14H frost_fever 55095 2560342 0 0 7.9 0.0% 0.0% 0.0% 0.0% 142.2 15941 31888 12.9% 0.0% 60.60sec 450.50sec
Death_Knight_Unholy_T14H horn_of_winter 57330 0 0 0 17.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.03sec 450.50sec
Death_Knight_Unholy_T14H icy_touch 45477 6 21003 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Death_Knight_Unholy_T14H melee_main_hand 0 5483431 25231 51984 192.4 17.9% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 2.33sec 450.50sec
Death_Knight_Unholy_T14H outbreak 77575 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.61sec 450.50sec
Death_Knight_Unholy_T14H plague_leech 123693 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.66sec 450.50sec
Death_Knight_Unholy_T14H plague_strike 45462 7 23288 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Death_Knight_Unholy_T14H scourge_strike 55090 11662779 33576 72364 157.4 8.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.85sec 450.50sec
Death_Knight_Unholy_T14H soul_reaper 130736 5167002 25255 52005 21.8 17.9% 0.0% 0.0% 0.0% 21.1 181053 372899 17.7% 0.6% 7.30sec 450.50sec
Death_Knight_Unholy_T14H summon_gargoyle 49206 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.24sec 450.50sec
Death_Knight_Unholy_T14H unholy_frenzy 49016 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.64sec 450.50sec
Death_Knight_Unholy_T14H_gargoyle gargoyle_strike 51963 1847213 45314 90619 34.6 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.11sec 86.25sec
Death_Knight_Unholy_T14H_ghoul claw 91776 879828 10047 20087 74.3 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.13sec 450.50sec
Death_Knight_Unholy_T14H_ghoul melee 0 4380621 10538 21079 371.5 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.21sec 450.50sec
Death_Knight_Unholy_T14H_ghoul sweeping_claws 91778 2114859 18547 37082 96.7 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.41sec 450.50sec
Death_Knight_Unholy_T14H_army_of_the_dead claw 91776 1131544 5461 10921 175.8 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.70sec 35.00sec
Death_Knight_Unholy_T14H_army_of_the_dead melee 0 1712436 4424 8850 345.9 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.78sec 35.00sec
Druid_Balance_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.95sec 450.50sec
Druid_Balance_T14H moonfire 8921 6005357 15397 32105 27.9 22.7% 0.0% 0.0% 0.0% 317.1 13865 28850 22.6% 0.0% 16.26sec 450.50sec
Druid_Balance_T14H starfall 48505 5422326 0 0 15.7 0.0% 0.0% 0.0% 0.0% 155.2 28009 58377 22.8% 0.0% 30.93sec 450.50sec
Druid_Balance_T14H starfire 2912 12369774 112504 235140 88.1 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.01sec 450.50sec
Druid_Balance_T14H starsurge 78674 8016443 138069 286938 46.8 22.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.55sec 450.50sec
Druid_Balance_T14H sunfire 93402 5851287 15403 32146 27.7 22.6% 0.0% 0.0% 0.0% 312.9 13685 28363 22.6% 0.0% 16.34sec 450.50sec
Druid_Balance_T14H wild_mushroom 88747 0 0 0 20.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.52sec 450.50sec
Druid_Balance_T14H wild_mushroom_detonate 88751 441445 17695 37638 5.0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 74.70sec 450.50sec
Druid_Balance_T14H wrath 5176 6473268 56919 117462 92.2 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.82sec 450.50sec
Druid_Feral_T14H berserk 106952 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 188.75sec 450.50sec
Druid_Feral_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.38sec 450.50sec
Druid_Feral_T14H cat_melee 0 11464205 16595 34615 497.4 41.3% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.91sec 450.50sec
Druid_Feral_T14H feral_spirit 110807 0 0 0 3.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 124.60sec 450.50sec
Druid_Feral_T14H ferocious_bite 22568 3620317 103168 220150 19.8 68.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 23.10sec 450.50sec
Druid_Feral_T14H healing_touch 5185 1008351 0 0 43.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.62sec 450.50sec
Druid_Feral_T14H natures_swiftness 132158 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 68.98sec 450.50sec
Druid_Feral_T14H rake 1822 18113051 61425 129154 51.1 41.1% 0.1% 0.0% 0.0% 148.8 62476 131819 41.2% 0.0% 8.76sec 450.50sec
Druid_Feral_T14H rip 1079 12066503 0 0 11.9 0.0% 0.1% 0.0% 0.0% 209.6 39501 83839 40.8% 0.0% 30.32sec 450.50sec
Druid_Feral_T14H savage_roar 52610 0 0 0 17.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.58sec 450.50sec
Druid_Feral_T14H shred 5221 7050836 45123 93869 107.8 41.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.20sec 450.50sec
Druid_Feral_T14H tigers_fury 5217 0 0 0 14.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.48sec 450.50sec
Druid_Feral_T14H_symbiosis_wolf melee 0 379909 1581 3195 177.6 40.4% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.39sec 113.14sec
Druid_Feral_T14H_symbiosis_wolf spirit_bite 58859 334620 6226 12606 37.8 41.3% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.93sec 113.14sec
Hunter_BM_T14H arcane_shot 3044 5578588 33560 69484 126.1 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.51sec 450.50sec
Hunter_BM_T14H aspect_of_the_fox 82661 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.00sec 450.50sec
Hunter_BM_T14H aspect_of_the_hawk 13165 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.01sec 450.50sec
Hunter_BM_T14H bestial_wrath 19574 0 0 0 8.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 56.74sec 450.50sec
Hunter_BM_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.73sec 450.50sec
Hunter_BM_T14H cobra_shot 77767 2900756 20660 42610 106.8 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.02sec 450.50sec
Hunter_BM_T14H dire_beast 120679 0 0 0 15.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.50sec 450.50sec
Hunter_BM_T14H focus_fire 82692 0 0 0 9.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 44.45sec 450.50sec
Hunter_BM_T14H glaive_toss 117050 2915066 37894 78573 29.3 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.55sec 450.50sec
Hunter_BM_T14H kill_command 34026 0 0 0 63.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.05sec 450.50sec
Hunter_BM_T14H kill_shot 53351 1708292 87368 180472 14.9 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.48sec 450.50sec
Hunter_BM_T14H lynx_rush 120697 0 0 0 6.3 0.0% 0.0% 0.0% 0.0% 56.7 0 0 13.1% 0.0% 75.29sec 450.50sec
Hunter_BM_T14H ranged 0 5727938 20968 43366 206.8 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.17sec 450.50sec
Hunter_BM_T14H rapid_fire 3045 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.78sec 450.50sec
Hunter_BM_T14H readiness 23989 0 0 0 1.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 388.24sec 450.50sec
Hunter_BM_T14H serpent_sting 1978 1357355 0 0 3.9 0.0% 0.0% 0.0% 0.0% 147.4 6990 14452 29.7% 0.0% 105.41sec 450.50sec
Hunter_BM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 450.50sec
Hunter_BM_T14H_cat claw 16827 5195903 25238 51024 130.1 57.2% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.48sec 450.50sec
Hunter_BM_T14H_cat kill_command 83381 7471204 83416 169288 63.6 39.9% 0.3% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 7.05sec 450.50sec
Hunter_BM_T14H_cat lynx_rush 120699 2484450 31393 66098 56.7 39.2% 3.7% 0.0% 1.4% 0.0 0 0 0.0% 0.0% 7.28sec 450.50sec
Hunter_BM_T14H_cat melee 0 6599866 15055 30888 321.8 40.1% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.40sec 450.50sec
Hunter_BM_T14H_cat rabid 53401 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 84.63sec 450.50sec
Hunter_BM_T14H_devilsaur claw 16827 188454 10094 20360 13.0 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.55sec 40.00sec
Hunter_BM_T14H_devilsaur melee 0 226041 5386 11358 29.2 44.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.29sec 40.00sec
Hunter_BM_T14H_devilsaur monstrous_bite 54680 0 0 0 8.0 42.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 45.58sec 40.00sec
Hunter_BM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.78sec 40.00sec
Hunter_BM_T14H_raptor claw 16827 188658 10100 20345 13.0 43.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.54sec 40.00sec
Hunter_BM_T14H_raptor melee 0 226393 5387 11356 29.2 44.4% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.28sec 40.00sec
Hunter_BM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.78sec 40.00sec
Hunter_BM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.78sec 40.00sec
Hunter_BM_T14H_hyena claw 16827 188247 10095 20357 13.0 43.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.55sec 40.00sec
Hunter_BM_T14H_hyena melee 0 226262 5386 11353 29.2 44.4% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.30sec 40.00sec
Hunter_BM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.78sec 40.00sec
Hunter_BM_T14H_wolf claw 16827 188276 10077 20403 13.0 42.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.54sec 40.00sec
Hunter_BM_T14H_wolf melee 0 226248 5386 11354 29.2 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.28sec 40.00sec
Hunter_BM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.78sec 40.00sec
Hunter_BM_T14H_dire_beast dire_beast_melee 0 3496822 19835 40340 140.8 30.1% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.11sec 210.63sec
Hunter_MM_T14H aimed_shot 19434 2241578 69048 150947 20.0 52.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.01sec 450.50sec
Hunter_MM_T14H aimed_shot_mm 82928 1951437 69401 143927 20.6 34.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.01sec 450.50sec
Hunter_MM_T14H arcane_shot 3044 4111355 31798 65685 95.9 33.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.99sec 450.50sec
Hunter_MM_T14H aspect_of_the_fox 82661 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.01sec 450.50sec
Hunter_MM_T14H aspect_of_the_hawk 13165 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.07sec 450.50sec
Hunter_MM_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.68sec 450.50sec
Hunter_MM_T14H chimera_shot 53209 4329332 73818 152509 43.7 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.79sec 450.50sec
Hunter_MM_T14H dire_beast 120679 0 0 0 15.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.24sec 450.50sec
Hunter_MM_T14H glaive_toss 117050 2976236 36730 76348 30.0 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.23sec 450.50sec
Hunter_MM_T14H kill_shot 53351 1585093 84327 174439 14.0 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.86sec 450.50sec
Hunter_MM_T14H lynx_rush 120697 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 61.4 0 0 16.1% 0.0% 70.32sec 450.50sec
Hunter_MM_T14H piercing_shots 63468 1725949 0 0 79.2 0.0% 0.0% 0.0% 0.0% 339.9 5078 0 0.0% 0.0% 5.52sec 450.50sec
Hunter_MM_T14H ranged 0 5762465 20295 41996 210.1 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.13sec 450.50sec
Hunter_MM_T14H rapid_fire 3045 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 108.03sec 450.50sec
Hunter_MM_T14H readiness 23989 0 0 0 1.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 402.64sec 450.50sec
Hunter_MM_T14H serpent_sting 1978 1288350 0 0 1.2 0.0% 0.0% 0.0% 0.0% 140.8 6788 14063 32.5% 0.0% 249.30sec 450.50sec
Hunter_MM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 450.50sec
Hunter_MM_T14H steady_shot 56641 1965382 10531 22002 135.2 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.25sec 450.50sec
Hunter_MM_T14H wild_quiver_shot 76663 3889786 15762 31677 185.6 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.40sec 450.50sec
Hunter_MM_T14H_cat claw 16827 2570371 13881 28417 128.1 42.7% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.53sec 450.50sec
Hunter_MM_T14H_cat lynx_rush 120699 2080080 23870 49622 61.4 42.4% 3.8% 0.0% 1.3% 0.0 0 0 0.0% 0.0% 6.88sec 450.50sec
Hunter_MM_T14H_cat melee 0 4366973 10028 20531 313.0 43.1% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.44sec 450.50sec
Hunter_MM_T14H_cat rabid 53401 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.66sec 450.50sec
Hunter_MM_T14H_devilsaur claw 16827 147308 6939 14763 13.9 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.77sec 40.00sec
Hunter_MM_T14H_devilsaur melee 0 161809 3674 7731 30.0 47.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 44.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.84sec 40.00sec
Hunter_MM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.20sec 40.00sec
Hunter_MM_T14H_raptor claw 16827 147468 6930 14781 13.9 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.77sec 40.00sec
Hunter_MM_T14H_raptor melee 0 161626 3671 7734 30.0 47.1% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.20sec 40.00sec
Hunter_MM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.20sec 40.00sec
Hunter_MM_T14H_hyena claw 16827 147135 6931 14786 13.9 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.77sec 40.00sec
Hunter_MM_T14H_hyena melee 0 161873 3672 7736 30.0 47.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.20sec 40.00sec
Hunter_MM_T14H_wolf claw 16827 147318 6929 14787 13.9 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.77sec 40.00sec
Hunter_MM_T14H_wolf melee 0 161775 3672 7736 30.0 47.2% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.20sec 40.00sec
Hunter_MM_T14H_dire_beast dire_beast_melee 0 2895239 13771 28259 161.3 34.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 217.76sec
Hunter_SV_T14H arcane_shot 3044 4139053 37011 76634 82.8 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.27sec 450.50sec
Hunter_SV_T14H aspect_of_the_fox 82661 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 84.93sec 450.50sec
Hunter_SV_T14H aspect_of_the_hawk 13165 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.02sec 450.50sec
Hunter_SV_T14H black_arrow 3674 3548310 0 0 18.0 0.0% 0.0% 0.0% 0.0% 177.8 14691 30631 33.0% 0.0% 25.03sec 450.50sec
Hunter_SV_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.72sec 450.50sec
Hunter_SV_T14H cobra_shot 77767 2574772 23711 48988 81.0 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.30sec 450.50sec
Hunter_SV_T14H dire_beast 120679 0 0 0 15.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.78sec 450.50sec
Hunter_SV_T14H explosive_shot 53301 9607344 18439 38434 129.8 33.0% 0.0% 0.0% 0.0% 222.9 21354 43153 33.0% 0.0% 3.44sec 450.50sec
Hunter_SV_T14H glaive_toss 117050 2965718 36788 76517 29.9 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.23sec 450.50sec
Hunter_SV_T14H kill_shot 53351 1520102 84286 174426 13.4 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.06sec 450.50sec
Hunter_SV_T14H lynx_rush 120697 0 0 0 7.1 0.0% 0.0% 0.0% 0.0% 63.3 0 0 16.3% 0.0% 67.64sec 450.50sec
Hunter_SV_T14H ranged 0 5422087 20360 42211 196.4 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.28sec 450.50sec
Hunter_SV_T14H rapid_fire 3045 0 0 0 4.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 102.58sec 450.50sec
Hunter_SV_T14H readiness 23989 0 0 0 1.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 381.98sec 450.50sec
Hunter_SV_T14H serpent_sting 1978 3180829 0 0 2.2 0.0% 0.0% 0.0% 0.0% 147.6 15923 33073 32.8% 0.0% 115.60sec 450.50sec
Hunter_SV_T14H serpent_sting_burst 0 109662 34863 72270 2.2 39.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 115.60sec 450.50sec
Hunter_SV_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.63sec 450.50sec
Hunter_SV_T14H_cat claw 16827 2143617 13604 27894 108.7 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 4.17sec 450.50sec
Hunter_SV_T14H_cat lynx_rush 120699 2165585 24044 50104 63.3 42.5% 3.7% 0.0% 1.3% 0.0 0 0 0.0% 0.0% 6.65sec 450.50sec
Hunter_SV_T14H_cat melee 0 4363950 10026 20517 313.0 43.0% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.44sec 450.50sec
Hunter_SV_T14H_cat rabid 53401 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.53sec 450.50sec
Hunter_SV_T14H_devilsaur claw 16827 133879 6828 14324 13.0 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.85sec 40.00sec
Hunter_SV_T14H_devilsaur melee 0 159064 3621 7581 30.0 47.5% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.09sec 40.00sec
Hunter_SV_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 64.05sec 40.00sec
Hunter_SV_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.67sec 40.00sec
Hunter_SV_T14H_raptor claw 16827 134209 6797 14393 13.0 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.85sec 40.00sec
Hunter_SV_T14H_raptor melee 0 159331 3623 7577 30.0 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.09sec 40.00sec
Hunter_SV_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.67sec 40.00sec
Hunter_SV_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.67sec 40.00sec
Hunter_SV_T14H_hyena claw 16827 134021 6819 14341 13.0 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.85sec 40.00sec
Hunter_SV_T14H_hyena melee 0 159298 3622 7575 30.0 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.09sec 40.00sec
Hunter_SV_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.67sec 40.00sec
Hunter_SV_T14H_wolf claw 16827 134065 6809 14367 13.0 46.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.85sec 40.00sec
Hunter_SV_T14H_wolf melee 0 159262 3623 7575 30.0 47.7% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.09sec 40.00sec
Hunter_SV_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.67sec 40.00sec
Hunter_SV_T14H_dire_beast dire_beast_melee 0 2821317 13752 28123 157.5 34.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.81sec 208.85sec
Mage_Arcane_T14H alter_time_activate 108978 0 0 0 2.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 200.41sec 450.50sec
Mage_Arcane_T14H arcane_barrage 44425 7120854 174726 366528 34.9 15.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.98sec 450.50sec
Mage_Arcane_T14H arcane_blast 30451 20190125 125476 262618 137.5 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.27sec 450.50sec
Mage_Arcane_T14H arcane_missiles 5143 18286507 0 0 67.7 0.0% 0.0% 0.0% 0.0% 334.8 46839 98255 15.7% 0.1% 6.53sec 450.50sec
Mage_Arcane_T14H arcane_power 12042 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.56sec 450.50sec
Mage_Arcane_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 186.41sec 450.50sec
Mage_Arcane_T14H fire_blast 2136 260269 56000 115716 4.0 15.2% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.07sec 450.50sec
Mage_Arcane_T14H ice_lance 30455 195044 17470 36291 9.6 15.0% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.88sec 450.50sec
Mage_Arcane_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.12sec 450.50sec
Mage_Arcane_T14H nether_tempest 114923 7895246 0 0 35.1 0.0% 0.1% 0.0% 0.0% 534.3 12635 26368 15.6% 0.0% 13.00sec 450.50sec
Mage_Arcane_T14H presence_of_mind 12043 0 0 0 5.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.11sec 450.50sec
Mage_Arcane_T14H rune_of_power 116011 0 0 0 7.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 64.74sec 450.50sec
Mage_Arcane_T14H_mirror_image arcane_blast 88084 969575 5635 11464 147.2 16.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.69sec 86.88sec
Mage_Fire_T14H alter_time_activate 108978 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 189.03sec 450.50sec
Mage_Fire_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 189.81sec 450.50sec
Mage_Fire_T14H combustion 11129 7815591 46504 96603 12.1 29.1% 0.0% 0.0% 0.0% 163.1 32898 68770 29.3% 0.0% 37.93sec 450.50sec
Mage_Fire_T14H evocation 12051 0 0 0 10.0 0.0% 0.0% 0.0% 0.0% 39.7 0 0 28.7% 0.0% 46.92sec 450.50sec
Mage_Fire_T14H fireball 133 15915779 77038 159940 140.9 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.17sec 450.50sec
Mage_Fire_T14H ice_lance 30455 217900 10844 22413 15.4 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.03sec 450.50sec
Mage_Fire_T14H ignite 12654 7041856 0 0 217.4 0.0% 0.0% 0.0% 0.0% 207.3 33974 0 0.0% 0.0% 2.05sec 450.50sec
Mage_Fire_T14H inferno_blast 108853 1803307 0 63403 28.4 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.65sec 450.50sec
Mage_Fire_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.49sec 450.50sec
Mage_Fire_T14H nether_tempest 114923 5409443 0 0 32.7 0.0% 0.0% 0.0% 0.0% 504.0 8183 16951 29.1% 0.0% 13.90sec 450.50sec
Mage_Fire_T14H presence_of_mind 12043 0 0 0 5.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.55sec 450.50sec
Mage_Fire_T14H pyroblast 11366 17305272 150786 313358 48.9 43.9% 0.0% 0.0% 0.0% 179.4 24549 51005 43.8% 0.0% 9.05sec 450.50sec
Mage_Fire_T14H_mirror_image fireball 88082 1157852 6009 12117 148.3 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.67sec 86.74sec
Mage_Frost_T14H alter_time_activate 108978 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 185.45sec 450.50sec
Mage_Frost_T14H blood_fury 33702 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 126.54sec 450.50sec
Mage_Frost_T14H evocation 12051 0 0 0 10.0 0.0% 0.0% 0.0% 0.0% 39.8 0 0 18.4% 0.0% 46.59sec 450.50sec
Mage_Frost_T14H fire_blast 2136 181636 38060 78803 4.0 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.39sec 450.50sec
Mage_Frost_T14H frost_bomb 112948 6468622 0 0 46.3 0.0% 0.0% 0.0% 0.0% 45.9 117218 243469 18.8% 0.0% 9.74sec 450.50sec
Mage_Frost_T14H frostbolt 116 10007456 62466 127994 134.2 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.31sec 450.50sec
Mage_Frost_T14H frostfire_bolt 44614 6863605 76543 155505 47.3 87.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.34sec 450.50sec
Mage_Frost_T14H frozen_orb 84714 2318801 0 0 7.5 0.0% 0.0% 0.0% 0.0% 75.0 25647 53243 19.0% 0.0% 62.97sec 450.50sec
Mage_Frost_T14H ice_lance 30455 8724698 34080 152434 72.3 73.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.02sec 450.50sec
Mage_Frost_T14H icy_veins 12472 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 94.87sec 450.50sec
Mage_Frost_T14H mini_frostbolt 131079 2800321 34506 71857 0.0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Mage_Frost_T14H mini_frostfire_bolt 131081 2888685 44232 95293 0.0 89.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Mage_Frost_T14H mini_ice_lance 131080 3453076 14526 81810 0.0 68.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Mage_Frost_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.11sec 450.50sec
Mage_Frost_T14H presence_of_mind 12043 0 0 0 5.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 90.80sec 450.50sec
Mage_Frost_T14H_water_elemental freeze 33395 44449 2165 4343 17.3 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.60sec 450.50sec
Mage_Frost_T14H_water_elemental mini_waterbolt 131581 2329922 14590 29547 0.0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Mage_Frost_T14H_water_elemental waterbolt 31707 7493571 25883 51522 245.4 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.83sec 450.50sec
Mage_Frost_T14H_mirror_image fire_blast 59637 163630 3164 6396 43.1 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.20sec 85.85sec
Mage_Frost_T14H_mirror_image frostbolt 59638 918216 3943 7970 194.8 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.91sec 85.85sec
Monk_Windwalker_1h_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.74sec 450.50sec
Monk_Windwalker_1h_T14H blackout_kick 100784 10133830 65162 135068 109.1 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.07sec 450.50sec
Monk_Windwalker_1h_T14H blackout_kick_dot 128531 1511434 0 0 109.0 0.0% 0.0% 0.0% 0.0% 327.0 4622 0 0.0% 0.0% 4.07sec 450.50sec
Monk_Windwalker_1h_T14H energizing_brew 115288 0 0 0 6.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 65.02sec 450.50sec
Monk_Windwalker_1h_T14H fists_of_fury 113656 4650380 0 0 13.7 0.0% 0.0% 0.0% 0.0% 53.9 60822 125736 39.2% 0.0% 28.94sec 450.50sec
Monk_Windwalker_1h_T14H invoke_xuen 123904 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.78sec 450.50sec
Monk_Windwalker_1h_T14H jab 100780 2757290 13716 28437 140.9 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.20sec 450.50sec
Monk_Windwalker_1h_T14H melee_main_hand 0 8342938 33665 70655 208.2 39.8% 19.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 2.16sec 450.50sec
Monk_Windwalker_1h_T14H melee_off_hand 0 4946905 19558 41122 212.3 39.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.12sec 450.50sec
Monk_Windwalker_1h_T14H rising_sun_kick 107428 7993778 116691 241715 48.1 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.40sec 450.50sec
Monk_Windwalker_1h_T14H tiger_palm 100787 1758649 27355 56700 45.0 40.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.04sec 450.50sec
Monk_Windwalker_1h_T14H tiger_strikes_melee 0 3901386 26911 56036 101.2 40.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.71sec 450.50sec
Monk_Windwalker_1h_T14H tigereye_brew_use 116740 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.15sec 450.50sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger crackling_tiger_lightning 123996 2200577 0 0 22.9 0.0% 0.0% 0.0% 0.0% 113.8 13582 27732 40.7% 0.0% 18.79sec 128.49sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger melee 0 906442 3283 6698 201.0 41.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.00sec 128.49sec
Paladin_Retribution_T14H ancient_fury 86704 225007 92281 190743 2.0 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.81sec 450.50sec
Paladin_Retribution_T14H avenging_wrath 31884 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.66sec 450.50sec
Paladin_Retribution_T14H censure 31803 4722874 0 0 307.1 0.0% 0.0% 0.0% 0.0% 200.9 19068 39448 21.8% 0.0% 1.47sec 450.50sec
Paladin_Retribution_T14H crusader_strike 35395 3031361 31462 64882 78.3 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.76sec 450.50sec
Paladin_Retribution_T14H execution_sentence 114157 2587272 0 0 7.8 0.0% 0.0% 0.0% 0.0% 77.1 27554 56775 20.5% 0.0% 60.98sec 450.50sec
Paladin_Retribution_T14H exorcism 879 3787009 62070 128657 50.1 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.04sec 450.50sec
Paladin_Retribution_T14H guardian_of_ancient_kings 86698 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.81sec 450.50sec
Paladin_Retribution_T14H hammer_of_wrath 24275 7183483 83084 171167 70.1 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.40sec 450.50sec
Paladin_Retribution_T14H hand_of_light 0 9912506 46195 0 214.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.10sec 450.50sec
Paladin_Retribution_T14H inquisition 84963 0 0 0 15.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.35sec 450.50sec
Paladin_Retribution_T14H judgment 20271 3196279 48472 100270 53.5 21.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.32sec 450.50sec
Paladin_Retribution_T14H melee 0 5062288 26568 54780 162.6 21.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 450.50sec
Paladin_Retribution_T14H seal_of_truth_proc 31801 2300413 6076 12553 307.1 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.47sec 450.50sec
Paladin_Retribution_T14H templars_verdict 85256 6736560 82491 169901 66.2 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.68sec 450.50sec
Paladin_Retribution_T14H_guardian_of_ancient_kings melee 0 2160027 47400 0 48.5 0.0% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 6.96sec 60.00sec
Priest_Disc_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.76sec 450.50sec
Priest_Disc_T14H divine_aegis 0 0 33467 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Priest_Disc_T14H greater_heal 2060 14455277 137580 274996 78.0 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.70sec 450.50sec
Priest_Disc_T14H greater_heal_divine_aegis 47753 3458772 0 0 27.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 16.61sec 450.50sec
Priest_Disc_T14H inner_focus 89485 0 0 0 15.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.28sec 450.50sec
Priest_Disc_T14H mindbender 123040 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.46sec 450.50sec
Priest_Disc_T14H penance_heal 47540 8707138 0 0 62.3 0.0% 0.0% 0.0% 0.0% 185.3 39754 79543 18.4% 0.0% 7.27sec 450.50sec
Priest_Disc_T14H penance_heal_tick_divine_aegis 47753 1256810 0 0 34.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.84sec 450.50sec
Priest_Disc_T14H power_word_shield 17 4357647 33298 0 32.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.07sec 450.50sec
Priest_Disc_T14H power_word_shield_glyph 55672 1031645 26641 53300 32.7 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.07sec 450.50sec
Priest_Disc_T14H power_word_shield_glyph_divine_aegis 47753 148691 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 64.62sec 450.50sec
Priest_Disc_T14H renew 139 3346579 0 0 32.0 0.0% 0.0% 0.0% 0.0% 130.5 21638 43293 18.5% 0.0% 14.03sec 450.50sec
Priest_Disc_T14H renew_divine_aegis 47753 484462 0 0 24.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.86sec 450.50sec
Priest_Disc_T14H_mindbender melee 0 2392770 29917 59865 84.6 15.5% 15.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.44sec 102.35sec
Priest_Disc_T14H_mindbender shadowcrawl 63619 0 0 0 20.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.95sec 102.35sec
Priest_Holy_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.14sec 450.50sec
Priest_Holy_T14H chakra 81208 0 0 0 15.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.06sec 450.50sec
Priest_Holy_T14H echo_of_light 77489 4961376 0 0 235.5 0.0% 0.0% 0.0% 0.0% 437.4 11343 0 0.0% 0.0% 1.91sec 450.50sec
Priest_Holy_T14H flash_heal 2061 3174067 79391 158817 26.8 49.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 16.37sec 450.50sec
Priest_Holy_T14H greater_heal 2060 4911364 105723 211459 32.0 45.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.88sec 450.50sec
Priest_Holy_T14H heal 2050 9756533 49534 99096 136.9 43.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.28sec 450.50sec
Priest_Holy_T14H holy_word_serenity 88684 3343480 62762 125550 39.9 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.40sec 450.50sec
Priest_Holy_T14H renew 139 5011209 0 0 3.1 0.0% 0.0% 0.0% 0.0% 182.5 19144 38304 43.4% 0.0% 103.85sec 450.50sec
Priest_Holy_T14H shadowfiend 34433 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.02sec 450.50sec
Priest_Holy_T14H_shadowfiend melee 0 1163160 44404 88866 27.7 15.4% 14.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 12.27sec 32.74sec
Priest_Holy_T14H_shadowfiend shadowcrawl 63619 0 0 0 5.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.35sec 32.74sec
Priest_Shadow_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.94sec 450.50sec
Priest_Shadow_T14H devouring_plague 2944 2718650 125008 258685 18.2 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.93sec 450.50sec
Priest_Shadow_T14H devouring_plague_mastery 124467 1190043 20894 43334 47.7 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.38sec 450.50sec
Priest_Shadow_T14H devouring_plague_tick 2944 3768854 0 0 18.2 0.0% 0.0% 0.0% 0.0% 152.4 20691 42889 18.2% 0.0% 25.93sec 450.50sec
Priest_Shadow_T14H halo_damage 120644 1648183 124043 257578 11.1 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.85sec 450.50sec
Priest_Shadow_T14H mind_blast 8092 5338211 98920 204991 45.1 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.05sec 450.50sec
Priest_Shadow_T14H mind_flay 15407 9190099 0 0 130.8 0.0% 0.0% 0.0% 0.0% 294.0 26122 54180 18.3% 0.0% 3.39sec 450.50sec
Priest_Shadow_T14H mind_flay_mastery 124468 2868212 26060 54040 92.0 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.79sec 450.50sec
Priest_Shadow_T14H mind_spike 73510 4494840 99629 206481 37.7 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.50sec 450.50sec
Priest_Shadow_T14H shadow_word_death 32379 1972734 110049 228053 14.9 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.50sec 450.50sec
Priest_Shadow_T14H shadow_word_pain 589 4729482 0 0 37.2 0.0% 0.0% 0.0% 0.0% 238.5 15241 31545 28.1% 0.0% 12.10sec 450.50sec
Priest_Shadow_T14H shadow_word_pain_mastery 124464 1483033 15305 31652 74.6 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.96sec 450.50sec
Priest_Shadow_T14H shadowfiend 34433 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.99sec 450.50sec
Priest_Shadow_T14H shadowy_apparition 87532 1733962 19108 38484 77.9 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.72sec 450.50sec
Priest_Shadow_T14H vampiric_touch 34914 3963286 0 0 23.1 0.0% 0.0% 0.0% 0.0% 193.1 17161 35593 18.3% 0.0% 19.75sec 450.50sec
Priest_Shadow_T14H vampiric_touch_mastery 124465 1242242 17233 35721 60.3 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.34sec 450.50sec
Priest_Shadow_T14H_shadowfiend melee 0 2380419 52544 106304 39.7 19.7% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 9.41sec 34.88sec
Priest_Shadow_T14H_shadowfiend shadowcrawl 63619 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 74.20sec 34.88sec
Rogue_Assassination_T14H ambush 8676 378807 60955 128481 4.6 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 130.99sec 450.50sec
Rogue_Assassination_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.54sec 450.50sec
Rogue_Assassination_T14H deadly_poison_dot 2818 6150445 0 0 535.5 0.0% 0.0% 0.0% 0.0% 149.5 29933 63459 33.4% 0.0% 1.07sec 450.50sec
Rogue_Assassination_T14H deadly_poison_instant 113780 11459708 15531 33030 534.5 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.07sec 450.50sec
Rogue_Assassination_T14H dispatch 111240 6072935 51383 107446 86.6 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.11sec 450.50sec
Rogue_Assassination_T14H envenom 32645 4838018 72036 153885 48.4 34.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.19sec 450.50sec
Rogue_Assassination_T14H melee_main_hand 0 4591793 12392 26275 330.6 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.36sec 450.50sec
Rogue_Assassination_T14H melee_off_hand 0 2303364 6217 13193 330.4 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.36sec 450.50sec
Rogue_Assassination_T14H mutilate 1329 0 0 0 69.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.27sec 450.50sec
Rogue_Assassination_T14H mutilate_mh 5374 2428324 25436 53900 69.4 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.27sec 450.50sec
Rogue_Assassination_T14H mutilate_oh 27576 1234066 12927 27391 69.4 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.27sec 450.50sec
Rogue_Assassination_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.68sec 450.50sec
Rogue_Assassination_T14H rupture 1943 1459884 0 0 23.4 0.0% 0.0% 0.0% 0.0% 220.8 4802 10152 33.8% 0.0% 19.51sec 450.50sec
Rogue_Assassination_T14H shadow_blade 121473 2061032 21096 44235 69.2 37.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.42sec 450.50sec
Rogue_Assassination_T14H shadow_blade_offhand 121474 1026895 10562 22120 68.9 37.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.44sec 450.50sec
Rogue_Assassination_T14H shadow_blades 121471 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.84sec 450.50sec
Rogue_Assassination_T14H slice_and_dice 5171 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 309.18sec 450.50sec
Rogue_Assassination_T14H tricks_of_the_trade 57934 0 0 0 14.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.17sec 450.50sec
Rogue_Assassination_T14H vanish 1856 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.28sec 450.50sec
Rogue_Assassination_T14H vendetta 79140 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.50sec 450.50sec
Rogue_Assassination_T14H venomous_wound 79136 6202390 27262 57749 165.7 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.69sec 450.50sec
Rogue_Combat_T14H adrenaline_rush 13750 0 0 0 5.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.19sec 450.50sec
Rogue_Combat_T14H ambush 8676 469456 63488 132011 5.3 37.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.36sec 450.50sec
Rogue_Combat_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.48sec 450.50sec
Rogue_Combat_T14H deadly_poison_dot 2818 4038711 0 0 339.7 0.0% 0.0% 0.0% 0.0% 149.3 19936 41937 32.3% 0.0% 1.42sec 450.50sec
Rogue_Combat_T14H deadly_poison_instant 113780 4912704 10645 22485 338.5 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.42sec 450.50sec
Rogue_Combat_T14H eviscerate 2098 4207533 89556 186957 34.9 31.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.61sec 450.50sec
Rogue_Combat_T14H killing_spree 51690 0 0 0 7.2 0.0% 0.0% 0.0% 0.0% 50.1 0 0 34.0% 0.0% 65.68sec 450.50sec
Rogue_Combat_T14H killing_spree_mh 0 1909614 0 0 50.1 0.0% 0.0% 0.0% 0.0% 0.0 27599 57900 34.7% 0.0% 8.42sec 450.50sec
Rogue_Combat_T14H killing_spree_oh 0 1158704 0 0 50.1 0.0% 0.0% 0.0% 0.0% 0.0 16726 35075 34.9% 0.0% 8.42sec 450.50sec
Rogue_Combat_T14H main_gauche 86392 5891085 23443 49096 185.2 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.43sec 450.50sec
Rogue_Combat_T14H melee_main_hand 0 5153940 19408 40978 238.1 32.6% 19.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 1.89sec 450.50sec
Rogue_Combat_T14H melee_off_hand 0 4517112 11724 24758 345.3 32.7% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.30sec 450.50sec
Rogue_Combat_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.10sec 450.50sec
Rogue_Combat_T14H revealing_strike 84617 824363 24147 50319 25.3 32.4% 0.0% 0.0% 0.0% 147.5 0 0 32.3% 0.0% 18.11sec 450.50sec
Rogue_Combat_T14H rupture 1943 1472271 0 0 10.6 0.0% 0.0% 0.0% 0.0% 126.1 8670 18059 32.1% 0.0% 41.37sec 450.50sec
Rogue_Combat_T14H shadow_blade 121473 2625257 29835 61796 65.9 31.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.07sec 450.50sec
Rogue_Combat_T14H shadow_blade_offhand 121474 2308539 18062 37455 95.6 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.17sec 450.50sec
Rogue_Combat_T14H shadow_blades 121471 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.45sec 450.50sec
Rogue_Combat_T14H sinister_strike 1752 7688284 31040 64678 183.4 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.44sec 450.50sec
Rogue_Combat_T14H slice_and_dice 5171 0 0 0 15.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.84sec 450.50sec
Rogue_Combat_T14H tricks_of_the_trade 57934 0 0 0 15.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.77sec 450.50sec
Rogue_Combat_T14H vanish 1856 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.36sec 450.50sec
Rogue_Subtlety_T14H ambush 8676 4353354 81658 172896 35.7 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.40sec 450.50sec
Rogue_Subtlety_T14H backstab 53 8040314 46708 98548 122.7 36.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.65sec 450.50sec
Rogue_Subtlety_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.14sec 450.50sec
Rogue_Subtlety_T14H deadly_poison_dot 2818 4314846 0 0 302.8 0.0% 0.0% 0.0% 0.0% 149.4 20350 42900 37.9% 0.0% 1.64sec 450.50sec
Rogue_Subtlety_T14H deadly_poison_instant 113780 4538616 10517 22281 301.6 38.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.64sec 450.50sec
Rogue_Subtlety_T14H eviscerate 2098 10683446 118573 257333 61.6 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.29sec 450.50sec
Rogue_Subtlety_T14H hemorrhage 16511 1489241 29493 62371 19.5 37.7% 0.0% 0.0% 0.0% 144.6 3278 6940 37.4% 0.0% 23.64sec 450.50sec
Rogue_Subtlety_T14H melee_main_hand 0 6894856 14672 31478 398.7 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.07sec 450.50sec
Rogue_Subtlety_T14H melee_off_hand 0 3465224 7362 15795 399.2 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.07sec 450.50sec
Rogue_Subtlety_T14H premeditation 14183 0 0 0 9.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 51.07sec 450.50sec
Rogue_Subtlety_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.48sec 450.50sec
Rogue_Subtlety_T14H rupture 1943 3791809 0 0 19.8 0.0% 0.0% 0.0% 0.0% 217.8 12320 25808 37.7% 0.0% 23.19sec 450.50sec
Rogue_Subtlety_T14H shadow_blade 121473 2992241 21612 45751 92.8 44.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.18sec 450.50sec
Rogue_Subtlety_T14H shadow_blade_offhand 121474 1488040 10851 22966 91.8 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.22sec 450.50sec
Rogue_Subtlety_T14H shadow_blades 121471 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.52sec 450.50sec
Rogue_Subtlety_T14H shadow_dance 51713 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.38sec 450.50sec
Rogue_Subtlety_T14H slice_and_dice 5171 0 0 0 13.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.11sec 450.50sec
Rogue_Subtlety_T14H tricks_of_the_trade 57934 0 0 0 14.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.52sec 450.50sec
Rogue_Subtlety_T14H vanish 1856 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 104.97sec 450.50sec
Shaman_Elemental_T14H ascendance 114049 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.39sec 450.50sec
Shaman_Elemental_T14H blood_fury 33697 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.09sec 450.50sec
Shaman_Elemental_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.57sec 450.50sec
Shaman_Elemental_T14H earth_shock 8042 1099319 26699 69456 32.0 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.23sec 450.50sec
Shaman_Elemental_T14H earth_shock_eoe 0 63636 25952 67594 1.9 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 111.12sec 450.50sec
Shaman_Elemental_T14H elemental_blast 117014 3677186 97312 253552 29.2 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.51sec 450.50sec
Shaman_Elemental_T14H elemental_blast_eoe 0 219547 97329 253577 1.7 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 115.54sec 450.50sec
Shaman_Elemental_T14H elemental_blast_overload 120588 1338782 73014 190303 14.2 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.56sec 450.50sec
Shaman_Elemental_T14H elemental_blast_overload_eoe 0 80876 72556 190331 0.9 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 132.56sec 450.50sec
Shaman_Elemental_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Shaman_Elemental_T14H flame_shock 8050 2428198 14993 39004 15.3 17.5% 0.0% 0.0% 0.0% 190.6 8754 22757 17.5% 0.0% 30.41sec 450.50sec
Shaman_Elemental_T14H flame_shock_eoe 0 17252 14565 37808 0.9 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 140.51sec 450.50sec
Shaman_Elemental_T14H fulmination 26364 3961120 96004 249479 32.0 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.23sec 450.50sec
Shaman_Elemental_T14H lava_burst 51505 12767069 0 146630 87.2 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.14sec 450.50sec
Shaman_Elemental_T14H lava_burst_eoe 0 750864 50959 144322 5.2 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 70.98sec 450.50sec
Shaman_Elemental_T14H lava_burst_overload 77451 4594845 38718 108479 42.5 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.40sec 450.50sec
Shaman_Elemental_T14H lava_burst_overload_eoe 0 281246 40411 111212 2.5 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 104.19sec 450.50sec
Shaman_Elemental_T14H lightning_bolt 403 8369994 47773 124255 137.0 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.11sec 450.50sec
Shaman_Elemental_T14H lightning_bolt_eoe 0 484729 46444 120833 8.2 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 46.74sec 450.50sec
Shaman_Elemental_T14H lightning_bolt_overload 45284 2696045 33193 86361 63.7 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.67sec 450.50sec
Shaman_Elemental_T14H lightning_bolt_overload_eoe 0 160264 33216 86317 3.8 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.46sec 450.50sec
Shaman_Elemental_T14H searing_totem 3599 0 0 0 5.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.53sec 450.50sec
Shaman_Elemental_T14H spiritwalkers_grace 79206 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 170.04sec 450.50sec
Shaman_Elemental_T14H unleash_elements 73680 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.26sec 450.50sec
Shaman_Elemental_T14H unleash_flame 73683 100364 19578 51169 4.0 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 85.26sec 450.50sec
Shaman_Elemental_T14H unleash_flame_eoe 0 6401 19613 50909 0.3 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 126.42sec 450.50sec
Shaman_Elemental_T14H_greater_fire_elemental fire_blast 57984 173572 6795 17161 20.0 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.75sec 119.97sec
Shaman_Elemental_T14H_greater_fire_elemental fire_melee 0 2308787 17075 43210 110.9 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.24sec 119.97sec
Shaman_Elemental_T14H_greater_earth_elemental earth_melee 0 496906 5770 11587 77.2 17.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.66sec 118.25sec
Shaman_Elemental_T14H_searing_totem searing_bolt 3606 1145754 4717 12263 190.6 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.03sec 309.74sec
Shaman_Enhancement_T14H ascendance 114049 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 182.75sec 450.50sec
Shaman_Enhancement_T14H blood_fury 33697 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.74sec 450.50sec
Shaman_Enhancement_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.24sec 450.50sec
Shaman_Enhancement_T14H earth_shock 8042 2321114 32117 66558 45.4 55.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.78sec 450.50sec
Shaman_Enhancement_T14H earth_shock_eoe 0 692031 32132 66551 13.5 55.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.73sec 450.50sec
Shaman_Enhancement_T14H feral_spirit 51533 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.77sec 450.50sec
Shaman_Enhancement_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.21sec 450.50sec
Shaman_Enhancement_T14H flame_shock 8050 3153146 23777 49508 13.9 15.5% 0.0% 0.0% 0.0% 165.6 14336 29887 15.2% 0.0% 33.42sec 450.50sec
Shaman_Enhancement_T14H flame_shock_eoe 0 115161 23784 49547 4.2 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 90.86sec 450.50sec
Shaman_Enhancement_T14H flametongue_oh 8024 2397872 7209 15071 284.3 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.58sec 450.50sec
Shaman_Enhancement_T14H improved_lava_lash 0 0 0 0 37.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.05sec 450.50sec
Shaman_Enhancement_T14H lava_lash 60103 5880292 108384 225551 39.2 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.42sec 450.50sec
Shaman_Enhancement_T14H lightning_bolt 403 4975317 42446 88153 73.3 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.08sec 450.50sec
Shaman_Enhancement_T14H lightning_bolt_eoe 0 1467897 42572 88396 21.6 55.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 20.21sec 450.50sec
Shaman_Enhancement_T14H lightning_shield 324 5217974 20334 42039 162.4 54.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.01sec 450.50sec
Shaman_Enhancement_T14H melee_main_hand 0 3197262 13845 28891 204.3 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.21sec 450.50sec
Shaman_Enhancement_T14H melee_off_hand 0 1588650 6920 14436 203.3 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.21sec 450.50sec
Shaman_Enhancement_T14H searing_totem 3599 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 71.97sec 450.50sec
Shaman_Enhancement_T14H spiritwalkers_grace 79206 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 170.49sec 450.50sec
Shaman_Enhancement_T14H stormblast 115356 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.03sec 450.50sec
Shaman_Enhancement_T14H stormblast_mh 115357 1081147 129826 272637 5.8 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.03sec 450.50sec
Shaman_Enhancement_T14H stormblast_oh 115360 541955 64891 136365 5.8 39.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.03sec 450.50sec
Shaman_Enhancement_T14H stormstrike 17364 0 0 0 46.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.79sec 450.50sec
Shaman_Enhancement_T14H stormstrike_mh 32175 3165089 50050 103809 46.1 34.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.79sec 450.50sec
Shaman_Enhancement_T14H stormstrike_oh 32176 1583758 25025 51906 46.1 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.79sec 450.50sec
Shaman_Enhancement_T14H unleash_elements 73680 0 0 0 29.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.69sec 450.50sec
Shaman_Enhancement_T14H unleash_flame 73683 792059 23338 48452 29.1 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.69sec 450.50sec
Shaman_Enhancement_T14H unleash_flame_eoe 0 237217 23319 48375 8.7 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 47.69sec 450.50sec
Shaman_Enhancement_T14H unleash_wind 73681 505841 12593 26155 29.1 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.69sec 450.50sec
Shaman_Enhancement_T14H windfury_mh 33757 2429587 15221 31661 115.3 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.56sec 450.50sec
Shaman_Enhancement_T14H windlash_main_hand 114089 1393330 34354 72146 28.0 40.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.48sec 450.50sec
Shaman_Enhancement_T14H windlash_off_hand 114093 708831 17191 36109 28.4 40.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.27sec 450.50sec
Shaman_Enhancement_T14H_spirit_wolf melee 0 835979 2408 4915 261.2 37.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.12sec 119.00sec
Shaman_Enhancement_T14H_spirit_wolf spirit_bite 58859 786528 14291 29102 39.7 37.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.84sec 119.00sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_blast 57984 224686 8151 16841 20.0 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.72sec 119.86sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_melee 0 3734638 20470 42503 137.6 35.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.62sec 119.86sec
Shaman_Enhancement_T14H_greater_earth_elemental earth_melee 0 637240 5013 10257 97.1 35.1% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.72sec 119.34sec
Shaman_Enhancement_T14H_searing_totem searing_bolt 3606 1299632 5538 11501 201.2 15.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.22sec 327.08sec
Warlock_Affliction_T14H agony 980 7697346 0 0 13.5 0.0% 0.0% 0.0% 0.0% 347.5 18594 38676 17.7% 0.0% 28.63sec 450.50sec
Warlock_Affliction_T14H agony_ds 0 1347840 29658 61579 38.1 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.50sec
Warlock_Affliction_T14H agony_mg 0 5553695 13779 28659 338.5 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.08sec 450.50sec
Warlock_Affliction_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.18sec 450.50sec
Warlock_Affliction_T14H corruption 172 6417787 0 0 15.2 0.0% 0.0% 0.0% 0.0% 344.3 15664 32549 17.6% 0.0% 25.76sec 450.50sec
Warlock_Affliction_T14H corruption_ds 0 1141284 25100 52070 38.1 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.50sec
Warlock_Affliction_T14H corruption_mg 0 4691084 11642 24196 338.5 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.08sec 450.50sec
Warlock_Affliction_T14H dark_soul 113860 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 81.20sec 450.50sec
Warlock_Affliction_T14H drain_soul 1120 2600297 0 0 16.9 0.0% 0.0% 0.0% 0.0% 38.1 57207 118722 18.0% 0.0% 4.86sec 450.50sec
Warlock_Affliction_T14H fel_flame 77799 899088 48384 100178 15.7 17.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.64sec 450.50sec
Warlock_Affliction_T14H haunt 48181 5671855 116703 242832 41.1 17.5% 0.0% 0.0% 0.0% 160.4 0 0 0.0% 0.0% 11.06sec 450.50sec
Warlock_Affliction_T14H life_tap 1454 0 0 0 12.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 33.21sec 450.50sec
Warlock_Affliction_T14H malefic_grasp 103103 5411998 0 0 99.5 0.0% 0.0% 0.0% 0.0% 338.5 13452 27927 17.5% 0.0% 3.68sec 450.50sec
Warlock_Affliction_T14H soul_swap 86121 255246 23757 49167 9.0 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 55.21sec 450.50sec
Warlock_Affliction_T14H soulburn 74434 0 0 0 9.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 53.26sec 450.50sec
Warlock_Affliction_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Warlock_Affliction_T14H unstable_affliction 30108 6873291 0 0 21.1 0.0% 0.0% 0.0% 0.0% 338.2 17070 35487 17.7% 0.0% 20.66sec 450.50sec
Warlock_Affliction_T14H unstable_affliction_ds 0 1242477 27327 56752 38.1 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.50sec
Warlock_Affliction_T14H unstable_affliction_mg 0 5117572 12702 26414 338.5 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.08sec 450.50sec
Warlock_Affliction_T14H_felhunter shadow_bite 54049 26247 22118 44236 1.0 18.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 0.00sec
Warlock_Affliction_T14H_doomguard doom_bolt 85692 952630 36884 75097 21.7 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.73sec 60.00sec
Warlock_Demonology_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.89sec 450.50sec
Warlock_Demonology_T14H cancel_metamorphosis 0 0 0 0 14.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.64sec 450.50sec
Warlock_Demonology_T14H corruption 172 3922743 0 0 1.0 0.0% 0.1% 0.0% 0.0% 286.3 11484 23897 17.9% 0.0% 301.64sec 450.50sec
Warlock_Demonology_T14H dark_soul 113861 0 0 0 6.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.87sec 450.50sec
Warlock_Demonology_T14H doom 603 4712464 0 0 9.2 0.0% 0.1% 0.0% 0.0% 39.2 100298 209205 18.3% 0.0% 47.05sec 450.50sec
Warlock_Demonology_T14H fel_flame 77799 722420 34380 71016 17.7 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.36sec 450.50sec
Warlock_Demonology_T14H hand_of_guldan 105174 849758 12118 25316 29.6 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.26sec 450.50sec
Warlock_Demonology_T14H life_tap 1454 0 0 0 14.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.20sec 450.50sec
Warlock_Demonology_T14H melee 103988 1864298 7115 14783 221.3 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.02sec 450.50sec
Warlock_Demonology_T14H metamorphosis 103958 0 0 0 18.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.96sec 450.50sec
Warlock_Demonology_T14H service_felguard 111898 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.89sec 450.50sec
Warlock_Demonology_T14H shadow_bolt 686 3573455 19216 39984 156.2 17.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.60sec 450.50sec
Warlock_Demonology_T14H shadowflame 47960 2106200 0 0 29.3 17.9% 0.0% 0.0% 0.0% 219.4 8032 16818 17.8% 0.0% 15.27sec 450.50sec
Warlock_Demonology_T14H soul_fire 6353 7004879 0 96123 73.5 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.91sec 450.50sec
Warlock_Demonology_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Warlock_Demonology_T14H touch_of_chaos 103964 8690134 57997 120290 126.0 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.53sec 450.50sec
Warlock_Demonology_T14H_doomguard doom_bolt 85692 1195385 48343 99425 20.8 18.2% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.83sec 60.00sec
Warlock_Demonology_T14H_felguard felstorm 89753 2501082 17863 35969 10.3 17.7% 0.1% 0.0% 0.0% 71.7 27006 54484 17.8% 0.1% 45.75sec 450.50sec
Warlock_Demonology_T14H_felguard legion_strike 30213 2242959 23022 46456 82.5 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.54sec 450.50sec
Warlock_Demonology_T14H_felguard melee 0 5225114 17562 35435 265.5 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.67sec 450.50sec
Warlock_Demonology_T14H_wild_imp firebolt 104318 5704348 15181 30594 355.0 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.25sec 326.75sec
Warlock_Demonology_T14H_service_felguard felstorm 89751 1194092 19824 39867 4.3 18.2% 0.1% 0.0% 0.0% 29.9 30827 61902 18.5% 0.1% 120.90sec 92.04sec
Warlock_Demonology_T14H_service_felguard legion_strike 30213 688138 26457 53652 21.9 18.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.43sec 92.04sec
Warlock_Demonology_T14H_service_felguard melee 0 1116496 20195 41081 48.9 18.4% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 8.45sec 92.04sec
Warlock_Destruction_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.91sec 450.50sec
Warlock_Destruction_T14H chaos_bolt 116858 9313848 0 343401 27.1 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.76sec 450.50sec
Warlock_Destruction_T14H conflagrate 17962 3405970 67023 141557 38.7 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.71sec 450.50sec
Warlock_Destruction_T14H dark_soul 113858 0 0 0 6.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.81sec 450.50sec
Warlock_Destruction_T14H immolate 348 4850588 16489 34789 27.3 27.5% 0.0% 0.0% 0.0% 197.6 16460 34773 28.0% 0.0% 16.46sec 450.50sec
Warlock_Destruction_T14H incinerate 29722 18172541 65238 136645 215.3 27.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.07sec 450.50sec
Warlock_Destruction_T14H shadowburn 17877 1962243 215849 447609 6.9 28.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.70sec 450.50sec
Warlock_Destruction_T14H summon_terrorguard 112927 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.50sec
Warlock_Destruction_T14H_observer melee 0 6238851 16066 32825 316.1 27.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.42sec 450.50sec
Warlock_Destruction_T14H_observer tongue_lash 115778 2963276 23583 48161 97.6 27.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.68sec 450.50sec
Warlock_Destruction_T14H_terrorguard doom_bolt 85692 1220311 42300 92913 21.3 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 60.00sec
Warrior_Arms_T14H battle_shout 6673 0 0 0 3.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 99.22sec 450.50sec
Warrior_Arms_T14H berserker_rage 18499 0 0 0 14.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.41sec 450.50sec
Warrior_Arms_T14H bloodbath 12292 2573132 0 0 7.9 0.0% 0.0% 0.0% 0.0% 126.4 20354 0 0.0% 0.0% 60.71sec 450.50sec
Warrior_Arms_T14H colossus_smash 86346 2463000 51634 107753 35.7 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.69sec 450.50sec
Warrior_Arms_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.72sec 450.50sec
Warrior_Arms_T14H deep_wounds 115767 2661436 0 0 70.7 0.0% 0.0% 0.0% 0.0% 149.7 13541 27782 29.8% 0.0% 6.42sec 450.50sec
Warrior_Arms_T14H dragon_roar 118000 1473077 0 206758 7.1 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 65.40sec 450.50sec
Warrior_Arms_T14H execute 5308 5824235 204751 444482 20.6 32.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.98sec 450.50sec
Warrior_Arms_T14H heroic_leap 6544 1041656 56124 118776 13.8 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 33.76sec 450.50sec
Warrior_Arms_T14H heroic_strike 78 3429510 76378 154938 34.1 30.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.71sec 450.50sec
Warrior_Arms_T14H heroic_throw 57755 178422 15078 31291 9.0 29.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 47.92sec 450.50sec
Warrior_Arms_T14H impending_victory 103840 8994 30983 62909 0.2 27.1% 0.2% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 108.15sec 450.50sec
Warrior_Arms_T14H melee_main_hand 0 6107314 35751 73674 141.0 25.7% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.18sec 450.50sec
Warrior_Arms_T14H mortal_strike 12294 7665886 81666 171225 70.8 29.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.42sec 450.50sec
Warrior_Arms_T14H opportunity_strike 76858 4515570 19156 39185 179.6 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.51sec 450.50sec
Warrior_Arms_T14H overpower 7384 6928421 41322 86718 85.5 87.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.25sec 450.50sec
Warrior_Arms_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 167.75sec 450.50sec
Warrior_Arms_T14H slam 1464 4455712 71028 148420 47.9 28.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.36sec 450.50sec
Warrior_Fury_1h_T14H battle_shout 6673 0 0 0 5.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.40sec 450.50sec
Warrior_Fury_1h_T14H berserker_rage 18499 0 0 0 13.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.27sec 450.50sec
Warrior_Fury_1h_T14H bloodbath 12292 2396391 0 0 7.9 0.0% 0.0% 0.0% 0.0% 126.5 18942 0 0.0% 0.0% 60.57sec 450.50sec
Warrior_Fury_1h_T14H bloodthirst 23881 4892253 32430 69472 91.0 57.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.98sec 450.50sec
Warrior_Fury_1h_T14H bloodthirst_heal 23881 139769 0 0 91.0 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.98sec 450.50sec
Warrior_Fury_1h_T14H colossus_smash 86346 1111578 39513 83884 21.1 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.80sec 450.50sec
Warrior_Fury_1h_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.16sec 450.50sec
Warrior_Fury_1h_T14H deep_wounds 115767 4370830 0 0 91.0 0.0% 0.0% 0.0% 0.0% 149.7 22207 46034 29.4% 0.0% 4.98sec 450.50sec
Warrior_Fury_1h_T14H dragon_roar 118000 1852495 0 264567 7.0 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 66.40sec 450.50sec
Warrior_Fury_1h_T14H execute 5308 8485098 257600 564679 23.8 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.43sec 450.50sec
Warrior_Fury_1h_T14H heroic_leap 6544 1331582 91620 196270 10.8 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.58sec 450.50sec
Warrior_Fury_1h_T14H heroic_strike 78 4376510 49009 103396 67.5 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.44sec 450.50sec
Warrior_Fury_1h_T14H heroic_throw 57755 190152 12561 26423 11.5 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 37.38sec 450.50sec
Warrior_Fury_1h_T14H impending_victory 103840 261733 23285 49112 8.6 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.81sec 450.50sec
Warrior_Fury_1h_T14H impending_victory__heal 118340 0 0 0 8.6 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.81sec 450.50sec
Warrior_Fury_1h_T14H melee_main_hand 0 6574852 30148 62142 213.8 25.2% 18.7% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.10sec 450.50sec
Warrior_Fury_1h_T14H melee_off_hand 0 5547911 25440 52428 213.8 25.3% 18.8% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.10sec 450.50sec
Warrior_Fury_1h_T14H raging_blow 85288 0 0 0 56.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.93sec 450.50sec
Warrior_Fury_1h_T14H raging_blow_mh 96103 4582600 60475 127173 56.5 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.93sec 450.50sec
Warrior_Fury_1h_T14H raging_blow_oh 85384 3866100 51018 107340 56.5 30.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.93sec 450.50sec
Warrior_Fury_1h_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 166.72sec 450.50sec
Warrior_Fury_1h_T14H wild_strike 100130 3206058 45464 95781 53.9 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.56sec 450.50sec
Warrior_Fury_2h_T14H battle_shout 6673 0 0 0 5.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.83sec 450.50sec
Warrior_Fury_2h_T14H berserker_rage 18499 0 0 0 13.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 36.18sec 450.50sec
Warrior_Fury_2h_T14H bloodbath 12292 2458606 0 0 7.9 0.0% 0.0% 0.0% 0.0% 126.7 19407 0 0.0% 0.0% 60.57sec 450.50sec
Warrior_Fury_2h_T14H bloodthirst 23881 6254334 40519 86043 91.0 62.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.98sec 450.50sec
Warrior_Fury_2h_T14H bloodthirst_heal 23881 142447 0 0 91.0 25.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.98sec 450.50sec
Warrior_Fury_2h_T14H colossus_smash 86346 1442617 50421 106406 21.1 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.82sec 450.50sec
Warrior_Fury_2h_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.05sec 450.50sec
Warrior_Fury_2h_T14H deep_wounds 115767 3648127 0 0 91.0 0.0% 0.0% 0.0% 0.0% 149.7 18212 37543 31.9% 0.0% 4.98sec 450.50sec
Warrior_Fury_2h_T14H dragon_roar 118000 1520221 0 217838 7.0 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 66.56sec 450.50sec
Warrior_Fury_2h_T14H execute 5308 7158591 208786 454285 24.3 35.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.38sec 450.50sec
Warrior_Fury_2h_T14H heroic_leap 6544 1114055 75291 160172 10.8 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.60sec 450.50sec
Warrior_Fury_2h_T14H heroic_strike 78 4119652 44157 92698 69.3 31.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.29sec 450.50sec
Warrior_Fury_2h_T14H heroic_throw 57755 246832 16141 33820 11.4 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 37.61sec 450.50sec
Warrior_Fury_2h_T14H impending_victory 103840 334168 29684 62637 8.4 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.47sec 450.50sec
Warrior_Fury_2h_T14H impending_victory__heal 118340 0 0 0 8.4 25.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.47sec 450.50sec
Warrior_Fury_2h_T14H melee_main_hand 0 6269704 38460 79316 156.0 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.88sec 450.50sec
Warrior_Fury_2h_T14H melee_off_hand 0 3916080 24046 49547 155.9 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.88sec 450.50sec
Warrior_Fury_2h_T14H raging_blow 85288 0 0 0 58.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.55sec 450.50sec
Warrior_Fury_2h_T14H raging_blow_mh 96103 6163400 76749 160697 58.9 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.55sec 450.50sec
Warrior_Fury_2h_T14H raging_blow_oh 85384 3855617 47938 100557 58.9 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.55sec 450.50sec
Warrior_Fury_2h_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 166.46sec 450.50sec
Warrior_Fury_2h_T14H wild_strike 100130 3005227 42927 90153 52.4 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.75sec 450.50sec

Fluffy_Pillow : 8364 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
8363.8 8363.8 21.06 / 0.25% 1774 / 21.2% -1.0 0.0 0.0 None 149.89% 0.1 100.0%

Charts

http://8.chart.apis.google.com/chart?chs=550x60&cht=bhg&chf=bg,s,333333&chd=t:8410&chds=0,16820&chco=C79C6E&chm=t++8410++melee_main_hand,C79C6E,0,0,15&chtt=Fluffy_Pillow Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:100&chds=0,100&chdls=ffffff&chco=C79C6E&chl=melee_main_hand&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:AAAAAACCFEIIIIIIIIIIIIIIIIIHIGHEEEEEEEEEFEGGHHIHJHLJNNSSWWWWXWYWZYZYZYYVVRSNQMQQUTWVVSTSTSVVXXXWXUVQTPURWWccihnjonssvvyx0x2x2w2w2w1vytvqqmnjlimimhlgibdXaXaZaaccebdZcYdZfdjhnkqnrpsqusvtvsupqlmghbdXZVXUWTVSVSWUZYdchgkjpnspsptqtququpvqwrwrwqvrvtxuyuxuxsuoqkmgideZbXZVYUXUXVZXcafejinlqosqvsxuyu0v1w2x3y50627372402x0vytwqtmnghbcWYVXUXVYVYVZVaYdchhlkpnrpurvsxuyv0vzuytwrupsoqlojmhjfgbcYZWYUXUXUYVZWbYdbgfkjonsrwuzw1x2y3z4z4y3x2x0vzuxsvqsnqlnikfhdeabXZWYVYVZWaYcafdihmlqpusyv0x2z405050504y2x0uxsvpsnqlnikfhdeacYZWYVYWZWaYcZechfljonsrwu0x3z5272834z4141404z3z3&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=8364|max=15474&chxp=1,1,54,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,1,1,0,3,6,5,12,12,20,19,34,56,82,83,110,133,182,203,277,307,384,413,486,500,561,547,619,615,583,531,526,497,445,380,319,257,207,160,140,80,61,52,38,21,13,8,0,1,3&chds=0,619&chbh=5&chxt=x&chxl=0:|min=3906|avg=8364|max=11943&chxp=0,1,55,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:149.9&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 675.3s&chtt=Fluffy_Pillow Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 8364
melee_main_hand 8364 100.0% 224.7 2.00sec 16820 8410 16820 0 16820 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.74 224.74 0.00 0.00 2.0000 0.0000 3780108.16 3780108.16 0.00 8409.83 8409.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 224.74 100.00% 16819.63 0 59609 16765.64 7825 23886 3780108 3780108 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:87529.00
  • base_dd_max:87529.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
censure 1.0 306.1 1.2sec 1.5sec 99.72% 99.85%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • censure_1:0.3%
  • censure_2:0.6%
  • censure_3:0.4%
  • censure_4:0.2%
  • censure_5:98.2%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 31.8 3.8 14.3sec 12.7sec 45.98% 48.37%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:46.0%
colossus_smash 21.1 0.0 21.8sec 21.8sec 27.91% 31.29%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:27.9%
colossus_smash 21.1 0.0 21.8sec 21.8sec 27.89% 31.61%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:27.9%
find_weakness 12.7 23.0 36.4sec 12.4sec 37.57% 37.10%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • find_weakness_1:37.6%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:Armor $w1% less effective against the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for $91021d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
frost_vulnerability 1.0 444.1 2.6sec 1.0sec 99.52% 99.82%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_vulnerability
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frost_vulnerability_1:0.4%
  • frost_vulnerability_2:0.2%
  • frost_vulnerability_3:0.2%
  • frost_vulnerability_4:0.1%
  • frost_vulnerability_5:98.7%

Spelldata details

  • id:51714
  • name:Frost Vulnerability
  • tooltip:Frost damage taken from the death knight's abilities increased by $s1%.
  • description:Imbues your rune weapon with the power of Frost. Your melee swings cause your target to take an additional $51714s1% damage from your Frost attacks for $51714d. This effect stacks up to 5 times.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
frostbolt 2.7 131.0 96.2sec 3.3sec 96.84% 96.46%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frostbolt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frostbolt_1:1.1%
  • frostbolt_2:1.0%
  • frostbolt_3:94.7%

Spelldata details

  • id:116
  • name:Frostbolt
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
haunt 20.9 20.0 19.1sec 11.1sec 71.44% 73.30%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • haunt_1:71.4%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
health_decade_0__10 1.0 0.0 0.0sec 0.0sec 9.11% 9.11%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_0__10
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_0__10_1:9.1%
health_decade_10__20 1.0 0.0 0.0sec 0.0sec 9.09% 9.09%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:9.1%
health_decade_20__30 1.0 0.0 0.0sec 0.0sec 10.58% 10.58%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:10.6%
health_decade_30__40 1.0 0.0 0.0sec 0.0sec 11.07% 11.07%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:11.1%
health_decade_40__50 1.0 0.0 0.0sec 0.0sec 11.14% 11.14%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:11.1%
health_decade_50__60 1.0 0.0 0.0sec 0.0sec 10.92% 10.92%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_50__60
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_50__60_1:10.9%
health_decade_60__70 1.0 0.0 0.0sec 0.0sec 11.54% 11.54%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_60__70
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_60__70_1:11.5%
health_decade_70__80 1.0 0.0 0.0sec 0.0sec 11.11% 11.11%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_70__80
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_70__80_1:11.1%
health_decade_80__90 1.0 0.0 0.0sec 0.0sec 9.99% 9.99%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_80__90
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_80__90_1:10.0%
health_decade_90__100 1.0 0.0 0.0sec 0.0sec 5.46% 5.46%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:5.5%
pyromaniac 7.4 25.3 62.1sec 13.9sec 95.91% 96.53%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyromaniac
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • pyromaniac_1:95.9%

Spelldata details

  • id:132209
  • name:Pyromaniac
  • tooltip:(null)
  • description:Your Nether Tempest, Living Bomb, and Frost Bomb spells now also apply the Pyromaniac effect. $@spellname132210 $@spelldesc132210
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
rising_sun_kick 1.7 46.4 152.3sec 9.4sec 99.31% 99.38%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_rising_sun_kick
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rising_sun_kick_1:99.3%

Spelldata details

  • id:130320
  • name:Rising Sun Kick
  • tooltip:Damage taken from abilities dealt by the Monk increased $w1%.
  • description:$@spelldesc107428
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
stormstrike 1.7 47.3 191.6sec 9.2sec 99.03% 99.42%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_stormstrike
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stormstrike_1:99.0%

Spelldata details

  • id:17364
  • name:Stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
  • max_stacks:
  • duration:15.00
  • cooldown:8.00
  • default_chance:1.00%
unleashed_fury_ft 29.1 8.7 15.7sec 12.0sec 64.26% 65.23%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_ft
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_ft_1:64.3%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage taken from the Shaman's Lightning Bolt by $s1%.
  • description:Increases the enemy target's damage taken from your Lightning Bolt by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
vendetta 4.3 0.0 120.5sec 120.5sec 27.36% 29.05%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • vendetta_1:27.4%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2803241.12
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
combo_points 224.8 2.9sec
combo_points_wasted 18.9 25.5sec
Rogue_Subtlety_T14H: combo_points 476.1 1.2sec
Rogue_Subtlety_T14H: anticipation_charges 60.5 9.2sec
Rogue_Subtlety_T14H: anticipation_charges_wasted 0.1 77.8sec
Rogue_Assassination_T14H: combo_points 328.6 2.8sec
Rogue_Assassination_T14H: anticipation_charges 29.6 19.5sec
Rogue_Assassination_T14H: anticipation_charges_wasted 0.4 24.4sec
Rogue_Combat_T14H: combo_points 304.9 2.1sec
Rogue_Combat_T14H: anticipation_charges 139.0 4.3sec
Rogue_Combat_T14H: anticipation_charges_wasted 6.4 74.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 450.50
Minimum 352.20
Maximum 551.44
Spread ( max - min ) 199.23
Range [ ( max - min ) / 2 * 100% ] 22.11%

DPS

Sample Data
Count 9996
Mean 8363.83
Minimum 3906.38
Maximum 11942.79
Spread ( max - min ) 8036.41
Range [ ( max - min ) / 2 * 100% ] 48.04%
Standard Deviation 1074.4887
5th Percentile 6541.44
95th Percentile 10089.35
( 95th Percentile - 5th Percentile ) 3547.91
Mean Distribution
Standard Deviation 10.7470
95.00% Confidence Intervall ( 8342.77 - 8384.90 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 633
0.1% Error 63399
0.1 Scale Factor Error with Delta=300 9855
0.05 Scale Factor Error with Delta=300 39422
0.01 Scale Factor Error with Delta=300 985569
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 8363.83

Damage

Sample Data
Count 9996
Mean 3780108.16

DTPS

Sample Data
Count 9996
Mean 2807375.09

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 1.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats
Default action list
# count action,conditions
1 1.00 auto_attack,damage=87529,attack_speed=2.0,target=Healing Target

Sample Sequence

1

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1515588388 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -1.#J% -1.#J% 0
Spell Haste 0.00% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit -1.#J% -1.#J% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
origin="unknown"
level=93
race=humanoid
spec=unknown
role=tank
position=back

actions.precombat=snapshot_stats

actions=auto_attack,damage=87529,attack_speed=2.0,target=Healing Target


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%%

Percentage of executes that resulted in critical strikes.

Dodge%%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%%

Percentage of executes that resulted in glancing blows.

G%%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.