close

SimulationCraft 504-7

for World of Warcraft 5.0.4 Live (build level 16016)

Beta Release

Table of Contents

Raid Summary

 

DPS Chart DPS Chart
HPS Chart

Death_Knight_Frost_1h_T14H : 116402 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
116402.5 116402.5 53.27 / 0.05% 4481 / 3.8% 15200.6 7.1 7.1 Runic Power 2.32% 59.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://2.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:139505|87128|75635|59304|47672|16065|8074|4036&chds=0,279010&chco=9482C9,0070DE,0070DE,C79C6E,9482C9,C79C6E,C79C6E,C79C6E&chm=t++139505++soul_reaper,9482C9,0,0,15|t++87128++frost_strike,0070DE,1,0,15|t++75635++howling_blast,0070DE,2,0,15|t++59304++obliterate,C79C6E,3,0,15|t++47672++death_and_decay,9482C9,4,0,15|t++16065++plague_strike,C79C6E,5,0,15|t++8074++melee_main_hand,C79C6E,6,0,15|t++4036++melee_off_hand,C79C6E,7,0,15&chtt=Death_Knight_Frost_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,21,15,7,7,4,4,4,3,3,3,2,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,C79C6E,9482C9,0070DE,C79C6E,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,0070DE,C79C6E&chl=frost_strike|howling_blast|frost_strike_offhand|melee_main_hand|soul_reaper|frost_fever|obliterate|melee_off_hand|army_of_the_dead: melee|blood_plague|ghoul: melee|obliterate_offhand|army_of_the_dead: claw|ghoul: claw|plague_strike|death_and_decay|razorice|plague_strike_offhand&chtt=Death_Knight_Frost_1h_T14H Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uvxyz012232355676420zxwvtsqonljjihgffefffffecbbbaaabbbbbbccccccddeffffeedccbbaaaZZZZYYYYYXYYZZZZZZYZZYYYYYYYYYXXYYYYZZabbbbbbbccdddeeeeedddddddddeddcbbbbaaaaaaZZZZYYYYYYYZZZYYXYYYYYZZZZZaaaaabbbcccccbbaaaaZZZZYYYYYXXXXWXXXXXXWWVVVVVVVVWWXXYYZZaabccddeeeeeeeeeddddccccbbbbbabbaaaZZZZZZZZZZZZZZZZZZZZaaaaaZZZZZZZZZaaaaaabaabbbbcbbbbaaaaaaaaZaZaaaaaaZaZaZZZZZYZZZZZaaabbccddeeffghhhhhggggfffffeeeedddddcccddddccbbbbaaaaaaaaaabbbccddeeeeefeffffffffffeeeedddddddccbbbaaaaaZZZZZZZZZZZaabbccddddeeffghhiiiijjjjjjiiiihhggfeeeddccccbbbbbbbbbbbbbaaaZYXXXXXWWWVVUUUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=116402|max=242164&chxp=1,1,48,100&chtt=Death_Knight_Frost_1h_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,2,4,6,10,9,11,32,44,48,79,132,166,208,292,338,427,433,493,590,599,615,647,617,609,542,543,458,376,344,276,255,211,154,132,97,53,44,35,30,11,8,7,7,0,2,2,0,1&chds=0,647&chbh=5&chxt=x&chxl=0:|min=106131|avg=116402|max=127658&chxp=0,1,48,100&chtt=Death_Knight_Frost_1h_T14H DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.7,30.3,7.8,7.2,5.1,4.1,2.1,2.1,1.4,1.0,2.3&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,9482C9,9482C9,C79C6E,ffffff&chl=frost_strike 165.4s|howling_blast 136.6s|plague_strike 35.2s|obliterate 32.6s|soul_reaper 22.8s|plague_leech 18.4s|horn_of_winter 9.4s|death_and_decay 9.4s|outbreak 6.4s|raise_dead 4.5s|waiting 10.5s&chtt=Death_Knight_Frost_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T14H 116402
blood_fury 0 0.0% 4.2 120.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.20 4.20 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 2802 2.4% 74.1 11.31sec 17038 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.5 9405 18801 9978 6.1% 0.0% 84.2%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.10 74.10 126.53 126.53 0.0000 3.0000 1262506.35 1262506.35 0.00 3325.96 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.8 93.91% 9405.44 7121 15380 9408.73 8637 10274 1117568 1117568 0.00
crit 7.7 6.09% 18800.76 14243 30760 18792.23 0 27050 144939 144939 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
death_and_decay 992 0.9% 9.1 43.57sec 49409 47672 0 0 0 6.2% 0.0% 0.0% 0.0% 98.4 4273 8797 4548 6.1% 0.0% 19.8%

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.06 9.06 98.43 98.43 1.0364 0.9079 447637.27 447637.27 0.00 4532.76 47671.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.50 93.85% 0.00 0 0 0.00 0 0 0 0 0.00
crit 0.56 6.15% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.4 93.91% 4272.52 3272 7103 4273.04 3472 5494 394928 394928 0.00
crit 6.0 6.09% 8797.02 6741 14631 8762.99 0 14631 52709 52709 0.00
DPS Timeline Chart

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every sec.$?$w4!=0[ Movement speed reduced by $w4%.][]
  • description:Corrupts the ground targeted by the Death Knight, causing $52212m1 Shadow damage every sec to targets that remain in the area $?s58629[and reducing their movement speed by $58629s1% ][]for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:51.10
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
empower_rune_weapon 0 0.0% 1.6 319.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.60 1.60 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4805 4.1% 138.0 3.25sec 15687 0 0 0 0 0.0% 0.0% 0.0% 0.0% 136.1 14989 29988 15901 6.1% 0.0% 90.6%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.01 138.01 136.15 136.15 0.0000 3.0000 2164907.78 2164907.78 0.00 5300.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.9 93.92% 14989.29 11423 24726 14994.56 14187 15766 1916634 1916634 0.00
crit 8.3 6.08% 29987.64 22845 49452 29972.50 0 47134 248274 248274 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 31994 27.5% 159.6 2.79sec 90308 87128 58608 120898 90308 50.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.57 159.57 0.00 0.00 1.0365 0.0000 14410651.90 14410651.90 0.00 87127.65 87127.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.36 49.11% 58608.42 50970 78734 58616.60 56317 60942 4592796 4592796 0.00
crit 81.21 50.89% 120898.39 104999 162191 120925.20 115824 125704 9817856 9817856 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>=88
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
frost_strike_offhand 16000 13.8% 159.6 2.79sec 45164 0 29308 60459 45164 50.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.57 159.57 0.00 0.00 0.0000 0.0000 7206961.45 7206961.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.35 49.10% 29308.22 25487 39368 29312.66 28215 30656 2296217 2296217 0.00
crit 81.22 50.90% 60458.99 52502 81099 60472.42 58038 63010 4910745 4910745 0.00
DPS Timeline Chart

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% off-hand weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 10.1 39.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 10.09 0.00 0.00 0.9338 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 22930 19.7% 131.8 3.39sec 78396 75635 73618 151708 78396 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.81 131.81 0.00 0.00 1.0365 0.0000 10333154.29 10333154.29 0.00 75634.83 75634.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.74 93.88% 73618.10 55964 121613 73638.40 69868 77865 9109674 9109674 0.00
crit 8.06 6.12% 151708.14 115286 250523 151647.82 0 235665 1223481 1223481 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 8066 6.9% 272.6 1.65sec 13322 8074 15213 31332 13322 11.2% 18.3% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 272.63 272.63 0.00 0.00 1.6500 0.0000 3631996.92 3631996.92 0.00 8073.80 8073.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.10 46.62% 15213.25 13152 20628 15216.94 14697 15812 1933639 1933639 0.00
crit 30.41 11.15% 31332.10 27093 42494 31338.38 29070 34021 952859 952859 0.00
glance 65.34 23.97% 11409.81 9864 15471 11412.45 10782 12031 745499 745499 0.00
miss 49.78 18.26% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 4031 3.5% 272.6 1.65sec 6659 4036 7606 15668 6659 11.2% 18.3% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 272.63 272.63 0.00 0.00 1.6500 0.0000 1815448.52 1815448.52 0.00 4035.71 4035.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.96 46.57% 7605.52 6576 10314 7607.41 7361 7896 965560 965560 0.00
crit 30.40 11.15% 15667.86 13547 21247 15671.09 14625 17293 476363 476363 0.00
glance 65.47 24.02% 5704.93 4932 7736 5706.16 5365 6042 373526 373526 0.00
miss 49.80 18.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4295 3.7% 31.4 13.91sec 61469 59304 46688 95547 61469 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.43 31.43 0.00 0.00 1.0365 0.0000 1932006.29 1932006.29 0.00 59304.02 59304.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.92 69.75% 46688.47 40067 61891 46724.42 42851 52278 1023542 1023542 0.00
crit 9.51 30.25% 95547.36 82538 127496 95576.43 84416 115985 908464 908464 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react&runic_power<10
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
obliterate_offhand 2146 1.8% 31.4 13.91sec 30704 0 23344 47782 30704 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.43 31.43 0.00 0.00 0.0000 0.0000 965046.28 965046.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.96 69.88% 23343.69 20035 30947 23361.72 21363 26267 512742 512742 0.00
crit 9.47 30.12% 47782.50 41271 63750 47792.35 0 61792 452304 452304 0.00
DPS Timeline Chart

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% off-hand weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
outbreak 0 0.0% 6.2 78.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.20 6.20 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.8 61.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.84 7.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 17.7 26.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.71 17.71 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 1254 1.1% 33.9 13.25sec 16652 16065 14895 30685 16652 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.95 33.95 0.00 0.00 1.0365 0.0000 565312.40 565312.40 0.00 16065.49 16065.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.17 88.88% 14895.23 12998 19899 14898.97 13995 15846 449435 449435 0.00
crit 3.78 11.12% 30684.58 26775 40991 29933.34 0 40991 115877 115877 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 627 0.5% 33.9 13.25sec 8322 0 7447 15344 8322 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.95 33.95 0.00 0.00 0.0000 0.0000 282530.97 282530.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.19 88.92% 7447.48 6499 9949 7449.45 7009 8040 224836 224836 0.00
crit 3.76 11.08% 15344.48 13388 20496 14965.14 0 19877 57695 57695 0.00
DPS Timeline Chart

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66216
  • name:Plague Strike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% off-hand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:233.06
  • base_dd_max:233.06
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.3 120.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
razorice 692 0.6% 469.8 0.96sec 663 0 663 0 663 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 469.81 469.81 0.00 0.00 0.0000 0.0000 311546.34 311546.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 469.81 100.00% 663.13 573 898 663.27 646 680 311546 311546 0.00
DPS Timeline Chart

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razor Frost
  • school:frost
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
soul_reaper 7064 6.1% 22.0 7.36sec 144592 139505 15274 31457 17074 11.1% 0.0% 0.0% 0.0% 21.3 117703 242628 131541 11.1% 0.0% 23.7%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.01 22.01 21.33 21.33 1.0365 5.0000 3182104.53 3182104.53 0.00 24575.65 139504.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.56 88.87% 15273.93 13152 20628 15277.14 14311 16287 298743 298743 0.00
crit 2.45 11.13% 31457.09 27093 42494 28788.39 0 42494 77020 77020 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.0 88.92% 117702.72 101663 160938 117727.11 109799 125499 2232938 2232938 0.00
crit 2.4 11.08% 242628.46 209426 331532 221536.02 0 331532 573404 573404 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 7953 / 4224
claw 2832 1.3% 80.5 5.87sec 8407 0 7567 15140 8407 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.50 80.50 0.00 0.00 0.0000 0.0000 676784.63 676784.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.57 88.91% 7567.37 5828 11694 7569.22 7083 8222 541590 541590 0.00
crit 8.93 11.09% 15139.87 11655 23387 15144.76 11655 20830 135194 135194 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 5120 2.3% 191.5 2.29sec 6393 5158 6081 12159 6393 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 191.51 191.51 0.00 0.00 1.2394 0.0000 1224206.00 1224206.00 0.00 5157.66 5157.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.26 64.89% 6080.51 4662 9355 6081.90 5603 6527 755567 755567 0.00
crit 21.32 11.13% 12159.43 9324 18710 12163.52 10220 14569 259261 259261 0.00
glance 45.92 23.98% 4559.23 3497 7016 4560.05 4019 5204 209378 209378 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 56792 / 4482
claw 20682 1.4% 120.0 2.58sec 6032 0 5428 10854 6032 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.00 120.00 0.00 0.00 0.0000 0.0000 723866.17 723866.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.63 88.86% 5427.90 3642 6989 5427.88 4890 5798 578801 578801 0.00
crit 13.36 11.14% 10854.25 7285 13978 10854.10 8273 13830 145065 145065 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 36110 2.4% 276.2 0.99sec 4576 4576 4355 8707 4576 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.16 276.16 0.00 0.00 1.0002 0.0000 1263843.43 1263843.43 0.00 4575.60 4575.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.11 64.86% 4355.25 2914 5591 4355.56 3888 4713 780052 780052 0.00
crit 30.66 11.10% 8706.80 5828 11182 8707.32 7161 10366 266920 266920 0.00
glance 66.40 24.04% 3266.15 2185 4193 3266.49 2766 3663 216872 216872 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.2 0.0 120.5sec 120.5sec 13.72% 13.72%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.7%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 23.03%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 7.5 0.0 63.5sec 63.5sec 32.67% 32.67%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.7%
killing_machine 78.4 18.3 5.7sec 4.6sec 23.88% 40.90%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:23.9%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 408.8sec 0.0sec 9.91% 9.91%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:9.9%
pillar_of_frost 7.8 0.0 61.4sec 61.4sec 34.08% 38.26%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:34.1%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
relic_of_xuen 9.9 0.0 47.6sec 47.6sec 32.35% 32.35%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.4%
rime 14.0 0.1 29.9sec 29.9sec 3.89% 3.89%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:3.9%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 10.9 27.8 41.6sec 11.3sec 72.59% 70.62%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:72.6%
synapse_springs_2 7.8 0.0 61.4sec 61.4sec 17.23% 17.23%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_presence

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_1h_T14H
frost_strike Runic Power 159.6 3191.4 20.0 20.0 4515.4
pet - ghoul
claw Energy 80.5 3220.0 40.0 40.0 210.2
pet - army_of_the_dead
claw Energy 120.0 4800.0 40.0 40.0 150.8
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 10.09 100.92 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 7.84 77.72 9.92 0.66 0.85%
rp_soul_reaper Runic Power 22.01 217.83 9.90 2.25 1.02%
rp_howling_blast Runic Power 117.80 1175.69 9.98 2.30 0.20%
rp_plague_strike Runic Power 33.95 333.72 9.83 5.77 1.70%
rp_empower_rune_weapon Runic Power 1.60 39.84 24.97 0.05 0.12%
rp_obliterate Runic Power 31.43 615.05 19.57 13.57 2.16%
rp_death_and_decay Runic Power 9.06 90.60 10.00 0.00 0.00%
frost_presence Runic Power 234.77 540.01 2.30 1.18 0.22%
rune_regen_all None 5640.29 157.92 0.03 7.30 4.42%
rune_regen_unholy None 1895.54 52.26 0.03 2.84 5.15%
rune_regen_blood None 1897.42 51.88 0.03 3.11 5.66%
rune_regen_frost None 1847.33 53.77 0.03 1.35 2.46%
runic_empowerment Rune 71.83 70.13 0.98 1.70 2.37%
runic_empowerment_blood Blood Rune 27.91 27.91 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 30.44 30.44 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 11.78 11.78 1.00 0.00 0.00%
empower_rune_weapon Rune 1.60 6.30 3.95 3.27 34.15%
plague_leech Rune 16.84 16.84 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 956.34 2920.88 3.05 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 528.01 3.80 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 7.15 7.08
Combat End Resource Mean Min Max
Health 459541.00 459541.00 459541.00
Runic Power 29.87 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.6%
bloodworms-Runic Power Cap 0.6%
gargoyle-Runic Power Cap 0.6%
army_of_the_dead-Runic Power Cap 0.6%
army_of_the_dead-Runic Power Cap 0.6%
army_of_the_dead-Runic Power Cap 0.6%
army_of_the_dead-Runic Power Cap 0.6%

Procs

Count Interval
hat_donor 215.7 3.3sec
runic_empowerment 70.1 6.3sec
runic_empowerment_wasted 1.7 103.7sec
oblit_killing_machine 6.7 56.2sec
frost_strike_killing_machine 71.4 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 116402.50
Minimum 106130.67
Maximum 127657.51
Spread ( max - min ) 21526.84
Range [ ( max - min ) / 2 * 100% ] 9.25%
Standard Deviation 2718.1202
5th Percentile 112028.46
95th Percentile 120990.43
( 95th Percentile - 5th Percentile ) 8961.97
Mean Distribution
Standard Deviation 27.1812
95.00% Confidence Intervall ( 116349.23 - 116455.77 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2094
0.1 Scale Factor Error with Delta=300 63069
0.05 Scale Factor Error with Delta=300 252278
0.01 Scale Factor Error with Delta=300 6306973
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 116402.50

Damage

Sample Data
Count 10000
Mean 48511811.29

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 448.62
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 4.20 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
9 1.00 auto_attack
A 7.84 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 7.84 pillar_of_frost
C 4.31 raise_dead
D 6.20 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 22.01 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 12.47 howling_blast,if=!dot.frost_fever.ticking
H 12.44 plague_strike,if=!dot.blood_plague.ticking
I 17.71 plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
J 12.00 howling_blast,if=buff.rime.react
K 14.96 frost_strike,if=runic_power>=88
L 0.28 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 53.16 frost_strike,if=buff.killing_machine.react
N 2.09 obliterate,if=buff.killing_machine.react&runic_power<10
O 29.34 obliterate,if=(unholy=2|frost=2|death=2)
P 107.33 howling_blast
Q 91.45 frost_strike
R 9.06 death_and_decay
S 21.51 plague_strike
T 0.00 blood_tap,if=talent.blood_tap.enabled
U 9.09 horn_of_winter
V 1.32 empower_rune_weapon

Sample Sequence

9ABCDIGHMOKOK7PPMQMPMOMPMOJPMPMPOOIGHKPKPMPMPPMOJPKPKPQQOPMIGHPABKQOQPQQPPQPOQMOPQPQQMOIDPPQQPQOQPPQRQUVOOKOJKPKQIGHMPQQQSPCQABPQPMSUPM7PMPMRIGHPPQQPQPQSPQSQPPQOPMQPPIDMOJOQPPQQPQPQRPQUQPSQABIGMHMNPQPMPMSSMPPQUMPRQIGHMOQPMPSQPQSUPMSQPQPSPIDCPPQMQPRQU7ABMSMPPMSIGHMPPMPQPPMPPQQRPMSMPPMOIEGHMPQEMPPQPQSQESQPPQRQUABIDEMPPQPEQOJQOEJMPQMEMOQPIEGHMOQEMPMOMEPPQQQCRMEPMIGHQ7UMEPMABQSSEMPQSME8SMIDNEJQQOLOEKOKPKEPKQPQQEMOIGHEMQPPQQEOJQQREQQSABMPSQUEIGHMQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21648 19252 18124
Agility 218 208 80
Stamina 22367 20334 20143
Intellect 121 115 80
Spirit 151 151 80
Health 459541 431079 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.79% 15.79% 2800
Spell Crit 9.13% 4.12% 2468
Spell Haste 15.72% 10.21% 4338
Mana Per 5 0 0 0
Attack Power 47901 38754 0
Melee Hit 8.24% 8.24% 2800
Melee Crit 14.14% 9.13% 2468
Melee Haste 10.21% 10.21% 4338
Swing Speed 45.47% 32.25% 4338
Expertise 7.55% / 7.55% 7.55% / 7.55% 2567
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.19% 5.56% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 46.44% 36.44% 6133

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_1h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
actions+=/howling_blast,if=buff.rime.react
actions+=/frost_strike,if=runic_power>=88
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react&runic_power<10
actions+=/obliterate,if=(unholy=2|frost=2|death=2)
actions+=/howling_blast
actions+=/frost_strike
actions+=/death_and_decay
actions+=/plague_strike
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_mastery
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160mastery_80str_160mastery_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160mastery_80str_160hit_160str_120haste
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit
feet=impaling_treads,id=86979,gems=160str,enchant=175haste,reforge=hit_exp
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str,reforge=haste_mastery
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=rune_of_razorice,reforge=hit_haste
off_hand=kilrak_jaws_of_terror,id=87173,enchant=rune_of_the_fallen_crusader,reforge=hit_haste

# Gear Summary
# gear_strength=18124
# gear_agility=80
# gear_stamina=20143
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2567
# gear_hit_rating=2800
# gear_crit_rating=2468
# gear_haste_rating=4338
# gear_mastery_rating=6133
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_razorice
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_2h_T14H : 115129 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
115128.9 115128.9 61.29 / 0.05% 5117 / 4.4% 14402.3 7.3 7.4 Runic Power 11.23% 54.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://2.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:170898|150328|78142|68241|27664|13455&chds=0,341796&chco=9482C9,C79C6E,0070DE,0070DE,C79C6E,C79C6E&chm=t++170898++soul_reaper,9482C9,0,0,15|t++150328++obliterate,C79C6E,1,0,15|t++78142++frost_strike,0070DE,2,0,15|t++68241++howling_blast,0070DE,3,0,15|t++27664++plague_strike,C79C6E,4,0,15|t++13455++melee_main_hand,C79C6E,5,0,15&chtt=Death_Knight_Frost_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:36,28,13,8,7,4,3,3,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,0070DE,C79C6E,9482C9,0070DE,0070DE,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|melee_main_hand|soul_reaper|howling_blast|frost_fever|blood_plague|army_of_the_dead: melee|ghoul: melee|army_of_the_dead: claw|ghoul: claw|plague_strike&chtt=Death_Knight_Frost_2h_T14H Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:012234555656777765432zyxwutrpommlkjihhhggffffdddcccbaaabbbbbbbcccccdddddeeeddcccbbaaZZZZYYYXXXXYXXXXXXXXXXXXXWWVVVWWWWXXYYZZZZaaabbcddddddcccbbbaaaaaZZZZZZZZYYYYYYYYYYYYYYXWWWWXXXXXXXYYYYYYYZZZaaaaaZZZZZYYYYYXXXXXXXXXXWWWWWWWWWWWWVVVUVVWWWXXYYZZZaabbbcdeeeeedddcccbbbbaaaaaZZZZZZZZZZZZZZZZZZZZYYYYYZZZZaaaaaabbbbbcdddccccbbbaaaaaZZZZZZZZZZZZZaaaaabbbbaaaaZaabbccddeeeffggghiijjjjjiiihhggffffeeeeddddddddddddddddddcbbbbbbbbcccccccdddddeeffeeeedddcccbbbaaaaaaZZZZZZZZZZZZZZZZZZYYYZZabbccddeeffghhijjkkjjjiihhggfeedddccbbbbaaaaaaaaaaaaaaZZYYYYYXXXXXXWWWWVVVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=115129|max=240013&chxp=1,1,48,100&chtt=Death_Knight_Frost_2h_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,3,2,1,2,3,6,24,24,41,59,90,130,168,249,300,393,418,493,543,599,614,611,628,618,604,505,503,472,391,328,295,217,184,152,87,93,50,37,17,11,7,12,6,5,1,2,1&chds=0,628&chbh=5&chxt=x&chxl=0:|min=102231|avg=115129|max=127520&chxp=0,1,51,100&chtt=Death_Knight_Frost_2h_T14H DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:38.0,25.0,11.2,5.2,3.4,1.8,1.7,1.5,1.0,11.2&chds=0,100&chdls=ffffff&chco=0070DE,C79C6E,0070DE,9482C9,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,ffffff&chl=frost_strike 171.2s|obliterate 112.6s|howling_blast 50.6s|soul_reaper 23.3s|horn_of_winter 15.4s|outbreak 8.2s|plague_strike 7.8s|plague_leech 6.9s|raise_dead 4.5s|waiting 50.6s&chtt=Death_Knight_Frost_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T14H 115129
blood_fury 0 0.0% 4.2 120.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.20 4.20 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 3301 2.9% 15.5 30.02sec 96200 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.9 9712 19414 10630 9.5% 0.0% 93.1%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.46 15.46 139.89 139.89 0.0000 3.0000 1487103.56 1487103.56 0.00 3543.41 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 90.54% 9712.23 7106 15358 9717.81 8286 10662 1230123 1230123 0.00
crit 13.2 9.46% 19414.07 14212 30715 19423.50 15245 24543 256980 256980 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 308.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.91 1.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4614 4.0% 56.7 7.92sec 36677 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.8 13296 26597 14553 9.4% 0.0% 95.1%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.67 56.67 142.82 142.82 0.0000 3.0000 2078426.77 2078426.77 0.00 4851.01 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 129.3 90.55% 13296.29 9661 20928 13301.76 12017 14501 1719517 1719517 0.00
crit 13.5 9.45% 26596.97 19322 41856 26606.32 21437 33142 358910 358910 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 29702 25.8% 165.2 2.71sec 80994 78142 60541 124725 80994 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.15 165.15 0.00 0.00 1.0365 0.0000 13376457.18 13376457.18 0.00 78141.73 78141.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.52 68.13% 60540.62 53152 77400 60551.80 58929 62246 6812303 6812303 0.00
crit 52.63 31.87% 124724.81 109492 159443 124745.19 118817 130721 6564155 6564155 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 15.9 27.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.90 15.90 0.00 0.00 0.9712 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 7662 6.7% 48.8 9.09sec 70731 68241 64279 132456 70731 9.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.77 48.77 0.00 0.00 1.0365 0.0000 3449764.31 3449764.31 0.00 68240.55 68240.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.16 90.54% 64279.37 47333 102933 64303.46 58437 70628 2838455 2838455 0.00
crit 4.62 9.46% 132455.70 97507 212041 131221.48 0 212041 611310 611310 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 13460 11.7% 205.4 2.19sec 29510 13455 26997 55617 29510 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 205.40 205.40 0.00 0.00 2.1932 0.0000 6061395.67 6061395.67 0.00 13455.39 13455.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.40 61.54% 26996.81 23655 35032 27002.24 26301 27753 3412340 3412340 0.00
crit 29.68 14.45% 55616.63 48729 72166 55625.41 52624 59608 1650512 1650512 0.00
glance 49.33 24.02% 20243.14 17741 26274 20247.86 19399 21266 998544 998544 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 37577 32.7% 108.6 4.14sec 155815 150328 114418 235123 155815 34.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.59 108.59 0.00 0.00 1.0365 0.0000 16920665.80 16920665.80 0.00 150328.42 150328.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.35 65.70% 114417.75 100376 146169 114439.62 110847 118380 8163787 8163787 0.00
crit 37.24 34.30% 235123.14 206775 301107 235160.69 223962 248150 8756879 8756879 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power<=76
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.22
outbreak 0 0.0% 7.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.90 7.90 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 7.9 60.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.89 7.89 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 6.7 61.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.70 6.70 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 481 0.4% 7.6 59.09sec 28672 27664 24903 51268 28672 14.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.56 7.56 0.00 0.00 1.0364 0.0000 216857.69 216857.69 0.00 27663.95 27663.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.48 85.70% 24903.15 23221 32741 24900.24 23743 28614 161427 161427 0.00
crit 1.08 14.30% 51267.57 47836 63466 34968.06 0 63466 55431 55431 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.3 120.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
soul_reaper 8844 7.7% 22.5 7.23sec 177125 170898 27135 55849 31291 14.5% 0.0% 0.0% 0.0% 21.8 131124 270022 150339 14.4% 0.6% 24.2%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.48 22.48 21.80 21.80 1.0364 5.0000 3981065.84 3981065.84 0.00 30089.38 170897.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.22 85.53% 27134.59 23655 35032 27145.91 25576 28683 521608 521608 0.00
crit 3.25 14.47% 55849.23 48729 72166 54177.91 0 72166 181678 181678 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.5 84.92% 131124.34 111708 176856 131172.24 122994 139882 2427833 2427833 0.00
crit 3.1 14.44% 270021.73 230119 364322 260087.16 0 364322 849947 849947 0.00
dodge 0.1 0.64% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 8669 / 4602
claw 3092 1.4% 84.4 5.59sec 8755 0 7649 15311 8755 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.36 84.36 0.00 0.00 0.0000 0.0000 738586.51 738586.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.18 85.56% 7648.77 5817 11678 7650.55 7148 8187 552108 552108 0.00
crit 12.18 14.44% 15310.95 11634 23356 15314.09 12478 19336 186478 186478 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 5577 2.6% 199.8 2.20sec 6673 5618 6152 12302 6673 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 199.75 199.75 0.00 0.00 1.1879 0.0000 1333013.05 1333013.05 0.00 5617.94 5617.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.03 61.59% 6151.83 4653 9342 6152.90 5757 6529 756852 756852 0.00
crit 28.87 14.45% 12301.87 9307 18684 12303.55 10878 14470 355203 355203 0.00
glance 47.85 23.96% 4617.61 3490 7007 4618.70 4141 5208 220958 220958 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 61889 / 4884
claw 22727 1.5% 127.8 2.49sec 6223 0 5437 10861 6223 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.83 127.83 0.00 0.00 0.0000 0.0000 795443.55 795443.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.32 85.52% 5437.02 3636 6979 5436.87 4899 5704 594353 594353 0.00
crit 18.51 14.48% 10861.29 7271 13958 10863.17 8835 12992 201090 201090 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 39162 2.6% 287.6 0.95sec 4765 4953 4395 8787 4765 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 287.64 287.64 0.00 0.00 0.9621 0.0000 1370669.05 1370669.05 0.00 4953.00 4953.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.05 61.55% 4395.06 2908 5583 4394.90 3854 4678 778156 778156 0.00
crit 41.52 14.43% 8786.80 5817 11167 8786.19 7388 10094 364833 364833 0.00
glance 69.07 24.01% 3296.36 2181 4187 3296.26 2884 3645 227679 227679 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.2 0.0 120.5sec 120.5sec 13.71% 13.71%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.7%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 24.08%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 7.3 0.0 65.7sec 65.7sec 31.56% 31.56%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.6%
killing_machine 59.0 2.6 7.5sec 7.2sec 14.75% 21.49%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:14.7%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 407.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
pillar_of_frost 7.9 0.0 61.0sec 60.9sec 34.28% 41.26%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:34.3%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
relic_of_xuen 9.5 0.0 49.2sec 49.2sec 31.28% 31.28%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.3%
rime 48.5 0.5 9.2sec 9.2sec 14.51% 14.51%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:14.5%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 8.2 52.9 55.4sec 7.3sec 86.87% 83.24%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:86.9%
synapse_springs_2 7.9 0.0 61.0sec 60.9sec 17.33% 17.33%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_presence

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_2h_T14H
frost_strike Runic Power 165.2 3303.1 20.0 20.0 4049.7
pet - ghoul
claw Energy 84.4 3374.5 40.0 40.0 218.9
pet - army_of_the_dead
claw Energy 127.8 5113.2 40.0 40.0 155.6
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 15.90 159.00 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 7.89 77.78 9.86 1.09 1.38%
rp_soul_reaper Runic Power 22.48 222.60 9.90 2.16 0.96%
rp_howling_blast Runic Power 0.43 4.33 9.99 0.01 0.14%
rp_plague_strike Runic Power 7.56 74.72 9.88 0.92 1.21%
rp_obliterate Runic Power 108.59 2160.33 19.89 11.56 0.53%
rp_empower_rune_weapon Runic Power 1.91 47.55 24.88 0.23 0.49%
frost_presence Runic Power 165.77 557.63 3.36 0.83 0.15%
rune_regen_all None 5608.87 166.45 0.03 6.18 3.58%
rune_regen_unholy None 1867.99 55.64 0.03 1.93 3.36%
rune_regen_blood None 1886.80 54.75 0.03 2.72 4.74%
rune_regen_frost None 1854.08 56.06 0.03 1.52 2.65%
runic_empowerment Rune 74.44 73.98 0.99 0.46 0.62%
runic_empowerment_blood Blood Rune 22.47 22.47 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 26.88 26.88 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 24.63 24.63 1.00 0.00 0.00%
empower_rune_weapon Rune 1.91 6.27 3.28 5.20 45.34%
plague_leech Rune 6.27 6.27 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 956.08 3048.15 3.19 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 7.40 7.33
Combat End Resource Mean Min Max
Health 464119.00 464119.00 464119.00
Runic Power 31.04 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.4%
bloodworms-Runic Power Cap 0.4%
gargoyle-Runic Power Cap 0.4%
army_of_the_dead-Runic Power Cap 0.4%
army_of_the_dead-Runic Power Cap 0.4%
army_of_the_dead-Runic Power Cap 0.4%
army_of_the_dead-Runic Power Cap 0.4%

Procs

Count Interval
hat_donor 124.1 3.6sec
runic_empowerment 74.0 6.0sec
runic_empowerment_wasted 0.5 112.9sec
oblit_killing_machine 25.2 17.2sec
frost_strike_killing_machine 33.6 13.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 115128.92
Minimum 102231.44
Maximum 127520.45
Spread ( max - min ) 25289.02
Range [ ( max - min ) / 2 * 100% ] 10.98%
Standard Deviation 3127.0338
5th Percentile 110148.06
95th Percentile 120382.18
( 95th Percentile - 5th Percentile ) 10234.12
Mean Distribution
Standard Deviation 31.2703
95.00% Confidence Intervall ( 115067.63 - 115190.21 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2833
0.1 Scale Factor Error with Delta=300 83473
0.05 Scale Factor Error with Delta=300 333894
0.01 Scale Factor Error with Delta=300 8347353
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 115128.92

Damage

Sample Data
Count 10000
Mean 47571736.82

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 410.26
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 4.20 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
9 1.00 auto_attack
A 7.89 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 7.89 pillar_of_frost
C 4.31 raise_dead
D 7.90 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 22.48 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 1.82 howling_blast,if=!dot.frost_fever.ticking
H 7.56 plague_strike,if=!dot.blood_plague.ticking
I 6.70 plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
J 46.95 howling_blast,if=buff.rime.react
K 107.54 obliterate,if=runic_power<=76
L 0.17 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 144.80 frost_strike,if=!buff.killing_machine.react
N 1.05 obliterate,if=buff.killing_machine.react
O 0.00 blood_tap,if=talent.blood_tap.enabled
P 20.36 frost_strike
Q 14.90 horn_of_winter
R 1.74 empower_rune_weapon

Sample Sequence

9ABCDKJNMMMMK7KJMKMMKJKMMKMKJMMKJKHPMMKJPKJPKJMKMMMKJKMMQMKMKJMABHIDMRKKJMKMMMMKMPKJMKMKMQKJMMKIGHKMMJKMMKMKMJMKMJQKJMMKCJABIDKMMMK7MKMQMKMKMKMKMGHPMQKJMKJMMKMKPQMJKIABGDKJMKJKJMPKMKMKMMMKJKJMMKJPMKHMKJMMQKMJMKMKMKJMMKJMKCMABIDMKKJPM7QMKMKPJKJPKJPKMMHKMQPKJMKMKJMEMKJMQMEMKIABDPEKJMMKMEMKMQMEKJMMKMEKPMJEHMKMQPEKMEMKMJEPKJCMQIABDEKJMM7KJEMMMKJPREKKMMMEMKMKJEPMMQMEHKMMEMKJKMMEPKJ8MEMKJIABDEPMKJMEMKJMQMEKME

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21600 19206 18080
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 12.44% 7.44% 4458
Spell Haste 21.27% 15.49% 6585
Mana Per 5 0 0 0
Attack Power 47795 38662 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 17.45% 12.45% 4458
Melee Haste 15.49% 15.49% 6585
Swing Speed 52.45% 38.59% 6585
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.18% 5.55% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 36.54% 26.54% 3163

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_2h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
actions+=/howling_blast,if=buff.rime.react
actions+=/obliterate,if=runic_power<=76
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=!buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/frost_strike
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160haste_80str_160haste_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160haste_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=80str_160haste_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader,reforge=mastery_haste

# Gear Summary
# gear_strength=18080
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=4458
# gear_haste_rating=6585
# gear_mastery_rating=3163
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_T14H : 113898 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
113898.4 113898.4 52.90 / 0.05% 4411 / 3.9% 13727.6 6.3 6.4 Runic Power 12.08% 59.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

Charts

http://6.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:229020|71610|59256|56582|13071&chds=0,458040&chco=9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++229020++soul_reaper,9482C9,0,0,15|t++71610++scourge_strike,C79C6E,1,0,15|t++59256++death_coil,9482C9,2,0,15|t++56582++festering_strike,C79C6E,3,0,15|t++13071++melee_main_hand,C79C6E,4,0,15&chtt=Death_Knight_Unholy_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,19,15,14,11,10,7,6,5,5,4,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,0070DE,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E&chl=scourge_strike|death_coil|melee_main_hand|soul_reaper|ghoul: melee|blood_plague|frost_fever|ghoul: sweeping_claws|festering_strike|gargoyle: gargoyle_strike|army_of_the_dead: melee|army_of_the_dead: claw|ghoul: claw&chtt=Death_Knight_Unholy_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vwy002223224457786654320zyvusqponmkjiggeecbZZXXWXWVVUUUUUUUTUUUUUUVVVVWWXXWWWWWWWWWVVVVVVVVUUUUUUUTTTTTTTSSSSSRRRRRSSSSTTTTTUUUUUUUVWVWVVVVVUUUUUUUUUUUUUTTTTTTTTTTTTSTSSSRRQQQQRRRSSTTUUVVWWXYZaabbccccdcddcccbbbaaaaZZYYXXWWWVVUUUUUTTSSSTTTTTTUUUUUUUUUUVVWWWWVWVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVVUUUUUVVVVVWWWWWXXXXXYYZZZZZZZYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYYXXXXXXYZZaabccdeeefghiijjjkjjjjjjiihhgggfffeeeddcccbbaaaaaaZZYYYYYZZZZZZZZZZaZZZaaaabaaaZZZZZZZYZZZZZZYYZYZZZZYZYZZZZZZYYYYYYYYZZZaaaaabbbbbbccccccccbbbbbaaaaaaaaaaaaaaaZZZZZZZZYYYXXWWWWWWWXXWWWWWVWWVWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=113898|max=266300&chxp=1,1,43,100&chtt=Death_Knight_Unholy_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,5,6,11,20,29,40,50,80,105,127,156,204,213,278,362,359,366,413,424,485,503,460,485,499,485,451,402,424,359,360,346,286,253,220,163,144,101,79,76,53,33,28,16,11,7,11,4,4&chds=0,503&chbh=5&chxt=x&chxl=0:|min=105283|avg=113898|max=122718&chxp=0,1,49,100&chtt=Death_Knight_Unholy_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:37.1,27.6,8.2,5.2,3.6,2.1,1.8,1.6,0.7,12.1&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=scourge_strike 167.3s|death_coil 124.5s|festering_strike 37.2s|soul_reaper 23.4s|horn_of_winter 16.3s|dark_transformation 9.4s|outbreak 8.2s|plague_leech 7.2s|summon_gargoyle 3.1s|waiting 54.4s&chtt=Death_Knight_Unholy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Unholy_T14H 113898
blood_fury 0 0.0% 4.3 120.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=2
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 8455 7.4% 7.9 60.58sec 479950 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.7 23656 47297 26698 12.9% 0.0% 95.0%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 142.66 142.66 0.0000 3.0000 3808687.61 3808687.61 0.00 8899.49 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.3 87.13% 23655.84 19324 33635 23662.54 22383 25007 2940336 2940336 0.00
crit 18.4 12.87% 47297.37 38647 67270 47313.05 42039 54076 868351 868351 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 47.4 9.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.44 47.44 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 47.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.blood_tap.enabled
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:(null)
  • description:Each damaging Death Coil, Frost Strike, or Rune Strike generates 2 Blood Charges, up to a maximum of $114851u charges. Blood Tap consumes $114851s1 Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 9.1 49.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.09 9.09 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 16377 14.4% 120.1 3.72sec 61420 59256 54012 111295 61420 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.09 120.09 0.00 0.00 1.0365 0.0000 7375599.68 7375599.68 0.00 59256.04 59256.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.56 87.07% 54012.43 44204 76353 54028.00 51697 56170 5647361 5647361 0.00
crit 15.53 12.93% 111295.34 91061 157286 111325.13 95413 127940 1728239 1728239 0.00
DPS Timeline Chart

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>90
Spelldata
  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $<damage> Shadow damage to an enemy target or healing $<healing> damage on a friendly Undead target$?s58677[. Refunds $58677s1 Runic Power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.496000
  • base_dd_min:1132.89
  • base_dd_max:1132.89
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.9 308.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 4674 4.1% 35.9 12.61sec 58646 56582 49249 101463 58646 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.86 35.86 0.00 0.00 1.0365 0.0000 2103082.22 2103082.22 0.00 56581.62 56581.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.41 82.00% 49249.02 44846 58807 49257.53 47547 50829 1448281 1448281 0.00
crit 6.45 18.00% 101462.99 92383 121143 101266.98 0 121143 654802 654802 0.00
DPS Timeline Chart

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:blood=2&frost=2&runic_power<90
Spelldata
  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.65
  • base_dd_max:539.65
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
frost_fever 5726 5.0% 7.9 60.58sec 325042 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.7 16018 32040 18082 12.9% 0.0% 95.0%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 142.65 142.65 0.0000 3.0000 2579403.80 2579403.80 0.00 6027.24 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.3 87.12% 16018.11 13077 22797 16022.51 14974 16888 1990722 1990722 0.00
crit 18.4 12.88% 32040.06 26153 45594 32048.17 28276 36661 588682 588682 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
horn_of_winter 0 0.0% 16.7 25.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.75 16.75 0.00 0.00 0.9746 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 16.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 13070 11.5% 206.4 2.18sec 28507 13071 25230 51983 28507 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 206.39 206.39 0.00 0.00 2.1810 0.0000 5883497.80 5883497.80 0.00 13070.61 13070.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.82 58.05% 25230.15 22880 30495 25235.26 24629 25815 3022973 3022973 0.00
crit 36.98 17.92% 51982.83 47132 62819 51993.57 50109 54296 1922335 1922335 0.00
glance 49.59 24.03% 18918.01 17160 22871 18922.07 18308 19655 938190 938190 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 7.9 60.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.94 7.94 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_leech 0 0.0% 7.0 60.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
scourge_strike 26612 23.4% 161.4 2.78sec 74223 71610 33633 72488 37112 9.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.44 322.88 0.00 0.00 1.0365 0.0000 11982531.32 11982531.32 0.00 71610.18 71610.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 293.97 91.05% 33632.70 24822 67027 33646.36 32129 36056 9886925 9886925 0.00
crit 28.91 8.95% 72488.25 66154 86717 72496.58 69649 75942 2095606 2095606 0.00
DPS Timeline Chart

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:unholy=2&runic_power<90
Spelldata
  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:588.25
  • base_dd_max:588.25
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
soul_reaper 11906 10.5% 22.6 7.18sec 237377 229020 25248 52010 30046 17.9% 0.0% 0.0% 0.0% 21.9 181089 373222 213862 17.7% 0.6% 24.3%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.58 22.58 21.89 21.89 1.0365 5.0000 5358841.99 5358841.99 0.00 40343.92 229020.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.53 82.07% 25248.21 22880 30495 25252.07 24189 26251 467809 467809 0.00
crit 4.05 17.93% 52010.37 47132 62819 51376.25 0 62819 210476 210476 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.9 81.68% 181088.83 161106 225304 181120.75 171710 190325 3237307 3237307 0.00
crit 3.9 17.67% 373222.29 331878 464126 366760.72 0 464126 1443251 1443251 0.00
dodge 0.1 0.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130736
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130736
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
summon_gargoyle 0 0.0% 3.0 181.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.96 2.96 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
unholy_frenzy 0 0.0% 3.0 180.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unholy_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unholy_frenzy

Static Values
  • id:49016
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Unholy_T14H
  • harmful:false
  • if_expr:time>=4
Spelldata
  • id:49016
  • name:Unholy Frenzy
  • school:physical
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - gargoyle 21437 / 4110
gargoyle_strike 21437 3.6% 34.4 11.11sec 53429 24716 45323 90674 53429 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.39 34.39 0.00 0.00 2.1618 0.0000 1837652.67 1837652.67 0.00 24715.58 24715.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.25 82.13% 45322.93 34953 60918 45355.97 40391 49707 1280200 1280200 0.00
crit 6.15 17.87% 90673.60 69907 121836 90582.51 0 121836 557452 557452 0.00
DPS Timeline Chart

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:51963
  • name:Gargoyle Strike
  • school:nature
  • tooltip:(null)
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.826000
  • base_dd_min:623.15
  • base_dd_max:623.15
pet - ghoul 16555 / 16555
claw 1927 1.7% 72.7 6.28sec 11918 0 10103 20211 11918 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.67 72.67 0.00 0.00 0.0000 0.0000 866111.78 866111.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.62 82.05% 10103.33 6596 20555 10107.87 9217 11120 602399 602399 0.00
crit 13.05 17.95% 20210.65 13192 32734 20218.82 15489 25472 263713 263713 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 9824 8.6% 371.7 1.21sec 11897 9829 10635 21265 11897 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 371.74 371.74 0.00 0.00 1.2105 0.0000 4422704.50 4422704.50 0.00 9828.87 9828.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 215.96 58.09% 10635.16 5277 17458 10636.33 9845 11513 2296760 2296760 0.00
crit 66.49 17.89% 21264.62 10554 34916 21267.97 18920 24099 1413902 1413902 0.00
glance 89.29 24.02% 7974.69 3958 13094 7975.64 7143 8856 712043 712043 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
sweeping_claws 4803 4.2% 98.5 4.33sec 21968 21194 18629 37255 21968 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.48 98.48 0.00 0.00 1.0365 0.0000 2163474.77 2163474.77 0.00 21194.12 21194.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.83 82.07% 18628.74 15831 26187 18625.88 17570 19870 1505766 1505766 0.00
crit 17.65 17.93% 37255.06 31662 52374 37252.16 33703 41759 657708 657708 0.00
DPS Timeline Chart

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91778
  • name:Sweeping Claws
  • school:physical
  • tooltip:(null)
  • description:Rakes an enemy with deformed claws, dealing $91778s1% of normal damage to the target and up to ${$91778x1-1} additional targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
pet - army_of_the_dead 81273 / 6413
claw 32343 2.2% 175.8 1.71sec 6439 0 5462 10926 6439 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.81 175.81 0.00 0.00 0.0000 0.0000 1132004.42 1132004.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.39 82.13% 5462.42 4123 6820 5462.38 4860 5725 788704 788704 0.00
crit 31.42 17.87% 10926.22 8245 13639 10925.48 9465 12231 343301 343301 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 48930 3.3% 345.9 0.78sec 4951 6208 4425 8853 4951 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 345.90 345.90 0.00 0.00 0.7975 0.0000 1712561.38 1712561.38 0.00 6208.33 6208.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 201.03 58.12% 4425.31 3298 5456 4425.41 3910 4674 889628 889628 0.00
crit 61.80 17.87% 8852.61 6596 10911 8852.44 7574 9713 547132 547132 0.00
glance 83.06 24.01% 3320.47 2474 4092 3320.50 2892 3589 275801 275801 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_charge 22.3 97.7 20.3sec 3.7sec 85.31% 85.31%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • blood_charge_1:14.3%
  • blood_charge_2:18.2%
  • blood_charge_3:18.1%
  • blood_charge_4:19.7%
  • blood_charge_5:6.7%
  • blood_charge_6:6.7%
  • blood_charge_7:0.7%
  • blood_charge_8:0.6%
  • blood_charge_9:0.1%
  • blood_charge_10:0.1%
  • blood_charge_11:0.1%
  • blood_charge_12:0.1%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:$@spelldesc45529
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:1.01%
blood_fury 4.3 0.0 120.6sec 120.6sec 14.04% 14.04%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 22.77%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_transformation 9.1 0.0 49.9sec 49.9sec 58.52% 58.08%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_transformation_1:58.5%

Spelldata details

  • id:63560
  • name:Dark Transformation
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
darkmist_vortex 7.1 0.0 67.0sec 67.0sec 31.04% 31.04%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.0%
mogu_power_potion 2.0 0.0 423.2sec 0.0sec 9.56% 9.56%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:9.6%
relic_of_xuen 9.4 0.0 50.1sec 50.1sec 30.83% 30.83%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:30.8%
rune_of_the_fallen_crusader 9.6 41.6 47.5sec 8.7sec 82.14% 81.01%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:82.1%
shadow_infusion 9.5 39.3 49.5sec 9.1sec 35.87% 36.34%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_shadow_infusion
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_infusion_1:7.8%
  • shadow_infusion_2:8.0%
  • shadow_infusion_3:8.2%
  • shadow_infusion_4:7.8%
  • shadow_infusion_5:4.1%

Spelldata details

  • id:91342
  • name:Shadow Infusion
  • tooltip:$?$w3>0[Pet damage dealt increased by $s1%.][Damage dealt increased by $s1%.]
  • description:Grants your successful Death Coils a chance to empower your active Ghoul, increasing its damage dealt by $91342s1% for $91342d. Stacks up to 5 times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
sudden_doom 36.7 0.5 12.0sec 12.0sec 7.20% 7.20%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • sudden_doom_1:7.2%

Spelldata details

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil consumes no Runic Power.
  • description:Your autoattacks have a chance to cause your next Death Coil to consume no Runic Power.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 7.9 0.0 60.5sec 60.5sec 17.30% 17.30%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
unholy_frenzy 3.0 0.0 180.6sec 180.6sec 19.21% 100.00%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_frenzy
  • max_stacks:1
  • duration:30.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unholy_frenzy_1:19.2%

Spelldata details

  • id:49016
  • name:Unholy Frenzy
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
unholy_presence

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • unholy_presence_1:100.0%

Spelldata details

  • id:48265
  • name:Unholy Presence
  • tooltip:Attack speed and rune regeneration increased by $w1%. Movement speed increased by $s2%.
  • description:You are infused with unholy fury, increasing attack speed and rune regeneration by $s1%, and movement speed by $s2%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Unholy_T14H
death_coil Runic Power 120.1 2670.3 22.2 22.2 2762.1
summon_gargoyle Runic Power 3.0 177.4 60.0 60.0 0.0
pet - ghoul
claw Energy 72.7 2906.9 40.0 40.0 298.0
sweeping_claws Energy 98.5 3939.4 40.0 40.0 549.2
pet - army_of_the_dead
claw Energy 175.8 7032.3 40.0 40.0 161.0
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 16.75 167.47 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_soul_reaper Runic Power 22.58 224.02 9.92 1.73 0.77%
rp_dark_transformation Runic Power 9.09 89.70 9.86 1.24 1.36%
rp_empower_rune_weapon Runic Power 1.95 48.63 24.96 0.07 0.15%
rp_scourge_strike Runic Power 161.44 1614.39 10.00 0.00 0.00%
rp_festering_strike Runic Power 35.86 708.45 19.76 8.77 1.22%
rune_regen_all None 5631.27 199.14 0.04 9.56 4.58%
rune_regen_unholy None 1842.71 68.16 0.04 1.49 2.14%
rune_regen_blood None 1923.34 63.98 0.03 5.47 7.88%
rune_regen_frost None 1865.21 67.00 0.04 2.59 3.72%
empower_rune_weapon Rune 1.95 7.10 3.64 4.59 39.26%
blood_tap Rune 47.43 47.43 1.00 0.00 0.00%
blood_tap_blood Rune 10.22 10.22 1.00 0.00 0.00%
blood_tap_frost Rune 11.59 11.59 1.00 0.00 0.00%
blood_tap_unholy Rune 25.62 25.62 1.00 0.00 0.00%
plague_leech Rune 6.79 6.79 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 1801.91 6767.28 3.76 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.39 5.72 0.00 0.00%
Resource RPS-Gain RPS-Loss
Runic Power 6.40 6.32
Combat End Resource Mean Min Max
Health 464119.00 464119.00 464119.00
Runic Power 35.06 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 0.2%
bloodworms-Runic Power Cap 0.2%
gargoyle-Runic Power Cap 0.2%
army_of_the_dead-Runic Power Cap 0.2%
army_of_the_dead-Runic Power Cap 0.2%
army_of_the_dead-Runic Power Cap 0.2%
army_of_the_dead-Runic Power Cap 0.2%

Procs

Count Interval
hat_donor 73.6 6.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 113898.36
Minimum 105283.46
Maximum 122718.49
Spread ( max - min ) 17435.03
Range [ ( max - min ) / 2 * 100% ] 7.65%
Standard Deviation 2699.0536
5th Percentile 109526.67
95th Percentile 118348.59
( 95th Percentile - 5th Percentile ) 8821.92
Mean Distribution
Standard Deviation 26.9905
95.00% Confidence Intervall ( 113845.46 - 113951.26 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2157
0.1 Scale Factor Error with Delta=300 62188
0.05 Scale Factor Error with Delta=300 248752
0.01 Scale Factor Error with Delta=300 6218801
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 113898.36

Damage

Sample Data
Count 10000
Mean 39091644.41

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 449.16
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=unholy
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 raise_dead
7 0.00 mogu_power_potion
Default action list
# count action,conditions
8 4.29 blood_fury,if=time>=2
9 1.00 mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
A 1.00 auto_attack
B 2.97 unholy_frenzy,if=time>=4
C 7.87 use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
D 7.94 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 22.58 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 0.00 icy_touch,if=!dot.frost_fever.ticking
H 0.00 plague_strike,if=!dot.blood_plague.ticking
I 6.95 plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
J 2.96 summon_gargoyle
K 9.09 dark_transformation
L 0.10 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 2.48 scourge_strike,if=unholy=2&runic_power<90
N 4.09 festering_strike,if=blood=2&frost=2&runic_power<90
O 13.88 death_coil,if=runic_power>90
P 23.48 death_coil,if=buff.sudden_doom.react
Q 47.44 blood_tap,if=talent.blood_tap.enabled
R 158.96 scourge_strike
S 31.77 festering_strike
T 82.73 death_coil,if=cooldown.summon_gargoyle.remains>8
U 15.75 horn_of_winter
V 1.85 empower_rune_weapon

Sample Sequence

ADR8SJBCRSTVMNRPRPQRORNOKQRRRORRPROPQRPRNORQRRORRPPQRONROQRRTTQRRRRTUTIDMRQRCSTSPKTQRRTRRUTQRRRRTTSTRQRSPRTQRRTRURTRTQRRRTTQKTSRID8RPTCQRRSTRPQRRRTTRUTQRRRTSPRQRTSRTRURTQRRRTTKQRRTSRPUIDRRBJCSRTQRRRRPRTQRRPTSRPQRTSTKQRRTRRRUTRRTQRTSRTQRTTSRTQRRTTQRRRUID8RRRCRTTSTRQRSTRUTKQRRRTRRRTTQRSTRUTQRRSETTRRETQRRIDERTCUVMNEOQRSTTEKPQRRTTEQRRRTUESTTQRESTTEQRRRTTERRUPQRESID8RBEJCSTPQKEPRRTRERTQRPPEQRSTRSTTQEURPPQRERTRRRTTQERSTUEPQK9STTERIDPQRECRPRRRTQERTTPQRPSTEPQRSTTQE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25042 22280 18240
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 15.89% 10.88% 6524
Spell Haste 14.46% 9.01% 3831
Mana Per 5 0 0 0
Attack Power 55367 44810 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 20.90% 15.89% 6524
Melee Haste 30.82% 9.01% 3831
Swing Speed 43.90% 9.01% 3831
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 7.07% 6.36% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.23% 34.73% 3531

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Unholy_T14H"
origin="unknown"
level=90
race=orc
spec=unholy
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=unholy
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=2
actions+=/mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
actions+=/auto_attack
actions+=/unholy_frenzy,if=time>=4
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/icy_touch,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
actions+=/summon_gargoyle
actions+=/dark_transformation
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/scourge_strike,if=unholy=2&runic_power<90
actions+=/festering_strike,if=blood=2&frost=2&runic_power<90
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil,if=cooldown.summon_gargoyle.remains>8
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=haste_crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160crit_80str_160crit_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160crit_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit,reforge=mastery_crit
feet=impaling_treads,id=86979,gems=80str_160crit_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_strength=18240
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=6524
# gear_haste_rating=3831
# gear_mastery_rating=3531
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T14H : 102664 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
102663.6 102663.6 54.22 / 0.05% 4535 / 4.4% 23.4 4386.5 4326.7 Mana 0.00% 43.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
Glyphs
  • moonbeast

Charts

http://6.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:317361|148979|76517|47781&chds=0,634721&chco=69CCF0,8AD0B1,69CCF0,ABD473&chm=t++317361++starfall,69CCF0,0,0,15|t++148979++starsurge,8AD0B1,1,0,15|t++76517++starfire,69CCF0,2,0,15|t++47781++wrath,ABD473,3,0,15&chtt=Druid_Balance_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,18,14,13,13,12,0&chds=0,100&chdls=ffffff&chco=69CCF0,8AD0B1,ABD473,69CCF0,ABD473,69CCF0,ABD473&chl=starfire|starsurge|wrath|moonfire|sunfire|starfall|wild_mushroom_detonate&chtt=Druid_Balance_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:mmpqrtuvwxxz134568310yxuspnljhedcbaYWVUTTTTTTUUUUUUUTTTTSSSSSSRRRRRQQQQQQRRSSTTTUUUUTTTTTSSSSRRRQQPPPOOOOOPPQQRRSSTTTTTTTTTTTTTSSSRRRQQQPPPPQQRRSSSTTTTTTTTTSSSSSSRRRRQQQPPPPPPQRSTUVWXYYZabcefhiklmnnnnnmmlkjjihgedcaZYXWVUTSSRRRSSSTTTTTTTSSSSSSRRRRQQQPPPPPOOPPPQRRSTTUUVVVVVVUUUUUUTTSSRRQPPPPPPPPQQQRRRRSSSSSSSRRRRRRRRRQQQQQQQQRRRSTTTUUUUUUUUTTTTTSSRRRQQPPPOOPPPQRSUVWXYZabcdefhijkkllllkjiihgfedcbZYXWVUTSRRQQQQQQQRRSSSSSSSSSSSSSSSRRRRQQQQPPPPPPQQRRSSSTTTTTTTTTTTSSSSRRRQQQQPPPQQQQRRRSSSSSSSSSSSSSRRRRQQQPPPPPPPPPQQRRRSSTTTTTTTTTTTTSSSRRRQQQPPPPPPPPPPPPPPPP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=102664|max=279824&chxp=1,1,37,100&chtt=Druid_Balance_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,4,8,12,20,28,43,80,115,154,204,240,339,328,413,436,518,503,545,555,529,532,543,481,433,422,385,360,338,262,244,210,152,128,111,72,71,58,38,24,20,16,8,5,4,1,1,3,1&chds=0,555&chbh=5&chxt=x&chxl=0:|min=94014|avg=102664|max=113481&chxp=0,1,44,100&chtt=Druid_Balance_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.3,31.1,12.1,6.7,6.1,4.0,0.7&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,69CCF0,C79C6E&chl=starfire 177.0s|wrath 139.9s|starsurge 54.4s|moonfire 30.3s|sunfire 27.4s|starfall 18.0s|incarnation 3.1s&chtt=Druid_Balance_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Balance_T14H 102664
berserking 0 0.0% 3.0 181.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
moonfire 13477 13.1% 27.7 16.43sec 219156 199772 15533 32355 19335 22.6% 0.0% 0.0% 0.0% 320.1 13891 28867 17268 22.5% 0.0% 96.5%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.66 27.66 320.10 320.10 1.0970 1.3582 6062480.37 6062480.37 0.00 13034.79 199771.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.41 77.40% 15533.38 9490 36326 15551.26 12564 18045 332581 332581 0.00
crit 6.25 22.60% 32354.57 19549 74831 32393.28 0 56034 202287 202287 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 247.9 77.45% 13891.29 9072 26274 13906.91 12897 15020 3443991 3443991 0.00
crit 72.2 22.55% 28867.42 18688 54124 28903.64 24896 33907 2083621 2083621 0.00
DPS Timeline Chart

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional $o1 Arcane damage over $d.$?s79577[ Your Starfire and Starsurge critical strikes on the target will extend your Moonfire's duration by $8921t1 sec.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 12738 12.4% 16.5 29.19sec 346765 317361 0 0 0 0.0% 0.0% 0.0% 0.0% 163.2 28152 58660 35062 22.6% 0.0% 36.2%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.50 16.50 163.19 163.19 1.0927 1.0000 5721693.28 5721693.28 0.00 31573.89 317360.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 16.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.2 77.35% 28152.35 15267 44014 28173.85 26183 30167 3553578 3553578 0.00
crit 37.0 22.65% 58659.54 31450 90668 58707.44 48823 70646 2168115 2168115 0.00
DPS Timeline Chart

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:19560.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.starfall.up
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:(null)
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.330000
  • base_dd_min:533.66
  • base_dd_max:620.20
starfire 30112 29.3% 95.6 4.61sec 141612 76517 113628 236873 141612 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.61 95.61 0.00 0.00 1.8507 0.0000 13540042.99 13540042.99 0.00 76516.87 76516.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.90 77.29% 113627.89 68839 197774 113742.54 101315 125385 8397453 8397453 0.00
crit 21.71 22.71% 236873.26 141808 407415 237097.82 178762 309758 5142589 5142589 0.00
DPS Timeline Chart

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse>=60&eclipse_dir>=0
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.759000
  • base_dd_min:3466.63
  • base_dd_max:4457.10
starsurge 18023 17.6% 46.9 9.50sec 173005 148979 139376 290593 173584 22.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.87 46.71 0.00 0.00 1.1613 0.0000 8108603.74 8108603.74 0.00 148978.54 148978.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.15 77.38% 139376.27 83054 238890 139526.05 120490 162516 5037853 5037853 0.00
crit 10.57 22.62% 290592.67 171091 492113 290773.33 0 431327 3070751 3070751 0.00
DPS Timeline Chart

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.133000
  • base_dd_min:3731.12
  • base_dd_max:5147.21
sunfire 13155 12.8% 27.6 16.45sec 214836 216149 15637 32614 19475 22.6% 0.0% 0.0% 0.0% 315.1 13745 28523 17081 22.6% 0.0% 95.2%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.55 27.55 315.14 315.14 0.9939 1.3614 5919443.19 5919443.19 0.00 12968.84 216148.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.32 77.39% 15636.90 9490 27201 15656.67 12973 19016 333435 333435 0.00
crit 6.23 22.61% 32614.09 19549 56034 32632.71 0 56034 203176 203176 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 244.0 77.43% 13745.25 9072 26274 13758.37 12415 15072 3354048 3354048 0.00
crit 71.1 22.57% 28522.73 18688 54124 28552.10 24147 34010 2028784 2028784 0.00
DPS Timeline Chart

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5400.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $s1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional $o1 Nature damage over $d. Your Wrath and Starsurge critical strikes on the target will extend your Sunfire's duration by $93402t1 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 324 0.3% 1.0 1.#Rsec 143848 0 28550 58200 35962 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 4.00 0.00 0.00 0.0000 0.0000 143848.26 143848.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.00 75.00% 28550.35 0 38054 28453.42 0 38054 85654 85654 0.00
crit 1.00 25.00% 58200.17 0 78392 39580.03 0 78392 58194 58194 0.00
DPS Timeline Chart

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:6120.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.wild_mushroom.stack>0&buff.solar_eclipse.up
Spelldata
  • id:88751
  • name:Wild Mushroom: Detonate
  • school:nature
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards, and creating a Fungal Growth in each mushroom's wake covering an area within 8 yards, slowing all enemy targets by $81281s1%, and lasting $81283d.
wrath 14833 14.5% 98.6 4.51sec 67789 47781 54954 113505 68026 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.64 98.29 0.00 0.00 1.4187 0.0000 6686494.16 6686494.16 0.00 47781.49 47781.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.35 77.67% 54954.34 40117 115304 54957.41 51542 61842 4195692 4195692 0.00
crit 21.94 22.33% 113505.14 82640 237527 113518.31 93052 134941 2490802 2490802 0.00
DPS Timeline Chart

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse<=-70&eclipse_dir<=0
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.027000
  • base_dd_min:1966.56
  • base_dd_max:2528.44

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.61% 7.67%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.08%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.9 0.0 183.3sec 183.3sec 9.45% 9.45%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • celestial_alignment_1:9.4%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Damage done by your Nature and Arcane spells increased by $w1%. Cannot gain Lunar or Solar Energy.
  • description:Grants you the simultaneous damage benefit of both your Lunar Eclipse and Solar Eclipse, increasing damage done by your Nature and Arcane spells by $s1%. In addition, casting Moonfire also applies the the periodic damage effect of Sunfire to your target. Activating this ability consumes all Lunar and Solar Energy and prevents gaining more during its duration. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
chosen_of_elune 3.0 0.0 181.9sec 181.9sec 19.17% 27.65%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chosen_of_elune_1:19.2%

Spelldata details

  • id:122114
  • name:Chosen of Elune
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 63.2sec 63.2sec 32.85% 32.85%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.9%
jade_serpent_potion 2.0 0.0 194.7sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.5sec 54.5sec 22.78% 23.14%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
lunar_eclipse 13.8 0.0 33.5sec 33.5sec 42.27% 80.17%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_eclipse_1:42.3%

Spelldata details

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Damage done by your Arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Arcane spells by $s1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
lunar_shower 40.8 11.6 11.1sec 8.6sec 31.27% 20.79%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_shower
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_shower_1:23.6%
  • lunar_shower_2:7.7%

Spelldata details

  • id:81192
  • name:Lunar Shower
  • tooltip:Direct damage of your Moonfire and Sunfire increased by $s1%, and mana cost reduced by $s2%.
  • description:When you cast Moonfire or Sunfire, you gain Lunar Shower. Lunar Shower increases the direct damage done by your Moonfire and Sunfire spells by $81192s1%, and reduces the mana cost by $81192s2%. This effect stacks up to 3 times and lasts $81192d.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:1.01%
natures_grace 21.8 5.8 21.0sec 16.5sec 87.62% 87.62%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_grace_1:87.6%

Spelldata details

  • id:16886
  • name:Nature's Grace
  • tooltip:Spell casting speed increased by $s1%.
  • description:You gain $s1% spell haste each time you trigger an Eclipse.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
natures_vigil 2.9 0.0 181.9sec 181.9sec 19.12% 27.30%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_vigil_1:19.1%

Spelldata details

  • id:124974
  • name:Nature's Vigil
  • tooltip:Damage and healing done increased by $s1%. $s3% of single-target damage done heals a nearby target and $s3% of single-target healing done damages a nearby target.
  • description:Increases all damage and healing done by $s1% for $d. While active, all single-target healing spells also damage a nearby enemy target for $s3% of the healing done, and all single-target damage spells and abilities also heal a nearby friendly target for $s3% of the damage done.
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:1.00%
relic_of_yulon 9.0 0.0 52.3sec 52.3sec 29.63% 29.63%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.6%
shooting_stars 37.5 5.4 11.7sec 10.2sec 15.83% 78.77%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_shooting_stars
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • shooting_stars_1:15.8%

Spelldata details

  • id:93400
  • name:Shooting Stars
  • tooltip:Your next Starsurge spell is instant cast.
  • description:You have a $93399h% chance when you deal critical periodic damage with your Moonfire or Sunfire to instantly reset the cooldown of your Starsurge and cause its next cast within $93400d to be instant.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
solar_eclipse 14.9 0.0 30.4sec 30.4sec 39.32% 59.16%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_solar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • solar_eclipse_1:39.3%

Spelldata details

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Damage done by your Nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Nature spells by $s1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
starfall 16.5 0.0 28.0sec 29.2sec 36.33% 36.33%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • starfall_1:36.3%

Spelldata details

  • id:48505
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
  • max_stacks:
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
moonkin_form

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • moonkin_form_1:100.0%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by $24905s3%. Immune to Polymorph effects. All damage taken reduced by $24905s1%.
  • description:Shapeshift into $?s114301[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by $24905s3% and reducing all damage you take by $24905s1%.$?s116209[][ The Druid cannot cast healing spells while shapeshifted.] While in this form, you increase the spell haste of all party and raid members within $24907a1 yards by $24907s1%. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Balance_T14H
moonfire Mana 27.7 130649.0 4722.9 4722.9 46.4
starfall Mana 16.5 322743.9 19560.0 19560.0 17.7
starfire Mana 95.6 590890.8 6180.0 6180.0 22.9
starsurge Mana 46.9 289651.0 6180.0 6180.0 28.0
sunfire Mana 27.6 139387.1 5058.8 5058.8 42.5
wild_mushroom_detonate Mana 1.0 6120.0 6120.0 6120.0 23.5
wrath Mana 98.6 497129.5 5040.0 5040.0 13.5
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 671997.38 372.94 3717.60 0.55%
eclipse Mana 27.58 1277610.91 46321.47 1618436.09 55.88%
Resource RPS-Gain RPS-Loss
Mana 4326.68 4386.51
Combat End Resource Mean Min Max
Health 462677.00 462677.00 462677.00
Mana 274001.18 230550.00 300000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%
treant-Mana Cap 0.2%

Procs

Count Interval
hat_donor 143.3 3.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 102663.59
Minimum 94013.64
Maximum 113480.74
Spread ( max - min ) 19467.10
Range [ ( max - min ) / 2 * 100% ] 9.48%
Standard Deviation 2766.3114
5th Percentile 98357.60
95th Percentile 107428.16
( 95th Percentile - 5th Percentile ) 9070.56
Mean Distribution
Standard Deviation 27.6631
95.00% Confidence Intervall ( 102609.37 - 102717.81 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2789
0.1 Scale Factor Error with Delta=300 65325
0.05 Scale Factor Error with Delta=300 261303
0.01 Scale Factor Error with Delta=300 6532595
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 102663.59

Damage

Sample Data
Count 10000
Mean 46182605.99

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 324.51
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 moonkin_form
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
8 16.50 starfall,if=!buff.starfall.up
9 0.00 treants,if=talent.force_of_nature.enabled
A 2.99 berserking
B 1.00 wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
C 0.00 natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
D 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
E 2.96 incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
F 2.87 celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
G 2.95 natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
H 12.07 wrath,if=eclipse<=-70&eclipse_dir<=0
I 12.13 starfire,if=eclipse>=60&eclipse_dir>=0
J 15.68 moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
K 12.08 sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
L 11.98 moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
M 12.67 sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
N 46.90 starsurge
O 17.57 starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
P 0.54 wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
Q 66.29 starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
R 86.35 wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
S 0.00 moonfire,moving=1,if=!dot.sunfire.ticking
T 0.00 sunfire,moving=1,if=!dot.moonfire.ticking
U 0.00 wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
V 0.00 starsurge,moving=1,if=buff.shooting_stars.react
W 0.00 moonfire,moving=1,if=buff.lunar_eclipse.up
X 0.00 sunfire,moving=1

Sample Sequence

8AHEGJMNQJQQ8QFBJOOOOO8NOONQQIKNRLNRRRRRRH8JNQMNQQQQIKNLRRRRRRRNH8JQNMQNQQQIKRRRRLNRRRRH8JNQMNQQQQIKRRLNRRRRRNH8JQMQNQNQQIKRRRLRNRRRRH8AJEGMQQNQQQF78JNONOONOOQQIKRRRNLRRNRRH8JNQQQMQQQIKNRLRRRRRRRH8JMNQQQNQQIKNRRRRRRRLNH8JQMNQNQQQIKRRLRNRRRRRH8JMNQQQNQNIKRLNRRRRRARRH8EGJMNQQQQF8JONOOONOQQIKRRLRRNRRRNH8JMNQNQQQNIKRRRLRNRRRRH8

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 186 177 80
Stamina 22591 20537 20418
Intellect 20858 18565 18400
Spirit 4511 4511 4322
Health 462677 433921 0
Mana 300000 300000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 31630 26462 7907
Spell Hit 15.17% 15.17% 835
Spell Crit 24.85% 18.95% 5862
Spell Haste 16.79% 11.23% 4771
Mana Per 5 7500 7500 0
Attack Power 499 445 0
Melee Hit 15.17% 15.17% 835
Melee Crit 22.40% 17.39% 5862
Melee Haste 11.23% 11.23% 4771
Swing Speed 22.35% 11.23% 4771
Expertise 0.00% 0.00% 0
Armor 18619 18619 18619
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.20% 0.19% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.81% 23.44% 2698

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Balance_T14H"
origin="unknown"
level=90
race=troll
spec=balance
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
glyphs=moonbeast

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
actions+=/starfall,if=!buff.starfall.up
actions+=/treants,if=talent.force_of_nature.enabled
actions+=/berserking
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
actions+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions+=/incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
actions+=/celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
actions+=/natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
actions+=/wrath,if=eclipse<=-70&eclipse_dir<=0
actions+=/starfire,if=eclipse>=60&eclipse_dir>=0
actions+=/moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/starsurge
actions+=/starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
actions+=/wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
actions+=/moonfire,moving=1,if=!dot.sunfire.ticking
actions+=/sunfire,moving=1,if=!dot.moonfire.ticking
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
actions+=/starsurge,moving=1,if=buff.shooting_stars.react
actions+=/moonfire,moving=1,if=buff.lunar_eclipse.up
actions+=/sunfire,moving=1

head=eternal_blossom_cover,id=86934,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=eternal_blossom_mantle,id=86932,gems=80int_160spi_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_crit
chest=eternal_blossom_vestment,id=86936,gems=80int_160crit_80int_160crit_180haste,enchant=80all,reforge=haste_mastery
wrists=pearlescent_butterfly_wristbands,id=86996,enchant=180int,reforge=mastery_crit
hands=eternal_blossom_gloves,id=86933,enchant=170haste,reforge=haste_crit
waist=stonebound_cinch,id=87019,gems=160int_160int,reforge=haste_crit
legs=eternal_blossom_leggings,id=86935,gems=160int_60int,enchant=285int_165spi,reforge=mastery_spi
feet=asanis_uncleansed_sandals,id=90514,gems=160int,enchant=175hit
finger1=watersoul_signet,id=90511,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,weapon=mace_1.90speed_1620min_3010max,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20418
# gear_intellect=18400
# gear_spirit=4322
# gear_spell_power=7907
# gear_hit_rating=835
# gear_crit_rating=5862
# gear_haste_rating=4771
# gear_mastery_rating=2698
# gear_armor=18619
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_1.90speed_1620min_3010max,enchant=jade_spirit

Druid_Feral_T14H : 120836 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
120835.5 120835.5 54.51 / 0.05% 4596 / 3.8% 8184.5 2297.4 2297.4 2.03 / 0.09% 169 / 7.4% 157.8 14.6 14.4 Energy 37.04% 39.5 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
Glyphs
  • savagery

Charts

http://5.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:340580|175693|63186|27181&chds=0,681161&chco=C55D54,C79C6E,C79C6E,C79C6E&chm=t++340580++rake,C55D54,0,0,15|t++175693++ferocious_bite,C79C6E,1,0,15|t++63186++shred,C79C6E,2,0,15|t++27181++cat_melee,C79C6E,3,0,15&chtt=Druid_Feral_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:34,23,22,14,7,1,1&chds=0,100&chdls=ffffff&chco=C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,ABD473&chl=rake|cat_melee|rip|shred|ferocious_bite|symbiosis_wolf: melee|symbiosis_wolf: spirit_bite&chtt=Druid_Feral_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uw010334553566687665321zxwutsrqqpoonnmmmllkkjiihhffeededdeeeefggghhhhiijjjkkkkkjjihgggggggghgggffeeeeeeeeeeeeddcccccccdddefffggghhhiiijjkkkkjjiiiihhhhiiiiiihhhhhhhhggggggfeedddddeeefgghijklmnoopqqqrrrrqqpoommlkjjiihhhhgggfggggfgfffffeedcddcddddeeffffgggghhhiiijjjjiihhhhhhhhiiiiiiiiiihhhhhhhhggffeeedddddeefffggggghhhhhiiiiiiiihhhhhghhhhiiiiiiiiiihhhhhiihhhhhgggggghhijkklmnoopqrrsttuuuuuutttsrrqqppooonnmmmllllkkkkjjjihhhggggggghhhiiiiiiiijijjjjjjjiiiihhhhhhiiiiiiijiiiiiiiiiihhhhgggggfggghhhiijjjkkkkkllllmlmmmmlllllllmmmmmmmmmmllllllkkjjihihgfffeeedddc&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=120836|max=203479&chxp=1,1,59,100&chtt=Druid_Feral_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,1,0,4,4,8,23,30,62,57,120,168,233,280,357,458,503,567,602,636,658,668,677,624,561,521,421,362,336,261,195,159,136,89,69,49,36,27,10,11,2,4,3,0,2,2,0,1,1&chds=0,677&chbh=5&chxt=x&chxl=0:|min=110296|avg=120836|max=133728&chxp=0,1,45,100&chtt=Druid_Feral_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:25.5,13.2,12.0,4.9,3.7,2.7,1.2,37.0&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C55D54,C79C6E,C79C6E,C55D54,ABD473,ffffff&chl=shred 114.7s|healing_touch 59.5s|rake 53.9s|ferocious_bite 21.9s|savage_roar 16.6s|rip 12.3s|feral_spirit 5.3s|waiting 166.9s&chtt=Druid_Feral_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Feral_T14H 120836
berserk 0 0.0% 2.9 186.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserk

Static Values
  • id:106952
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
Spelldata
  • id:106952
  • name:Berserk
  • school:physical
  • tooltip:(null)
  • description:When used in Bear Form, removes the cooldown from Mangle and causes it to hit up to $50334s1 targets and lasts $50334d. When used in Cat Form, reduces the cost of all Cat Form abilities by $106951s1% and lasts $106951d.
berserking 0 0.0% 3.0 180.44sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
cat_melee 27185 22.5% 531.7 0.85sec 23019 27181 16585 34584 23019 41.2% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 531.73 531.73 0.00 0.00 0.8469 0.0000 12239844.86 12239844.86 0.00 27181.47 27181.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.66 34.73% 16585.24 11981 21789 16587.10 16225 17015 3062639 3062639 0.00
crit 219.14 41.21% 34584.09 24681 44884 34591.36 33814 35422 7578816 7578816 0.00
glance 127.64 24.01% 12522.23 8986 16341 12524.41 12226 12875 1598390 1598390 0.00
dodge 0.20 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
feral_spirit 0 0.0% 4.0 123.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 3.96 0.00 0.00 1.3395 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:110807
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:110807
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Druid, lasting $d.
ferocious_bite 8553 7.1% 21.1 21.56sec 182094 175693 102612 219293 182094 68.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.11 21.11 0.00 0.00 1.0364 0.0000 3844333.73 3844333.73 0.00 175692.78 175692.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.71 31.78% 102612.04 9825 202391 102405.42 0 173041 688527 688527 0.00
crit 14.39 68.16% 219293.36 20240 416925 219545.89 146717 274051 3155807 3155807 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&dot.rip.ticking&target.health.pct<=25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.] When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target. Critical strike chance increased by $s2% against bleeding targets. 1 point : ${$m1+$b1*1+0.196*$AP}-${$M1+$b1*1+0.196*$AP} damage 2 points: ${$m1+$b1*2+0.196*2*$AP}-${$M1+$b1*2+0.196*2*$AP} damage 3 points: ${$m1+$b1*3+0.196*3*$AP}-${$M1+$b1*3+0.196*3*$AP} damage 4 points: ${$m1+$b1*4+0.196*4*$AP}-${$M1+$b1*4+0.196*4*$AP} damage 5 points: ${$m1+$b1*5+0.196*5*$AP}-${$M1+$b1*5+0.196*5*$AP} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.980000
  • base_dd_min:315.19
  • base_dd_max:685.41
healing_touch 2297 100.0% 44.2 10.32sec 23392 17396 0 0 23392 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.24 44.24 0.00 0.00 1.3447 0.0000 1034790.53 1034790.53 0.00 17395.53 17395.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 44.24 100.00% 23391.86 21668 32502 23396.52 22942 24038 1034791 1034791 0.00
HPS Timeline Chart

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17340.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:false
  • if_expr:!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:(null)
  • description:Heals a friendly target for $s1$?s54825[ and reduces your remaining cooldown on Swiftmend by $54825m1 sec][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.860000
  • base_dd_min:18459.28
  • base_dd_max:21800.87
natures_swiftness 0 0.0% 7.0 67.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: natures_swiftness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.04 7.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: natures_swiftness

Static Values
  • id:132158
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
Spelldata
  • id:132158
  • name:Nature's Swiftness
  • school:physical
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
rake 40732 33.7% 52.0 8.61sec 353008 340580 61803 129824 89731 41.1% 0.1% 0.0% 0.0% 149.4 62828 132567 91598 41.3% 0.0% 99.4%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.97 51.97 149.37 149.37 1.0365 3.0000 18344677.00 18344677.00 0.00 36545.95 340580.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.58 58.84% 61802.83 42958 94507 61814.05 56043 68977 1889906 1889906 0.00
crit 21.36 41.10% 129824.06 88493 194684 129912.16 114313 148417 2773133 2773133 0.00
dodge 0.02 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.7 58.75% 62827.70 42958 94507 62843.92 58564 67386 5512961 5512961 0.00
crit 61.6 41.25% 132566.86 88493 194684 132633.91 121270 145494 8168677 8168677 0.00
DPS Timeline Chart

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for $s1 Bleed damage and an additional $o2 Bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.368000
  • base_dd_min:118.23
  • base_dd_max:118.23
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.368000
  • base_td:118.23
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rip 26650 22.1% 11.8 30.04sec 1014557 978858 0 0 0 0.0% 0.1% 0.0% 0.0% 210.7 39147 83027 56981 40.6% 0.0% 93.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.83 11.83 210.66 210.66 1.0365 2.0000 12003734.84 12003734.84 0.00 27684.91 978857.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.82 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.01 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.0 59.36% 39146.93 32185 67806 39188.33 33289 49747 4894956 4894956 0.00
crit 85.6 40.64% 83026.99 66301 139680 83084.21 69970 110802 7108779 7108779 0.00
DPS Timeline Chart

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over time. Damage increases per combo point: 1 point : ${$floor($m1+$b1*1*$<mastery>+0.0484*$AP*$<mastery>)*8} damage over $d. 2 points: ${$floor($m1+$b1*2*$<mastery>+0.0484*2*$AP*$<mastery>)*8} damage over $d. 3 points: ${$floor($m1+$b1*3*$<mastery>+0.0484*3*$AP*$<mastery>)*8} damage over $d. 4 points: ${$floor($m1+$b1*4*$<mastery>+0.0484*4*$AP*$<mastery>)*8} damage over $d. 5 points: ${$floor($m1+$b1*5*$<mastery>+0.0484*5*$AP*$<mastery>)*8} damage over $d. Each time you Shred, Ravage, or Mangle the target while in Cat Form the duration of your Rip on that target is extended by $s2 sec, up to a maximum of $s3 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.242000
  • base_td:112.76
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
savage_roar 0 0.0% 17.0 28.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.04 17.04 0.00 0.00 0.9756 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 17.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
shred 16116 13.3% 110.7 4.07sec 65492 63186 45195 94015 65492 41.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.71 110.71 0.00 0.00 1.0365 0.0000 7250383.52 7250383.52 0.00 63185.82 63185.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.56 58.31% 45194.84 30413 69046 45198.87 42596 48082 2917684 2917684 0.00
crit 46.09 41.63% 94015.19 62650 142236 94020.91 87080 102227 4332699 4332699 0.00
dodge 0.05 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<=4
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:(null)
  • description:Shred the target, causing $m3% damage plus $m1 to the target$?s48484[ and reducing the target's movement speed by $58180s1% for $58180d][]. Must be behind the target. Awards $s2 combo $lpoint:points;. Deals $62078s2% additional damage against bleeding targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:62.40
  • base_dd_max:62.40
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.00
tigers_fury 0 0.0% 14.9 31.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.87 14.87 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35&!buff.omen_of_clarity.react
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d and instantly restores $s2 Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
pet - symbiosis_wolf 6306 / 1599
melee 3350 0.7% 179.5 4.38sec 2135 1728 1577 3188 2135 40.4% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.51 179.51 0.00 0.00 1.2350 0.0000 383188.47 383188.47 0.00 1728.39 1728.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.90 35.59% 1577.29 1516 2119 1576.93 1516 1752 100782 100782 0.00
crit 72.55 40.41% 3188.02 3032 4237 3184.36 3032 3558 231275 231275 0.00
glance 42.98 23.94% 1189.70 1137 1589 1188.90 1137 1339 51132 51132 0.00
dodge 0.05 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 2956 0.6% 38.2 10.88sec 8859 5745 6217 12609 8859 41.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.21 38.21 0.00 0.00 1.5422 0.0000 338470.66 338470.66 0.00 5744.58 5744.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.37 58.56% 6216.63 5871 8381 6213.50 5871 6826 139081 139081 0.00
crit 15.81 41.39% 12608.80 11742 16762 12598.82 11742 14244 199389 199389 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 2.9 0.0 186.6sec 186.6sec 9.55% 9.55%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserk_1:9.5%
berserking 3.0 0.0 180.5sec 180.4sec 6.65% 6.30%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 7.80%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 8.9 3.2 48.2sec 34.6sec 27.36% 27.11%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:27.4%
dream_of_cenarius_damage 44.1 0.1 10.2sec 10.3sec 33.68% 41.84%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dream_of_cenarius_damage
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dream_of_cenarius_damage_1:17.2%
  • dream_of_cenarius_damage_2:16.4%

Spelldata details

  • id:108381
  • name:Dream of Cenarius
  • tooltip:Moonfire and Sunfire damage increased by $s3%, and melee ability damage increased by $s1%.
  • description:Nourish, Healing Touch, and Regrowth increase the damage done by your next $n Moonfire or Sunfire casts by $108381s3% or by your next $n melee abilities by $108381s1%.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
natures_swiftness 7.0 0.0 67.9sec 67.9sec 0.00% 16.28%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_natures_swiftness
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

Spelldata details

  • id:132158
  • name:Nature's Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:60.00
  • default_chance:0.00%
omen_of_clarity 20.9 0.3 20.7sec 20.4sec 2.91% 6.26%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:4.00%
  • default_value:-1.00

Stack Uptimes

  • omen_of_clarity_1:2.9%

Spelldata details

  • id:16870
  • name:Clearcasting
  • tooltip:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%.
  • description:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%. Does not affect Nourish.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
predatory_swiftness 37.5 4.6 12.0sec 10.7sec 34.36% 100.00%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • predatory_swiftness_1:34.4%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth will be instant, free, and castable in all forms.
  • description:Your finishing moves have a chance per combo point to make your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth become instant, free, and castable in all forms.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 7.6 0.0 62.8sec 62.8sec 24.89% 24.89%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.9%
savage_roar 1.4 15.6 246.0sec 28.5sec 99.96% 99.79%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • savage_roar_1:100.0%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 7.7 0.0 62.2sec 62.2sec 16.87% 16.87%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.9%
terror_in_the_mists 7.5 0.0 64.1sec 64.1sec 32.50% 32.50%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.5%
tigers_fury 14.9 0.0 31.1sec 31.1sec 19.68% 18.55%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:19.7%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d and instantly restores $s2 Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 387.0sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
cat_form

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • cat_form_1:100.0%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Causes Agility to increase attack power, increases autoattack damage by $s3%, and increases movement speed by $113636s1%.$?$w2=100[ Additionally, all healing done to you is increased by $47180s1%][]
  • description:Shapeshift into Cat Form, causing Agility to increase attack power, increasing autoattack damage by $s3%, and increasing movement speed by $113636s1%.$?s47180[ Additionally, all healing done to you is increased by $47180s1%.][] Also protects the caster from Polymorph effects and allows the use of various cat abilities. Energy regeneration continues while not in Cat Form. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
symbiosis

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_symbiosis
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • symbiosis_1:100.0%

Spelldata details

  • id:110309
  • name:Symbiosis
  • tooltip:Grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death.
  • description:Creates a symbiotic link which grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death. Cannot be cast on other Druids. Effect cancelled if Druid and target become too far apart.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Feral_T14H
ferocious_bite Energy 42.2 782.4 18.5 37.1 4913.6
rake Energy 52.0 1638.8 31.5 31.5 11194.1
rip Energy 11.8 311.0 26.3 26.3 38592.4
savage_roar Energy 17.0 376.5 22.1 22.1 0.0
shred Energy 110.7 3450.4 31.2 31.2 2101.3
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.91 4751.26 2.64 84.06 1.74%
energy_refund Energy 0.39 2.55 6.60 0.00 0.00%
lotp_health Health 63.36 0.00 0.00 1175869.18 100.00%
lotp_mana Mana 63.36 0.00 0.00 304127.04 100.00%
omen_of_clarity Mana 1.92 33308.41 17340.00 0.00 0.00%
omen_of_clarity Energy 18.98 721.42 38.02 0.00 0.00%
soul_of_the_forest Energy 48.57 837.56 17.25 5.92 0.70%
tigers_fury Energy 14.87 892.00 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 14.39 14.56
Combat End Resource Mean Min Max
Health 463965.00 463965.00 463965.00
Mana 60000.00 60000.00 60000.00
Rage 0.00 0.00 0.00
Energy 24.50 0.38 97.65
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.5%
treant-Energy Cap 1.5%
treant-Energy Cap 1.5%
symbiosis_wolf-Energy Cap 1.5%
symbiosis_wolf-Energy Cap 1.5%

Procs

Count Interval
hat_donor 229.1 2.0sec
primal_fury 67.4 6.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 120835.51
Minimum 110295.98
Maximum 133728.06
Spread ( max - min ) 23432.08
Range [ ( max - min ) / 2 * 100% ] 9.70%
Standard Deviation 2780.9434
5th Percentile 116431.89
95th Percentile 125623.07
( 95th Percentile - 5th Percentile ) 9191.18
Mean Distribution
Standard Deviation 27.8094
95.00% Confidence Intervall ( 120781.00 - 120890.02 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2034
0.1 Scale Factor Error with Delta=300 66018
0.05 Scale Factor Error with Delta=300 264075
0.01 Scale Factor Error with Delta=300 6601885
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 120835.51

Damage

Sample Data
Count 10000
Mean 53682973.95

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 2297.45
Minimum 1891.63
Maximum 2736.40
Spread ( max - min ) 844.77
Range [ ( max - min ) / 2 * 100% ] 18.39%
Standard Deviation 103.6695
5th Percentile 2127.64
95th Percentile 2465.36
( 95th Percentile - 5th Percentile ) 337.73
Mean Distribution
Standard Deviation 1.0367
95.00% Confidence Intervall ( 2295.42 - 2299.48 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7821
0.1 Scale Factor Error with Delta=300 91
0.05 Scale Factor Error with Delta=300 366
0.01 Scale Factor Error with Delta=300 9174
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 2297.45

Heal

Sample Data
Count 10000
Mean 1034790.53

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 296.35
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 symbiosis,class=shaman
5 0.00 cat_form
6 0.00 savage_roar
7 0.00 snapshot_stats
8 0.00 virmens_bite_potion
Default action list
# count action,conditions
9 1.00 virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
A 1.00 auto_attack
B 0.00 skull_bash_cat
C 8.55 healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
D 7.04 healing_touch,if=prev.natures_swiftness
E 7.67 use_item,name=eternal_blossom_grips,sync=tigers_fury
F 14.87 tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
G 2.90 berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
H 0.00 natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
I 0.00 incarnation,if=buff.berserk.up&talent.incarnation.enabled
J 3.01 berserking
K 12.67 savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
L 0.00 faerie_fire,if=debuff.weakened_armor.stack<3
M 0.76 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
N 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
O 7.74 ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
P 0.28 ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
Q 0.00 ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
R 1.98 shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
S 2.57 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
T 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
U 11.83 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
V 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
W 4.16 ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
X 3.37 savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
Y 3.28 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
Z 0.42 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
a 20.37 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
b 7.28 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
c 38.42 rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
d 0.00 rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
e 13.55 rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
f 0.00 ravage,if=buff.omen_of_clarity.react
g 10.18 shred,if=buff.omen_of_clarity.react
h 0.37 ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
i 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
j 8.56 ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
k 0.00 ravage,if=(buff.tigers_fury.up|buff.berserk.up)
l 0.00 ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
m 0.00 ravage,if=cooldown.tigers_fury.remains<=3.0
n 0.00 ravage,if=target.time_to_die<=8.5
o 0.00 ravage,if=energy.time_to_max<=1.0
p 37.77 shred,if=(buff.tigers_fury.up|buff.berserk.up)
q 16.84 shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
r 18.65 shred,if=cooldown.tigers_fury.remains<=3.0
s 1.66 shred,if=target.time_to_die<=8.5
t 23.62 shred,if=energy.time_to_max<=1.0
u 3.96 feral_spirit

Sample Sequence

AJcqqEFGpSDUcKpppWppppWputbetXgttrCcFUacppjattetqUrrrEFacKcactgtgjbecqqSDUcFacppjaKteKqqCcEFpUacptuteXtCcqqFSDUcacptjbecRJXqqEFGppCUcppapWppppbejgCcqqFSDUcacKtCtettrUrEFacppKautetgtUgrrFacjacptKbecqSDUcrCcEFpjacRtgtXqqeqCUcrFacpOacttJZDeOtKrCcEFG9pppOacpgpOpppOpubKecrrOFacppKatetMDOcrrCEFcOaccpOsKs

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 21662 19265 18252
Stamina 22683 20621 20502
Intellect 257 245 80
Spirit 269 269 80
Health 463965 435097 0
Mana 60000 60000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 271 235 0
Spell Hit 14.95% 14.95% 2545
Spell Crit 15.49% 10.49% 5124
Spell Haste 8.34% 3.18% 1351
Mana Per 5 1500 1500 0
Attack Power 48134 445 0
Melee Hit 7.49% 7.49% 2545
Melee Crit 38.22% 31.32% 5124
Melee Haste 3.18% 3.18% 1351
Swing Speed 13.50% 3.18% 1351
Expertise 7.46% 7.46% 2537
Armor 18644 18644 18644
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 19.55% 17.71% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 78.19% 62.54% 7188

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Feral_T14H"
origin="unknown"
level=90
race=troll
spec=feral
role=attack
position=back
professions=engineering=600/inscription=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
glyphs=savagery

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/symbiosis,class=shaman
actions.precombat+=/cat_form
actions.precombat+=/savage_roar
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
actions+=/healing_touch,if=prev.natures_swiftness
actions+=/use_item,name=eternal_blossom_grips,sync=tigers_fury
actions+=/tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
actions+=/berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
actions+=/natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
actions+=/incarnation,if=buff.berserk.up&talent.incarnation.enabled
actions+=/berserking
actions+=/savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
actions+=/faerie_fire,if=debuff.weakened_armor.stack<3
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
actions+=/ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
actions+=/ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
actions+=/savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
actions+=/rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/ravage,if=buff.omen_of_clarity.react
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
actions+=/ravage,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/ravage,if=cooldown.tigers_fury.remains<=3.0
actions+=/ravage,if=target.time_to_die<=8.5
actions+=/ravage,if=energy.time_to_max<=1.0
actions+=/shred,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/shred,if=cooldown.tigers_fury.remains<=3.0
actions+=/shred,if=target.time_to_die<=8.5
actions+=/shred,if=energy.time_to_max<=1.0
actions+=/feral_spirit

head=eternal_blossom_headpiece,id=86925,gems=agile_primal_80agi_160hit_180agi,reforge=exp_crit
neck=choker_of_the_unleashed_storm,id=86953
shoulders=eternal_blossom_spaulders,id=86927,gems=80agi_160hit_60agi,enchant=520agi_100crit,reforge=haste_mastery
back=legbreaker_greatcloak,id=86963,enchant=180hit,reforge=crit_exp
chest=eternal_blossom_raiment,id=86923,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_mastery
hands=eternal_blossom_grips,id=86924,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=hit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=160agi_160agi,reforge=crit_mastery
legs=legguards_of_failing_purification,id=90504,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=hit_exp
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140mastery,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503,reforge=haste_mastery
finger2=painful_thorned_ring,id=86974,reforge=exp_crit
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=gaorei_staff_of_the_legendary_protector,id=87156,gems=500agi,enchant=dancing_steel,reforge=exp_hit

# Gear Summary
# gear_strength=80
# gear_agility=18252
# gear_stamina=20502
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2537
# gear_hit_rating=2545
# gear_crit_rating=5124
# gear_haste_rating=1351
# gear_mastery_rating=7188
# gear_armor=18644
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=eternal_blossom_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=gaorei_staff_of_the_legendary_protector,heroic=1,weapon=staff_3.30speed_13314min_19972max,enchant=dancing_steel

Hunter_BM_T14H : 106331 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
106330.8 106330.8 38.55 / 0.04% 3236 / 3.0% 3996.1 11.5 11.3 Focus 0.00% 54.3 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

Charts

http://1.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:810204|381235|220343|114112|110562|96513|42729|18354|13115&chds=0,1620407&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++810204++stampede,C79C6E,0,0,15|t++381235++lynx_rush,C79C6E,1,0,15|t++220343++dire_beast,C79C6E,2,0,15|t++114112++kill_command,C79C6E,3,0,15|t++110562++kill_shot,C79C6E,4,0,15|t++96513++glaive_toss,C79C6E,5,0,15|t++42729++arcane_shot,69CCF0,6,0,15|t++18354++cobra_shot,ABD473,7,0,15|t++13115++ranged,C79C6E,8,0,15&chtt=Hunter_BM_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:36,32,28,28,25,17,15,14,12,8,7,1,1,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat: kill_command|cat: melee|ranged|arcane_shot|cat: claw|dire_beast: dire_beast_melee|cobra_shot|glaive_toss|cat: lynx_rush|kill_shot|serpent_sting|raptor: melee|wolf: melee|devilsaur: melee|hyena: melee|raptor: claw|devilsaur: claw|hyena: claw|wolf: claw&chtt=Hunter_BM_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:3855434323234431vtpnlkggedcaZYWVUUTUUUVXXYYZZZaZZaaaaZaaaZYXWVVVUUUUTUUUUUUUUUUUUUUUUVVUUUUTTSSSSSRRSSSSSSSSSSTTTTTUUUVVUUUUTTTTTUUVVVVVVVVVVVWWWWWWWWVVUTTTTSSSSSTTTUUUUVVVWWWXXXYYYYXXXWVVUUTTTSSSSSRRRRRRSSSSSTTTTUUTTTTUUVVVVVVWWWWWWWWWXXXXXWWVVWWVVVVVVUUUUUUUUUTTTTTTTTTTTTUUUUTTTTTTTTSSSTTTTUUUVVWXXXYYZZZaabbcccccbaaaZZYYYYXXXXXWWVVVWWXXXYYYYYYZZYYYYYYYYYYXXXXXXXXXXXXXWWWVVVUUUUTTTTTTTTTTTUUUUUVVWXXYZZZZZZZZZZZZaaaaaaaaZZZaabbbccddddddddddcccbbaaaZZZYYYYYYYXXXXXXXXYYYYYYYYYYYXXXXXXXXXXXXXXXXXYYYYZZZZaaaaaabbbbbbbbbbbaaaaZZZZZYYXXWWVVUTTTSSSRRRQQQPP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=106331|max=268741&chxp=1,1,40,100&chtt=Hunter_BM_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,3,1,2,3,12,11,16,31,56,74,121,157,193,256,304,410,450,501,597,642,624,627,664,599,566,460,458,413,337,298,241,192,173,143,73,83,53,49,30,20,15,12,7,8,6,3,2,0,2&chds=0,664&chbh=5&chxt=x&chxl=0:|min=99204|avg=106331|max=114615&chxp=0,1,46,100&chtt=Hunter_BM_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.6,29.8,14.7,6.7,3.6,3.5,2.2,1.5,0.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473&chl=cobra_shot 164.9s|arcane_shot 134.1s|kill_command 66.2s|glaive_toss 30.4s|dire_beast 16.0s|kill_shot 15.9s|focus_fire 10.0s|lynx_rush 6.6s|serpent_sting 3.6s|stampede 2.1s|aspect_of_the_hawk 1.0s&chtt=Hunter_BM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_BM_T14H 106331
arcane_shot 12724 12.0% 129.4 3.43sec 44288 42729 33620 69588 44369 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.38 129.15 0.00 0.00 1.0365 0.0000 5730025.62 5730025.62 0.00 42728.86 42728.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.55 70.12% 33620.09 31200 40193 33621.42 32914 34517 3044350 3044350 0.00
crit 38.59 29.88% 69587.74 64272 82797 69595.94 66868 72996 2685676 2685676 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 8.4 56.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.42 8.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.beast_within.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
blood_fury 0 0.0% 4.3 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 6715 6.3% 111.2 3.85sec 27217 18354 20702 42700 27265 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.19 110.99 0.00 0.00 1.4829 0.0000 3026207.62 3026207.62 0.00 18354.45 18354.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.88 70.17% 20702.19 20060 26177 20702.39 20336 21005 1612324 1612324 0.00
crit 33.11 29.83% 42699.52 41324 53925 42698.69 41610 44144 1413884 1413884 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (7846) 0.0% (7.4%) 15.5 29.33sec 228378 220343 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.48 15.48 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 220342.94 220342.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&focus<=80
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
focus_fire 0 0.0% 9.7 44.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.66 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
glaive_toss 6510 6.1% 29.3 15.52sec 100036 96513 38090 78995 50264 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.33 58.38 0.00 0.00 1.0365 0.0000 2934297.99 2934297.99 0.00 96513.44 96513.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.00 70.24% 38089.91 34811 54094 38098.74 36459 39951 1561812 1561812 0.00
crit 17.37 29.76% 78994.72 71710 111433 79040.76 72807 88196 1372486 1372486 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_command 0 (16776) 0.0% (15.8%) 63.8 7.03sec 118276 114112 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.85 63.85 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 114111.82 114111.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 63.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:Give the command to kill, causing your pet to instantly inflict $ damage to its target. The pet must be within 25 yards of the target to Kill Command.
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.
kill_shot 3879 3.7% 15.3 5.50sec 114596 110562 87310 180359 115834 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.31 15.15 0.00 0.00 1.0365 0.0000 1754844.51 1754844.51 0.00 110562.28 110562.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.51 69.35% 87310.25 80976 105666 87315.92 80976 96271 917238 917238 0.00
crit 4.64 30.65% 180359.30 166811 217671 179318.88 0 217671 837607 837607 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (5570) 0.0% (5.2%) 6.4 75.26sec 395134 381235 0 0 0 0.0% 0.0% 0.0% 0.0% 56.9 0 0 0 13.1% 0.0% 5.6%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.35 6.35 56.87 56.87 1.0365 0.4441 0.00 0.00 0.00 78823.33 381234.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.4 86.88% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.5 13.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 13051 12.3% 212.0 2.11sec 27739 13115 21005 43437 27739 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 212.05 212.05 0.00 0.00 2.1151 0.0000 5881856.84 5881856.84 0.00 13114.74 13114.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.39 69.98% 21004.90 19852 26070 21006.05 20696 21355 3116997 3116997 0.00
crit 63.65 30.02% 43437.46 40896 53705 43441.98 41958 45249 2764860 2764860 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.0 105.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.04 4.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up&!buff.beast_within.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.6 388.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.58 1.58 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 3025 2.8% 3.4 108.66sec 397041 383085 0 0 0 0.0% 0.0% 0.0% 0.0% 147.7 7008 14490 9233 29.7% 0.0% 98.3%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 3.43 147.66 147.66 1.0364 3.0000 1363400.56 1363400.56 0.00 3053.28 383085.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.7 70.26% 7008.49 6577 9583 7008.42 6826 7215 727127 727127 0.00
crit 43.9 29.74% 14490.37 13548 19742 14490.41 13841 15248 636273 636273 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (3791) 0.0% (3.5%) 2.0 300.75sec 839776 810204 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 810203.63 810203.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 48789 / 48789
claw 11692 11.0% 130.3 3.47sec 40370 26274 25512 51432 40370 57.5% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.31 130.31 0.00 0.00 1.5365 0.0000 5260521.29 5260521.29 0.00 26273.84 26273.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.02 42.22% 25511.96 16058 82892 25550.98 19966 32676 1403694 1403694 0.00
crit 74.94 57.51% 51432.42 32117 165784 51503.38 42534 63995 3854165 3854165 0.00
block 0.08 0.06% 33361.50 16058 82892 2555.44 0 82892 2662 2662 0.00
parry 0.27 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
kill_command 16776 15.8% 63.8 7.03sec 118276 0 83870 170446 118276 40.0% 0.3% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.85 63.85 0.00 0.00 0.0000 0.0000 7551806.04 7551806.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.06 59.60% 83869.58 70144 180772 83938.54 74940 98678 3191799 3191799 0.00
crit 25.54 40.00% 170445.55 140288 361544 170663.38 147954 209577 4353622 4353622 0.00
block 0.07 0.11% 90943.92 70144 180772 6118.46 0 180772 6384 6384 0.00
parry 0.18 0.28% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc34026
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:697.93
  • base_dd_max:697.93
lynx_rush 5570 5.2% 56.9 7.28sec 44134 0 31750 66563 44134 39.0% 3.7% 0.0% 1.4% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.87 56.87 0.00 0.00 0.0000 0.0000 2510050.02 2510050.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.78 55.89% 31749.69 25429 64800 31858.50 25429 42436 1009158 1009158 0.00
crit 22.18 38.99% 66563.24 50857 129600 66835.36 50857 93843 1476113 1476113 0.00
block 0.78 1.37% 31731.85 25429 64800 17235.51 0 64800 24779 24779 0.00
parry 2.13 3.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 14751 13.9% 321.9 1.40sec 20617 14750 15137 31042 20617 40.1% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 321.86 321.86 0.00 0.00 1.3978 0.0000 6635990.41 6635990.41 0.00 14750.45 14750.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.67 35.63% 15137.03 12714 32400 15149.21 14066 16808 1735775 1735775 0.00
crit 129.16 40.13% 31041.86 25429 64800 31081.50 28687 34173 4009245 4009245 0.00
glance 77.25 24.00% 11507.94 9536 24300 11519.90 10423 13036 888975 888975 0.00
block 0.13 0.04% 15635.98 12714 32400 1876.70 0 32400 1995 1995 0.00
parry 0.66 0.20% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 5.8 84.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.84 5.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 10498 / 948
claw 4796 0.4% 13.0 26.58sec 14779 9601 10309 20670 14779 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 191833.72 191833.72 0.00 9601.29 9601.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.38 56.86% 10309.09 5991 17269 10315.52 0 16387 76084 76084 0.00
crit 5.60 43.14% 20670.30 11982 34538 20635.66 0 34538 115750 115750 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5702 0.5% 29.2 11.28sec 7804 5893 5448 11439 7804 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.22 29.22 0.00 0.00 1.3244 0.0000 228081.72 228081.72 0.00 5892.82 5892.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.30 31.82% 5447.63 4707 6750 5444.75 4707 6750 50652 50652 0.00
crit 12.94 44.29% 11439.23 9413 13500 11439.47 9802 13125 148051 148051 0.00
glance 6.98 23.90% 4206.33 3530 5062 4204.24 0 5062 29379 29379 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 8.0 45.58sec 0 0 0 0 0 42.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.63 57.86% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.37 42.14% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:5.60
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 300.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 10505 / 948
claw 4796 0.4% 13.0 26.59sec 14781 9603 10311 20667 14781 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5392 0.0000 191855.08 191855.08 0.00 9602.84 9602.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.38 56.83% 10310.63 5991 17269 10328.41 5991 15507 76058 76058 0.00
crit 5.60 43.17% 20666.53 11982 34538 20679.65 0 34538 115797 115797 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5709 0.5% 29.3 11.27sec 7806 5900 5451 11442 7806 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.25 29.25 0.00 0.00 1.3232 0.0000 228356.68 228356.68 0.00 5899.77 5899.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.29 31.75% 5451.22 4707 6750 5447.64 4707 6750 50636 50636 0.00
crit 12.96 44.31% 11442.26 9413 13500 11443.28 9593 13500 148299 148299 0.00
glance 7.00 23.94% 4201.21 3530 5062 4200.06 0 5062 29422 29422 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 10491 / 947
cackling_howl 0 0.0% 2.0 300.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:63.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 4793 0.4% 13.0 26.60sec 14769 9595 10310 20666 14769 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 191718.58 191718.58 0.00 9594.56 9594.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.39 56.95% 10310.23 5991 17269 10322.06 5991 17269 76218 76218 0.00
crit 5.59 43.05% 20665.63 11982 34538 20641.29 0 34538 115500 115500 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5698 0.5% 29.2 11.27sec 7797 5888 5446 11445 7797 44.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.23 29.23 0.00 0.00 1.3241 0.0000 227907.78 227907.78 0.00 5888.48 5888.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.28 31.74% 5445.84 4707 6750 5443.29 4707 6750 50517 50517 0.00
crit 12.91 44.18% 11445.36 9413 13500 11446.01 9813 13083 147797 147797 0.00
glance 7.04 24.09% 4203.51 3530 5062 4200.54 0 5062 29593 29593 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 10495 / 948
claw 4793 0.4% 13.0 26.60sec 14771 9596 10327 20625 14771 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 0.00 0.00 1.5393 0.0000 191716.41 191716.41 0.00 9595.90 9595.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.38 56.85% 10326.67 5991 17269 10347.18 5991 16387 76194 76194 0.00
crit 5.60 43.15% 20625.26 11982 34538 20640.20 0 34538 115522 115522 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5702 0.5% 29.2 11.29sec 7800 5893 5448 11435 7800 44.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.24 29.24 0.00 0.00 1.3237 0.0000 228082.16 228082.16 0.00 5892.68 5892.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.27 31.69% 5448.23 4707 6750 5445.33 4707 6750 50478 50478 0.00
crit 12.95 44.27% 11435.00 9413 13500 11436.74 9685 13330 148027 148027 0.00
glance 7.03 24.04% 4207.31 3530 5062 4206.40 0 5062 29577 29577 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 16893 / 7846
dire_beast_melee 16893 7.4% 141.4 3.10sec 25004 15030 19951 40541 25004 30.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.42 141.42 0.00 0.00 1.6636 0.0000 3536063.51 3536063.51 0.00 15029.87 15029.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.63 45.70% 19950.73 18918 26183 19955.80 19206 20848 1289511 1289511 0.00
crit 42.79 30.26% 40540.65 37836 52367 40559.92 38426 43405 1734674 1734674 0.00
glance 34.00 24.04% 15057.24 14188 19638 15061.89 14295 16646 511879 511879 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
beast_within 8.4 0.0 56.7sec 56.7sec 29.30% 28.55%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_beast_within
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • beast_within_1:29.3%

Spelldata details

  • id:34471
  • name:The Beast Within
  • tooltip:Enraged.
  • description:When your pet is under the effects of Bestial Wrath, you also go into a rage causing $34471s2% additional damage and reducing Focus costs of all your shots and abilities by $34471s1% for $19574d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.02% 14.02%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.11%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 15.1 4.2 28.7sec 22.1sec 23.90% 29.62%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • cobra_strikes_1:12.2%
  • cobra_strikes_2:8.4%
  • cobra_strikes_3:2.2%
  • cobra_strikes_4:0.8%
  • cobra_strikes_5:0.2%
  • cobra_strikes_6:0.1%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:$@spelldesc53260
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
focus_fire 9.4 0.3 45.7sec 44.3sec 41.77% 38.92%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • focus_fire_1:41.8%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 11.3 0.0 41.6sec 41.6sec 24.74% 24.07%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.7%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 4.0 0.0 105.7sec 105.7sec 13.04% 11.52%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:13.0%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 6.8 0.0 68.9sec 68.9sec 22.32% 22.32%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:22.3%
terror_in_the_mists 7.3 0.0 65.4sec 65.4sec 31.70% 31.70%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:31.7%
virmens_bite_potion 2.0 0.0 395.4sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-bestial_wrath 6.9 0.0 70.3sec 70.3sec 24.07% 24.22%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:16.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bestial_wrath_1:24.1%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
  • max_stacks:
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
cat-frenzy_effect 11.2 41.0 41.4sec 8.6sec 81.60% 83.07%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:20.5%
  • frenzy_effect_2:20.3%
  • frenzy_effect_3:19.9%
  • frenzy_effect_4:19.5%
  • frenzy_effect_5:1.4%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
cat-rabid 3.2 0.0 169.2sec 169.3sec 14.10% 14.53%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:14.1%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-frenzy_effect 1.9 3.2 300.5sec 68.8sec 75.78% 73.55%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.0%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-frenzy_effect 1.9 3.3 300.6sec 68.6sec 76.02% 73.78%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.0%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-frenzy_effect 1.9 3.3 300.6sec 67.8sec 76.43% 74.17%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-frenzy_effect 1.9 3.3 300.6sec 68.2sec 76.06% 73.81%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.2%
  • frenzy_effect_2:2.2%
  • frenzy_effect_3:1.1%
  • frenzy_effect_4:0.3%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 300.8sec 300.8sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 300.7sec 300.7sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
aspect_of_the_hawk

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T14H
arcane_shot Focus 129.4 2587.6 20.0 20.0 2214.4
glaive_toss Focus 29.3 372.3 12.7 12.7 7882.4
kill_command Focus 63.8 2153.0 33.7 33.7 3507.5
serpent_sting Focus 3.4 64.8 18.9 18.9 21024.3
pet - cat
claw Focus 130.3 4248.4 32.6 32.6 1238.2
pet - devilsaur
claw Focus 13.0 474.5 36.6 36.6 404.3
pet - raptor
claw Focus 13.0 474.5 36.6 36.6 404.3
pet - hyena
claw Focus 13.0 474.5 36.6 36.6 404.0
pet - wolf
claw Focus 13.0 474.5 36.6 36.6 404.1
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.91 2317.32 1.29 11.27 0.48%
invigoration Focus 27.27 534.19 19.59 11.28 2.07%
cobra_shot Focus 110.99 1552.19 13.98 1.73 0.11%
dire_beast Focus 141.42 706.34 4.99 0.75 0.11%
pet - cat
focus_regen Focus 1801.91 2910.70 1.62 0.04 0.00%
focus_fire Focus 9.66 289.82 30.00 0.00 0.00%
go_for_the_throat Focus 63.65 954.74 15.00 0.04 0.00%
pet - devilsaur
focus_regen Focus 160.00 254.15 1.59 0.23 0.09%
pet - raptor
focus_regen Focus 160.00 254.15 1.59 0.23 0.09%
pet - hyena
focus_regen Focus 160.00 254.15 1.59 0.23 0.09%
pet - wolf
focus_regen Focus 160.00 254.15 1.59 0.23 0.09%
Resource RPS-Gain RPS-Loss
Focus 11.34 11.49
Combat End Resource Mean Min Max
Health 460843.00 460843.00 460843.00
Focus 52.71 1.46 120.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.3%
cat-Focus Cap 0.3%
raptor-Focus Cap 0.3%
wolf-Focus Cap 0.3%
dire_beast-Focus Cap 0.3%

Procs

Count Interval
invigoration 27.3 16.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 106330.85
Minimum 99203.55
Maximum 114615.30
Spread ( max - min ) 15411.75
Range [ ( max - min ) / 2 * 100% ] 7.25%
Standard Deviation 1966.7199
5th Percentile 103220.41
95th Percentile 109692.28
( 95th Percentile - 5th Percentile ) 6471.86
Mean Distribution
Standard Deviation 19.6672
95.00% Confidence Intervall ( 106292.30 - 106369.40 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1314
0.1 Scale Factor Error with Delta=300 33019
0.05 Scale Factor Error with Delta=300 132077
0.01 Scale Factor Error with Delta=300 3301936
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 106330.85

Damage

Sample Data
Count 10000
Mean 20690633.14

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 407.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 1.00 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 9.66 focus_fire,five_stacks=1
D 3.43 serpent_sting,if=!ticking
E 4.28 blood_fury
F 0.00 fervor,if=enabled&!ticking&focus<=65
G 8.42 bestial_wrath,if=focus>60&!buff.beast_within.up
H 0.00 multi_shot,if=target.adds>5
I 0.00 cobra_shot,if=target.adds>5
J 15.31 kill_shot
K 0.00 a_murder_of_crows,if=enabled&!ticking
L 2.00 stampede
M 29.33 glaive_toss,if=enabled
N 0.00 barrage,if=enabled
O 0.00 powershot,if=enabled
P 0.00 blink_strike,if=enabled
Q 6.35 lynx_rush,if=enabled&!ticking
R 4.04 rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
S 63.85 kill_command
T 15.48 dire_beast,if=enabled&focus<=80
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 1.58 readiness,wait_for_rapid_fire=1
W 129.38 arcane_shot,if=focus>=69|buff.beast_within.up
X 0.00 focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
Y 111.47 cobra_shot

Sample Sequence

8ADEGLMQSWWWWWSWWTWWDMSWWWWWSYYWWYSCMYYWSYYWWYRSTVGMQSTWWWWSWWWWWYDMRYYSYYYCWSYYWWMSTYYWWSYWWWYMSYYWWSYYCGWSMWTWWSWWWYWESWYMYYSYYYSYQWCMSTYYWWSYYWWWSMYYYSYYWGWSWWMWTSYWWWWYSYYCMSYYWWYSYYWWYMSTYYWSYYCWSWMWYYSYWGQWWSWWWMTSWYEWWYRYSYYWCMSYYWWYSYYWWWSMTYWWSYYWWSYYMWSYYCGWSWWWYWMTLSWYWWYSYWWWMSYYQWSYWWYSMTYYSYWWYSYWMWYSYGWWWWCSJJWEMTSWWWWYDJJSYYMYSYJJYSY7YWWMJJSCTYYWSYJJWMSQWGWWWSJJYWWYMSWWJJRTVJMCQGSTWWWWJJDSWW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22364 19934 18773
Stamina 22460 20418 20266
Intellect 191 182 80
Spirit 195 195 80
Health 460843 432255 0
Focus 120 120 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2575
Spell Crit 11.78% 6.78% 4056
Spell Haste 11.77% 6.45% 2741
Mana Per 5 0 0 0
Attack Power 49377 40028 0
Melee Hit 7.57% 7.57% 2575
Melee Crit 27.99% 21.06% 4056
Melee Haste 6.45% 6.45% 2741
Swing Speed 17.09% 6.45% 2741
Expertise 7.52% 7.52% 2556
Armor 25344 25344 25344
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 45.78% 35.78% 5933

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_BM_T14H"
origin="unknown"
level=90
race=orc
spec=beast_mastery
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/focus_fire,five_stacks=1
actions+=/serpent_sting,if=!ticking
actions+=/blood_fury
actions+=/fervor,if=enabled&!ticking&focus<=65
actions+=/bestial_wrath,if=focus>60&!buff.beast_within.up
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/kill_shot
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/stampede
actions+=/glaive_toss,if=enabled
actions+=/barrage,if=enabled
actions+=/powershot,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/dire_beast,if=enabled&focus<=80
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=69|buff.beast_within.up
actions+=/focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
hands=yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
waist=fetters_of_death,id=87034,gems=320agi_320agi_160agi
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
finger1=painful_thorned_ring,id=86974,enchant=160agi
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit

# Gear Summary
# gear_strength=80
# gear_agility=18773
# gear_stamina=20266
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2556
# gear_hit_rating=2575
# gear_crit_rating=4056
# gear_haste_rating=2741
# gear_mastery_rating=5933
# gear_armor=25344
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_MM_T14H : 101720 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
101720.3 101720.3 35.87 / 0.04% 3013 / 3.0% 6012.7 12.0 11.9 Focus 0.00% 57.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

Charts

http://3.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:600974|293989|177719|109118|96318|96015|47017|41537|14471|11354&chds=0,1201949&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,C79C6E&chm=t++600974++stampede,C79C6E,0,0,15|t++293989++lynx_rush,C79C6E,1,0,15|t++177719++dire_beast,C79C6E,2,0,15|t++109118++kill_shot,C79C6E,3,0,15|t++96318++glaive_toss,C79C6E,4,0,15|t++96015++chimera_shot,ABD473,5,0,15|t++47017++aimed_shot,C79C6E,6,0,15|t++41537++arcane_shot,69CCF0,7,0,15|t++14471++ranged,C79C6E,8,0,15|t++11354++steady_shot,C79C6E,9,0,15&chtt=Hunter_MM_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,13,13,13,12,9,9,8,7,6,6,6,5,5,4,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=ranged|cat: melee|chimera_shot|arcane_shot|wild_quiver_shot|glaive_toss|dire_beast: dire_beast_melee|cat: claw|aimed_shot|cat: lynx_rush|steady_shot|aimed_shot_mm|piercing_shots|kill_shot|serpent_sting|hyena: melee|raptor: melee|wolf: melee|devilsaur: melee|hyena: claw|raptor: claw|wolf: claw|devilsaur: claw&chtt=Hunter_MM_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:232211432345785431xwvrponmkhhgebbZZYYYYYYYYYYYYYYXXXXXXWWWWWWWWWWWWWWXXXXXXYYYYYYXXXXXXXXXXYXXXXWWWWWXXXXXXXXWWVVVVVVVVVVVVWWWXXXXXYYYYZZZZZZZZYYYXXXWWWWVVVVVVVVVVVVVVVVVVVWVVVVVVVWWWWWWWWWWWXXXXXXYYYXXXXXXXXXWWWWWWVVVVVVVVVVVVVWWWWXXYXYYYYYYXXXXXYXYYYXXXXXXXXXXXXXYYYYYYYYYYYYYYYYYYYYXXXXXXWWWWWWWXXXXXXXXYYYYYZZaaaaaaaaaaaaaaaaaaZZZYYXYXXXXXXXXXXXXXXXXXYYYZZabcccccccccccccccccbbaZZYYYYZZZZZZZZZZZZabcccdccccccccddeeeeedcbbaaabbbbbbbbaZZZZaaaaabbaaaaaaaaaaaaaaZZaaaaaaaaaaaaaabccccdcccbbcccdddeedddccccccbcccccbaaZZYYYYYZZYYYYYYYYYYYYYYYYXXXXWWWWWWWVVUU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=101720|max=234460&chxp=1,1,43,100&chtt=Hunter_MM_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,1,1,5,9,20,19,28,40,58,91,109,204,221,288,332,404,464,491,559,613,574,606,574,571,600,544,479,418,326,285,253,192,165,126,97,74,60,30,19,20,7,8,4,5,2,0,1,1&chds=0,613&chbh=5&chxt=x&chxl=0:|min=94915|avg=101720|max=109165&chxp=0,1,48,100&chtt=Hunter_MM_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.5,22.6,11.4,10.1,6.9,3.6,3.3,1.6,0.5,0.3,0.2&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473&chl=steady_shot 178.2s|arcane_shot 101.9s|aimed_shot 51.4s|chimera_shot 45.4s|glaive_toss 31.1s|dire_beast 16.4s|kill_shot 14.9s|lynx_rush 7.1s|stampede 2.1s|serpent_sting 1.2s|aspect_of_the_hawk 1.0s&chtt=Hunter_MM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_MM_T14H 101720
aimed_shot 5364 5.3% 21.8 17.31sec 110678 47017 68917 150365 110797 51.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.84 21.82 0.00 0.00 2.3540 0.0000 2417231.37 2417231.37 0.00 47016.87 47016.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.60 48.58% 68916.84 68398 76184 68888.98 68398 72291 730422 730422 0.00
crit 11.22 51.42% 150364.98 140899 161611 150714.78 145641 160677 1686809 1686809 0.00
DPS Timeline Chart

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.master_marksman_fire.react
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6602.39
  • base_dd_max:7356.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
aimed_shot_mm 4448 4.4% 21.1 20.43sec 95019 0 69523 144146 95174 34.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.11 21.08 0.00 0.00 0.0000 0.0000 2005854.92 2005854.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.83 65.63% 69523.20 68398 78452 69521.80 68398 71061 961575 961575 0.00
crit 7.24 34.37% 144145.92 140899 161611 144089.03 0 156939 1044280 1044280 0.00
DPS Timeline Chart

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:82928
  • name:Aimed Shot!
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6598.90
  • base_dd_max:7359.64
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
arcane_shot 9389 9.2% 98.3 3.89sec 43053 41537 31849 65790 43142 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.28 98.07 0.00 0.00 1.0365 0.0000 4231020.07 4231020.07 0.00 41537.19 41537.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.44 66.73% 31849.16 31163 36501 31851.34 31425 32374 2084225 2084225 0.00
crit 32.63 33.27% 65790.46 64195 75192 65795.54 64195 67706 2146795 2146795 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
blood_fury 0 0.0% 4.3 120.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
chimera_shot 9667 9.5% 43.8 9.75sec 99516 96015 73995 152903 99745 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.77 43.67 0.00 0.00 1.0365 0.0000 4356102.68 4356102.68 0.00 96014.96 96014.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.42 67.37% 73994.62 72436 85328 73998.36 72815 75382 2176959 2176959 0.00
crit 14.25 32.63% 152903.07 149217 175775 152928.59 149217 159216 2179144 2179144 0.00
DPS Timeline Chart

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:9.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=90
Spelldata
  • id:53209
  • name:Chimera Shot
  • school:nature
  • tooltip:(null)
  • description:An instant shot that causes $s3% ranged weapon Nature damage plus $<damage>, refreshing the duration of your Serpent Sting and healing you for $?s119447[${$53353m1+$119447m1}][$53353m1]% of your total health.$?s53243[ Applies the Hunter's Mark effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.10
dire_beast 0 (6482) 0.0% (6.4%) 15.8 29.15sec 184200 177719 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.83 15.83 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 177719.07 177719.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
glaive_toss 6660 6.5% 30.0 15.21sec 99832 96318 36972 76765 50151 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.04 59.80 0.00 0.00 1.0365 0.0000 2999241.09 2999241.09 0.00 96317.84 96317.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.00 66.88% 36971.86 34711 49074 36982.19 35538 38473 1478764 1478764 0.00
crit 19.81 33.12% 76765.43 71504 101093 76812.32 71504 84028 1520478 1520478 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3603 3.5% 14.4 5.86sec 113102 109118 84282 174416 114279 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.37 14.22 0.00 0.00 1.0365 0.0000 1624875.27 1624875.27 0.00 109117.94 109117.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.49 66.72% 84281.80 80871 95953 84330.66 80871 89234 799539 799539 0.00
crit 4.73 33.28% 174415.88 166594 197662 173896.86 0 197662 825336 825336 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4647) 0.0% (4.6%) 6.9 70.26sec 304708 293989 0 0 0 0.0% 0.0% 0.0% 0.0% 61.4 0 0 0 16.0% 0.0% 6.1%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 61.41 61.41 1.0365 0.4442 0.00 0.00 0.00 60743.95 293989.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.6 83.97% 0.00 0 0 0.00 0 0 0 0 0.00
crit 9.8 16.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
piercing_shots 3947 3.9% 81.5 5.38sec 21829 0 0 0 0 0.0% 0.0% 0.0% 0.0% 344.1 5173 0 5173 0.0% 0.0% 76.4%

Stats details: piercing_shots

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.53 81.53 344.08 344.08 0.0000 1.0000 1779824.20 1779824.20 0.00 5172.69 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 344.1 100.00% 5172.69 801 25390 5171.59 3513 7107 1779824 1779824 0.00
DPS Timeline Chart

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:63468
  • name:Piercing Shots
  • school:physical
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed for $53238s1% of the damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:846.99
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ranged 13002 12.8% 213.1 2.10sec 27499 14471 20343 42090 27499 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 213.07 213.07 0.00 0.00 1.9002 0.0000 5859191.06 5859191.06 0.00 14471.35 14471.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.96 67.09% 20342.64 19826 23673 20344.94 20109 20568 2908171 2908171 0.00
crit 70.11 32.91% 42089.72 40841 48766 42096.96 41438 42881 2951020 2951020 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.3 107.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.32 4.32 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up|target.time_to_die<=30
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.7 401.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.70 1.70 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 2869 2.8% 1.2 210.01sec 1091620 1053364 0 0 0 0.0% 0.0% 0.0% 0.0% 140.6 6818 14126 9196 32.5% 0.0% 93.6%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 1.18 140.55 140.55 1.0363 3.0000 1292477.79 1292477.79 0.00 3056.31 1053364.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.8 67.47% 6818.41 6562 8697 6819.25 6681 6997 646612 646612 0.00
crit 45.7 32.53% 14126.34 13517 17916 14129.00 13706 14766 645866 645866 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.health.pct<=90
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (2812) 0.0% (2.7%) 2.0 301.13sec 622910 600974 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 600974.32 600974.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
steady_shot 4488 4.4% 138.7 3.16sec 14587 11354 10559 22044 14613 35.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.67 138.43 0.00 0.00 1.2848 0.0000 2022786.24 2022786.24 0.00 11353.63 11353.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.56 64.70% 10558.78 10365 12161 10558.97 10460 10660 945693 945693 0.00
crit 48.86 35.30% 22043.89 21353 25051 22052.14 21729 22587 1077093 1077093 0.00
DPS Timeline Chart

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $m1. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1994.08
  • base_dd_max:1994.08
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
wild_quiver_shot 8828 8.7% 189.5 2.35sec 20994 0 15794 31740 21035 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.47 189.10 0.00 0.00 0.0000 0.0000 3977773.78 3977773.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.95 67.13% 15793.85 15402 18274 15795.56 15602 16006 2004999 2004999 0.00
crit 62.15 32.87% 31740.06 30803 36549 31745.76 31084 32477 1972775 1972775 0.00
DPS Timeline Chart

Action details: wild_quiver_shot

Static Values
  • id:76663
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:45.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76663
  • name:Wild Quiver
  • school:physical
  • tooltip:(null)
  • description:Deals ranged weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
pet - cat 20161 / 20161
claw 5755 5.7% 128.4 3.52sec 20174 13130 13956 28520 20174 42.9% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 128.38 128.38 0.00 0.00 1.5365 0.0000 2589934.10 2589934.10 0.00 13129.81 13129.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.88 56.77% 13955.51 10982 47281 13967.40 12076 16040 1017106 1017106 0.00
crit 55.07 42.90% 28519.76 21963 94562 28564.57 23754 34528 1570583 1570583 0.00
block 0.11 0.09% 19869.39 10982 47281 2128.54 0 47281 2245 2245 0.00
parry 0.31 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4647 4.6% 61.4 6.88sec 34009 0 23958 49822 34009 42.3% 3.8% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.41 61.41 0.00 0.00 0.0000 0.0000 2088498.45 2088498.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.32 52.62% 23958.13 17391 36962 23983.72 18742 30188 774216 774216 0.00
crit 26.00 42.33% 49821.63 34782 73924 49902.52 37086 65448 1295243 1295243 0.00
block 0.79 1.29% 24048.59 17391 36962 13103.98 0 36962 19039 19039 0.00
parry 2.31 3.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9758 9.6% 313.1 1.44sec 14030 9764 10085 20640 14030 43.1% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.09 313.09 0.00 0.00 1.4369 0.0000 4392698.83 4392698.83 0.00 9764.48 9764.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.34 32.69% 10084.76 8695 18481 10087.11 9348 11316 1032079 1032079 0.00
crit 134.86 43.08% 20640.49 17391 36962 20655.12 19283 22385 2783616 2783616 0.00
glance 75.06 23.97% 7669.39 6522 13861 7673.55 6905 8566 575635 575635 0.00
block 0.12 0.04% 11834.69 8695 18481 1294.89 0 18481 1369 1369 0.00
parry 0.71 0.23% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7777 / 702
claw 3719 0.3% 14.0 24.71sec 10633 6909 7017 14874 10633 46.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.99 0.00 0.00 1.5391 0.0000 148769.87 148769.87 0.00 6908.60 6908.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.55 53.98% 7016.55 4097 11820 7005.43 4097 11215 52989 52989 0.00
crit 6.44 46.02% 14874.42 8194 23640 14908.57 0 23640 95781 95781 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4058 0.4% 30.0 11.00sec 5411 4184 3696 7762 5411 47.1% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 162317.53 162317.53 0.00 4184.09 4184.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.58 28.61% 3696.07 3219 4620 3694.29 3219 4620 31726 31726 0.00
crit 14.14 47.15% 7762.03 6437 9241 7764.08 6550 8892 109792 109792 0.00
glance 7.27 24.24% 2860.38 2414 3465 2859.25 0 3465 20799 20799 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.84sec 0 0 0 0 0 45.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.29 54.88% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.71 45.12% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 301.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7790 / 703
claw 3723 0.3% 14.0 24.70sec 10645 6916 7012 14882 10645 46.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.99 0.00 0.00 1.5391 0.0000 148938.63 148938.63 0.00 6916.44 6916.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.53 53.84% 7012.12 4097 11820 7001.15 4097 11144 52818 52818 0.00
crit 6.46 46.16% 14881.88 8194 23640 14910.91 8194 23640 96121 96121 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4066 0.4% 30.0 11.00sec 5422 4193 3696 7765 5422 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 162651.74 162651.74 0.00 4192.70 4192.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.60 28.66% 3696.30 3219 4620 3694.11 3219 4620 31776 31776 0.00
crit 14.21 47.36% 7764.54 6437 9241 7765.77 6561 9030 110308 110308 0.00
glance 7.20 23.99% 2857.96 2414 3465 2857.22 0 3465 20568 20568 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7794 / 704
cackling_howl 0 0.0% 2.0 301.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3725 0.3% 14.0 24.70sec 10650 6920 7015 14873 10650 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.99 0.00 0.00 1.5391 0.0000 149005.91 149005.91 0.00 6919.56 6919.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.52 53.74% 7015.39 4097 11820 7005.46 0 10611 52751 52751 0.00
crit 6.47 46.26% 14872.54 8194 23640 14907.07 0 23640 96255 96255 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4068 0.4% 30.0 11.00sec 5425 4195 3694 7763 5425 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 162736.42 162736.42 0.00 4194.89 4194.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.56 28.53% 3693.96 3219 4620 3691.29 0 4620 31621 31621 0.00
crit 14.23 47.45% 7763.03 6437 9241 7763.94 6437 9017 110504 110504 0.00
glance 7.21 24.02% 2860.61 2414 3465 2860.18 0 3465 20611 20611 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7785 / 703
claw 3722 0.3% 14.0 24.70sec 10640 6913 7018 14870 10640 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.99 13.99 0.00 0.00 1.5391 0.0000 148867.71 148867.71 0.00 6913.15 6913.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.54 53.87% 7017.57 4097 11820 7012.41 4097 11820 52890 52890 0.00
crit 6.45 46.13% 14869.89 8194 23640 14919.44 0 23640 95978 95978 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4063 0.4% 30.0 11.00sec 5418 4190 3695 7763 5418 47.3% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2931 0.0000 162531.95 162531.95 0.00 4189.62 4189.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.60 28.66% 3694.93 3219 4620 3691.29 3219 4620 31772 31772 0.00
crit 14.18 47.28% 7763.38 6437 9241 7764.68 6692 9011 110117 110117 0.00
glance 7.22 24.06% 2860.29 2414 3465 2859.34 0 3465 20643 20643 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13420 / 6482
dire_beast_melee 13420 6.4% 161.6 2.76sec 18035 11584 13842 28382 18035 34.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 161.64 161.64 0.00 0.00 1.5569 0.0000 2915125.91 2915125.91 0.00 11584.19 11584.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.19 41.57% 13841.72 12942 17925 13848.19 13251 14690 929998 929998 0.00
crit 55.55 34.37% 28382.29 25884 35851 28396.72 26765 30506 1576662 1576662 0.00
glance 38.90 24.07% 10500.70 9707 13444 10506.98 9798 11323 408467 408467 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.7sec 120.7sec 14.07% 14.07%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.96%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 11.3 0.0 41.4sec 41.4sec 24.90% 23.84%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.9%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
master_marksman 21.9 42.7 20.2sec 6.7sec 56.02% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_1:28.2%
  • master_marksman_2:27.8%

Spelldata details

  • id:82925
  • name:Ready, Set, Aim...
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
master_marksman_fire 21.2 0.0 20.4sec 20.4sec 7.82% 6.59%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman_fire
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_fire_1:7.8%

Spelldata details

  • id:82926
  • name:Fire!
  • tooltip:Aimed Shot cast time and Focus cost reduced by $s1%.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
rapid_fire 4.3 0.0 107.8sec 107.8sec 14.00% 18.13%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:14.0%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 7.2 0.0 65.7sec 65.7sec 23.57% 23.57%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.6%
steady_focus 17.4 33.5 26.0sec 8.7sec 90.02% 87.34%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • steady_focus_1:90.0%

Spelldata details

  • id:53220
  • name:Steady Focus
  • tooltip:Ranged attack speed increased by $w1%. Steady Shot Focus generation increased by $w2.
  • description:$@spelldesc53224
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
terror_in_the_mists 7.4 0.0 64.5sec 64.5sec 32.12% 32.12%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.1%
virmens_bite_potion 2.0 0.0 395.4sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-rabid 4.3 0.0 120.6sec 120.7sec 18.69% 22.19%

Buff details

  • buff initial source:Hunter_MM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:18.7%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 301.1sec 301.1sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 301.1sec 301.1sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 301.1sec 301.1sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 301.1sec 301.1sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
aspect_of_the_hawk

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T14H
aimed_shot Focus 21.8 1000.7 45.8 45.8 2415.5
arcane_shot Focus 98.3 1965.5 20.0 20.0 2152.6
chimera_shot Focus 43.8 1969.8 45.0 45.0 2211.5
glaive_toss Focus 30.0 450.6 15.0 15.0 6655.5
serpent_sting Focus 1.2 29.6 25.0 25.0 43664.8
pet - cat
claw Focus 128.4 3436.9 26.8 26.8 753.6
pet - devilsaur
claw Focus 14.0 521.6 37.3 37.3 285.2
pet - raptor
claw Focus 14.0 521.6 37.3 37.3 285.6
pet - hyena
claw Focus 14.0 521.6 37.3 37.3 285.7
pet - wolf
claw Focus 14.0 521.6 37.3 37.3 285.4
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.91 2610.78 1.45 73.01 2.72%
rapid_recuperation Focus 254.63 64.05 0.25 7.25 10.17%
steady_shot Focus 138.43 1916.64 13.85 21.33 1.10%
dire_beast Focus 161.64 771.79 4.77 36.40 4.50%
pet - cat
focus_regen Focus 1801.91 3354.74 1.86 0.00 0.00%
pet - devilsaur
focus_regen Focus 160.00 347.10 2.17 0.25 0.07%
pet - raptor
focus_regen Focus 160.00 347.10 2.17 0.24 0.07%
pet - hyena
focus_regen Focus 160.00 347.09 2.17 0.25 0.07%
pet - wolf
focus_regen Focus 160.00 347.09 2.17 0.25 0.07%
Resource RPS-Gain RPS-Loss
Focus 11.90 12.02
Combat End Resource Mean Min Max
Health 461207.00 461207.00 461207.00
Focus 48.08 1.74 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 1.2%
cat-Focus Cap 1.2%
raptor-Focus Cap 1.2%
wolf-Focus Cap 1.2%
dire_beast-Focus Cap 1.2%

Procs

Count Interval
wild_quiver 189.5 2.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 101720.26
Minimum 94914.76
Maximum 109164.77
Spread ( max - min ) 14250.01
Range [ ( max - min ) / 2 * 100% ] 7.00%
Standard Deviation 1830.0348
5th Percentile 98789.90
95th Percentile 104815.65
( 95th Percentile - 5th Percentile ) 6025.75
Mean Distribution
Standard Deviation 18.3003
95.00% Confidence Intervall ( 101684.39 - 101756.13 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1243
0.1 Scale Factor Error with Delta=300 28589
0.05 Scale Factor Error with Delta=300 114356
0.01 Scale Factor Error with Delta=300 2858922
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 101720.26

Damage

Sample Data
Count 10000
Mean 32566378.46

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 429.46
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 22.84 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 4.30 blood_fury
D 30.04 glaive_toss,if=enabled
E 0.00 powershot,if=enabled
F 0.00 barrage,if=enabled
G 0.00 blink_strike,if=enabled
H 6.85 lynx_rush,if=enabled&!ticking
I 0.00 multi_shot,if=target.adds>5
J 0.00 steady_shot,if=target.adds>5
K 1.18 serpent_sting,if=!ticking&target.health.pct<=90
L 43.77 chimera_shot,if=target.health.pct<=90
M 15.83 dire_beast,if=enabled
N 2.00 stampede
O 4.32 rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
P 1.70 readiness,wait_for_rapid_fire=1
Q 30.19 steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
R 14.37 kill_shot
S 18.27 aimed_shot,if=buff.master_marksman_fire.react
T 0.00 a_murder_of_crows,if=enabled&!ticking
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 24.71 aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
W 98.28 arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
X 0.00 fervor,if=enabled&focus<=50
Y 108.80 steady_shot

Sample Sequence

8ACDHMNOPDHMVAVAYQVAVAYYVAVAYDYVAYQVAYYVASVAVAYDYMQVAVAYYKLOSYYVADYVAYYLYVASVAYQWDLMWWYQYWLWWWYDYQLWWYYYSWLHDWMYQYLWWWYYWWDLYWWSYCQYLWWYDMSYQLWWWYYYWDLSWWYQYWLWWYYDMYLWWWYQYWLSWDYQYWLWWYYHYWDLMSWYQWWYLWWWDYQYLSWWYYYYLDWMYYOVAVAYYLYYVAVAYDVCYLWYQYYWWLWMDYQYWLSWWYQWWWDYLWYQHYWWLYMQDSWYLWWWYQYWLWDNYQYWLSWWYMQYDLWWWYQYWLWWWYDYQLSWWYYMYLWDWYQYWLSRRCWYQWDLWHWRRYQMLWWWYDRRYLWS7WYQYRLDRWYQWWYLMOPDHLMRRVAYQSLVAYVADORRYQLVAYYVAYRRVADYMLWYQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.56% 22.56% 1965

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_MM_T14H"
origin="unknown"
level=90
race=orc
spec=marksmanship
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/blood_fury
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health.pct<=90
actions+=/chimera_shot,if=target.health.pct<=90
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
actions+=/fervor,if=enabled&focus<=50
actions+=/steady_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_SV_T14H : 103045 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
103045.3 103045.3 28.53 / 0.03% 2398 / 2.3% 7357.8 10.2 10.1 Focus 0.00% 53.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

Charts

http://3.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:565893|296057|191597|177804|109050|96042|71797|48337|20110|12411&chds=0,1131786&chco=C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++565893++stampede,C79C6E,0,0,15|t++296057++lynx_rush,C79C6E,1,0,15|t++191597++black_arrow,9482C9,2,0,15|t++177804++dire_beast,C79C6E,3,0,15|t++109050++kill_shot,C79C6E,4,0,15|t++96042++glaive_toss,C79C6E,5,0,15|t++71797++explosive_shot,C41F3B,6,0,15|t++48337++arcane_shot,69CCF0,7,0,15|t++20110++cobra_shot,ABD473,8,0,15|t++12411++ranged,C79C6E,9,0,15&chtt=Hunter_SV_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,17,13,13,11,9,9,8,8,6,6,5,0,0,0,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,C79C6E,C79C6E,69CCF0,9482C9,ABD473,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=explosive_shot|ranged|cat: melee|arcane_shot|black_arrow|serpent_sting|glaive_toss|dire_beast: dire_beast_melee|cobra_shot|cat: lynx_rush|cat: claw|kill_shot|devilsaur: melee|hyena: melee|raptor: melee|wolf: melee|wolf: claw|raptor: claw|devilsaur: claw|hyena: claw|serpent_sting_burst&chtt=Hunter_SV_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uxz2435555567875564420wvroolkihffeddcbabaaaZZYYYYYXXYXXWWWWWWWWWWXXXXWXXWXXXYYYZZZaaaZZZZZaaaaaaZZZYYYYXXYYYXYYYYYYZYYYYYYYXYYYYYZZZZZZZZZaaabbbbbaaZZYYYYYXXXXXXXWXWWWWWWWWWWWXXXXXXXYYYYYYZYZZZZZZZZYZZZZZZZaaabbbbbbbbbbaaaZZYYXXXWWWWWXXXXYYZZZZZZZZZZZZZZYYYYYYXXYXYYYZZZaaaabbbabaaaaaaaaaaaZZZYYXXXXXXYYZZZaaaaaabbbcccdddcccbbaabbbbbbbbbbbababbaaaaaaZZZYZZYYZZZabcdffggggggggfffffgfffeeeedeefffgghhhhhhhhgggfffffeeeeddddcccbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaabbbbcccccdddeeeeeeeeffggggghhhhhhhhhhhhhhgffeeddcccbbbbbbaaaaaaaaaaababbbabbbaaaaaZZZZYYZXXXXXXWWWVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=103045|max=220394&chxp=1,1,47,100&chtt=Hunter_SV_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,0,1,3,10,16,30,45,63,91,121,142,211,237,312,362,397,498,480,605,579,587,540,577,590,505,493,446,378,317,292,241,215,163,130,95,66,48,47,22,15,10,9,3,2,2,0,2&chds=0,605&chbh=5&chxt=x&chxl=0:|min=97659|avg=103045|max=108637&chxp=0,1,49,100&chtt=Hunter_SV_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.0,29.8,19.7,6.9,4.1,3.6,3.2,1.6,0.5,0.5,0.2&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,69CCF0,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473&chl=explosive_shot 135.1s|cobra_shot 134.5s|arcane_shot 88.6s|glaive_toss 31.0s|black_arrow 18.7s|dire_beast 16.0s|kill_shot 14.4s|lynx_rush 7.3s|serpent_sting 2.2s|stampede 2.1s|aspect_of_the_hawk 1.0s&chtt=Hunter_SV_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_SV_T14H 103045
arcane_shot 9505 9.2% 85.5 5.10sec 50100 48337 37075 76755 50225 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.47 85.26 0.00 0.00 1.0365 0.0000 4281948.67 4281948.67 0.00 48337.18 48337.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.00 66.86% 37075.36 36236 42444 37077.01 36577 37733 2113422 2113422 0.00
crit 28.25 33.14% 76754.96 74646 87434 76762.08 74971 79072 2168527 2168527 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus>=67
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 7937 7.7% 18.0 24.98sec 198586 191597 0 0 0 0.0% 0.0% 0.0% 0.0% 178.0 14794 30811 20084 33.0% 0.0% 79.0%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.01 18.01 178.04 178.04 1.0365 2.0000 3575770.89 3575770.89 0.00 9542.00 191596.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.2 66.97% 14793.64 13847 19899 14800.68 14142 15476 1763863 1763863 0.00
crit 58.8 33.03% 30810.83 28525 40993 30828.87 29047 32907 1811908 1811908 0.00
DPS Timeline Chart

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.time_to_die>=8
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over $3674d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:186.94
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
blood_fury 0 0.0% 4.3 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 5999 5.8% 84.9 5.06sec 31869 20110 23765 49108 31920 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.86 84.72 0.00 0.00 1.5847 0.0000 2704322.89 2704322.89 0.00 20110.38 20110.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.46 67.82% 23764.58 23296 27641 23765.62 23482 24105 1365444 1365444 0.00
crit 27.26 32.18% 49107.96 47990 56941 49111.90 47990 50697 1338879 1338879 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (6326) 0.0% (6.1%) 15.4 29.67sec 184292 177804 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.45 15.45 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 177803.51 177803.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
explosive_shot 21527 20.9% 130.3 3.42sec 74417 71797 18542 38628 25175 33.0% 0.0% 0.0% 0.0% 222.8 21559 43583 28829 33.0% 0.0% 49.4%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.33 130.09 222.82 222.82 1.0365 1.0000 9698912.51 9698912.51 0.00 27098.90 71797.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.13 66.98% 18541.97 17448 25074 18547.14 18070 19175 1615557 1615557 0.00
crit 42.96 33.02% 38627.71 35943 51652 38643.07 36527 41433 1659559 1659559 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.3 66.99% 21559.01 17448 50147 21563.68 20391 23527 3217945 3217945 0.00
crit 73.6 33.01% 43582.58 34896 93414 43599.97 39830 48270 3205852 3205852 0.00
DPS Timeline Chart

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(remains<2.0)
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.234000
  • base_dd_min:145.82
  • base_dd_max:437.45

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:false
  • direct_power_mod:0.234000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:31018.53
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
glaive_toss 6615 6.4% 29.9 15.24sec 99549 96042 36938 76841 50027 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.93 59.56 0.00 0.00 1.0365 0.0000 2979514.78 2979514.78 0.00 96042.12 96042.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.02 67.20% 36938.05 34711 49074 36948.86 35229 38528 1478334 1478334 0.00
crit 19.54 32.80% 76840.96 71504 101093 76887.54 71504 84056 1501180 1501180 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3477 3.4% 13.9 6.07sec 113019 109050 84268 174341 114390 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.87 13.71 0.00 0.00 1.0364 0.0000 1567817.00 1567817.00 0.00 109050.36 109050.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.12 66.56% 84267.72 80871 95953 84300.98 0 89563 768724 768724 0.00
crit 4.58 33.44% 174341.26 166594 197662 173692.07 0 197662 799093 799093 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4807) 0.0% (4.7%) 7.0 67.67sec 306831 296057 0 0 0 0.0% 0.0% 0.0% 0.0% 63.1 0 0 0 16.2% 0.0% 6.2%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 7.05 63.13 63.13 1.0364 0.4442 0.00 0.00 0.00 61163.09 296057.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.9 83.76% 0.00 0 0 0.00 0 0 0 0 0.00
crit 10.3 16.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 12349 12.0% 201.2 2.23sec 27652 12411 20395 42273 27652 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.16 201.16 0.00 0.00 2.2280 0.0000 5562497.84 5562497.84 0.00 12411.03 12411.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.43 66.83% 20394.76 19826 23673 20397.60 20173 20665 2741720 2741720 0.00
crit 66.73 33.17% 42273.28 40841 48766 42282.43 41570 43395 2820778 2820778 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 4.5 102.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.49 4.49 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
readiness 0 0.0% 1.8 381.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: readiness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.80 1.80 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: readiness

Static Values
  • id:23989
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:23989
  • name:Readiness
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on all Hunter abilities with a base cooldown less than 5 minutes.
serpent_sting 7081 (7318) 6.9% (7.1%) 2.1 112.98sec 1562016 1507163 0 0 0 0.0% 0.0% 0.0% 0.0% 147.7 15971 33164 21604 32.8% 0.0% 98.3%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.11 2.11 147.68 147.68 1.0364 3.0000 3190534.41 3190534.41 0.00 7403.19 1507163.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.11 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.3 67.24% 15970.81 15260 20226 15973.94 15632 16387 1585840 1585840 0.00
crit 48.4 32.76% 33163.81 31435 41665 33175.09 31919 34967 1604694 1604694 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:2
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
serpent_sting_burst 238 0.2% 2.1 112.98sec 50058 0 35144 72654 50058 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.11 2.11 0.00 0.00 0.0000 0.0000 105631.87 105631.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.27 60.24% 35144.10 29345 38894 29396.62 0 38894 44675 44675 0.00
crit 0.84 39.76% 72653.98 60450 80122 46692.98 0 80122 60957 60957 0.00
DPS Timeline Chart

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
stampede 0 (2649) 0.0% (2.5%) 2.0 302.24sec 586548 565893 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 565892.83 565892.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 19343 / 19343
claw 4791 4.6% 108.7 4.17sec 19822 12901 13684 28021 19822 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.72 108.72 0.00 0.00 1.5365 0.0000 2155044.60 2155044.60 0.00 12900.75 12900.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.60 56.66% 13683.69 10982 47281 13705.36 11756 15715 842981 842981 0.00
crit 46.77 43.01% 28021.33 21963 94562 28074.74 23777 33989 1310429 1310429 0.00
block 0.09 0.08% 18166.12 10982 47281 1563.64 0 47281 1635 1635 0.00
parry 0.26 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4807 4.7% 63.1 6.65sec 34242 0 24068 50089 34242 42.6% 3.8% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.13 63.13 0.00 0.00 0.0000 0.0000 2161809.27 2161809.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.04 52.33% 24068.27 17391 36962 24074.96 19944 28400 795129 795129 0.00
crit 26.88 42.58% 50089.25 34782 73924 50159.47 39492 62055 1346614 1346614 0.00
block 0.83 1.32% 24091.49 17391 36962 13540.81 0 36962 20066 20066 0.00
parry 2.38 3.77% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9746 9.5% 313.1 1.44sec 14013 9752 10080 20627 14013 43.0% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 313.08 313.08 0.00 0.00 1.4369 0.0000 4387092.47 4387092.47 0.00 9752.11 9752.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.33 32.68% 10080.24 8695 18481 10082.37 9242 11137 1031491 1031491 0.00
crit 134.65 43.01% 20626.62 17391 36962 20640.17 19369 22193 2777397 2777397 0.00
glance 75.23 24.03% 7667.08 6522 13861 7670.53 6953 8535 576812 576812 0.00
block 0.12 0.04% 11869.16 8695 18481 1306.65 0 18481 1392 1392 0.00
parry 0.75 0.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.3 120.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7332 / 662
claw 3355 0.3% 13.0 26.73sec 10323 6707 6798 14412 10323 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 134204.32 134204.32 0.00 6706.53 6706.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.98 53.70% 6798.48 4097 11820 6782.76 0 11820 47462 47462 0.00
crit 6.02 46.30% 14411.97 8194 23640 14441.12 0 23640 86743 86743 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3977 0.3% 30.0 11.05sec 5303 4137 3625 7581 5303 47.5% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159093.33 159093.33 0.00 4137.34 4137.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.51 28.35% 3624.54 3219 4620 3624.78 3219 4620 30827 30827 0.00
crit 14.25 47.50% 7580.99 6437 9241 7582.64 6582 8698 108021 108021 0.00
glance 7.25 24.15% 2794.01 2414 3465 2793.14 0 3465 20245 20245 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.78sec 0 0 0 0 0 45.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.27 54.44% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.73 45.56% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 302.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7332 / 662
claw 3357 0.3% 13.0 26.73sec 10330 6711 6808 14387 10330 46.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 134290.13 134290.13 0.00 6710.82 6710.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 53.53% 6807.59 4097 11820 6797.27 4097 11015 47372 47372 0.00
crit 6.04 46.47% 14387.33 8194 23640 14413.24 0 23640 86918 86918 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3975 0.3% 30.0 11.05sec 5300 4135 3623 7581 5300 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 158985.86 158985.86 0.00 4134.55 4134.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.59 28.63% 3623.08 3219 4620 3622.73 3219 4462 31115 31115 0.00
crit 14.21 47.37% 7581.24 6437 9241 7581.89 6643 8753 107735 107735 0.00
glance 7.20 24.00% 2796.18 2414 3465 2794.76 0 3465 20136 20136 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 302.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7331 / 662
cackling_howl 0 0.0% 2.0 302.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3353 0.3% 13.0 26.73sec 10318 6703 6815 14372 10318 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 134129.12 134129.12 0.00 6702.77 6702.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.97 53.65% 6814.98 4097 11820 6806.40 0 11820 47534 47534 0.00
crit 6.03 46.35% 14372.43 8194 23640 14401.73 0 23640 86595 86595 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3977 0.3% 30.0 11.05sec 5303 4137 3625 7578 5303 47.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 159091.99 159091.99 0.00 4137.31 4137.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.57 28.57% 3624.53 3219 4620 3624.49 3219 4620 31068 31068 0.00
crit 14.24 47.47% 7578.33 6437 9241 7578.98 6437 8750 107923 107923 0.00
glance 7.19 23.96% 2796.69 2414 3465 2796.59 0 3465 20101 20101 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 302.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7333 / 662
claw 3358 0.3% 13.0 26.73sec 10333 6713 6804 14397 10333 46.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5393 0.0000 134326.95 134326.95 0.00 6712.66 6712.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.96 53.52% 6803.53 4097 11820 6796.16 4097 11820 47336 47336 0.00
crit 6.04 46.48% 14396.59 8194 23640 14424.93 0 23640 86991 86991 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 3974 0.3% 30.0 11.05sec 5299 4134 3623 7583 5299 47.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 1.2818 0.0000 158974.12 158974.12 0.00 4134.25 4134.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.57 28.57% 3622.71 3219 4620 3622.62 3219 4431 31049 31049 0.00
crit 14.21 47.36% 7582.68 6437 9241 7583.85 6561 8659 107742 107742 0.00
glance 7.22 24.07% 2795.29 2414 3465 2795.25 0 3465 20183 20183 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 302.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 13640 / 6326
dire_beast_melee 13640 6.1% 158.1 2.80sec 18005 11552 13825 28234 18005 34.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 158.11 158.11 0.00 0.00 1.5585 0.0000 2846811.95 2846811.95 0.00 11552.49 11552.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.45 41.39% 13825.41 12942 17925 13830.46 13291 14572 904822 904822 0.00
crit 54.70 34.60% 28234.13 25884 35851 28251.21 26749 30177 1544534 1544534 0.00
glance 37.96 24.01% 10469.90 9707 13444 10474.61 9783 11205 397456 397456 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 120.7sec 120.7sec 14.10% 14.10%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 15.53%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lock_and_load 30.5 0.0 14.6sec 14.6sec 12.39% 46.77%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:12.00
  • cooldown:10.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • lock_and_load_1:7.6%
  • lock_and_load_2:4.8%

Spelldata details

  • id:56453
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown and costs no Focus.
  • description:$@spelldesc56343
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
lord_blastingtons_scope_of_doom 11.3 0.0 41.4sec 41.4sec 24.83% 24.02%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.8%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 4.5 0.0 102.4sec 102.4sec 14.59% 19.89%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:14.6%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 7.1 0.0 66.6sec 66.6sec 23.15% 23.15%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.2%
terror_in_the_mists 7.4 0.0 64.9sec 64.9sec 31.98% 31.98%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.0%
virmens_bite_potion 2.0 0.0 395.4sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
cat-rabid 4.3 0.0 120.7sec 120.5sec 18.67% 22.49%

Buff details

  • buff initial source:Hunter_SV_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:18.7%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 302.3sec 302.3sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 302.3sec 302.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 302.3sec 302.3sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 302.3sec 302.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 302.3sec 302.3sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 302.3sec 302.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 302.3sec 302.3sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:9.0%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 302.3sec 302.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:9.0%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
aspect_of_the_hawk

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T14H
arcane_shot Focus 85.5 1709.3 20.0 20.0 2505.0
black_arrow Focus 18.0 630.2 35.0 35.0 5673.9
explosive_shot Focus 130.3 1734.4 13.3 13.3 5592.0
glaive_toss Focus 29.9 448.9 15.0 15.0 6636.6
serpent_sting Focus 2.1 52.8 25.0 25.0 62480.6
pet - cat
claw Focus 108.7 2843.0 26.1 26.1 758.0
pet - devilsaur
claw Focus 13.0 475.0 36.5 36.5 282.5
pet - raptor
claw Focus 13.0 475.0 36.5 36.5 282.7
pet - hyena
claw Focus 13.0 475.0 36.5 36.5 282.4
pet - wolf
claw Focus 13.0 475.0 36.5 36.5 282.8
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1801.91 2162.74 1.20 44.13 2.00%
cobra_shot Focus 84.72 1167.11 13.78 18.98 1.60%
dire_beast Focus 158.11 775.38 4.90 15.19 1.92%
viper_venom Focus 147.68 436.60 2.96 6.45 1.46%
pet - cat
focus_regen Focus 1801.91 2758.58 1.53 0.00 0.00%
pet - devilsaur
focus_regen Focus 159.98 305.78 1.91 0.21 0.07%
pet - raptor
focus_regen Focus 159.98 305.78 1.91 0.20 0.07%
pet - hyena
focus_regen Focus 159.98 305.78 1.91 0.20 0.07%
pet - wolf
focus_regen Focus 159.98 305.78 1.91 0.21 0.07%
Resource RPS-Gain RPS-Loss
Focus 10.08 10.15
Combat End Resource Mean Min Max
Health 461207.00 461207.00 461207.00
Focus 65.55 9.96 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
lock_and_load 30.5 14.6sec
explosive_shot_focus_starved 0.2 109.5sec
black_arrow_focus_starved 0.4 91.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 103045.34
Minimum 97659.39
Maximum 108636.74
Spread ( max - min ) 10977.35
Range [ ( max - min ) / 2 * 100% ] 5.33%
Standard Deviation 1455.6349
5th Percentile 100700.40
95th Percentile 105496.93
( 95th Percentile - 5th Percentile ) 4796.52
Mean Distribution
Standard Deviation 14.5563
95.00% Confidence Intervall ( 103016.81 - 103073.87 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 766
0.1 Scale Factor Error with Delta=300 18087
0.05 Scale Factor Error with Delta=300 72351
0.01 Scale Factor Error with Delta=300 1808791
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 103045.34

Damage

Sample Data
Count 10000
Mean 33666950.86

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 402.89
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 4.31 blood_fury
9 1.00 aspect_of_the_hawk,moving=0
A 0.00 aspect_of_the_fox,moving=1
B 1.00 auto_shot
C 0.00 explosive_trap,if=target.adds>0
D 0.00 a_murder_of_crows,if=enabled&!ticking
E 0.00 blink_strike,if=enabled
F 7.05 lynx_rush,if=enabled&!ticking
G 29.93 glaive_toss,if=enabled
H 0.00 powershot,if=enabled
I 0.00 barrage,if=enabled
J 0.00 multi_shot,if=target.adds>2
K 0.00 cobra_shot,if=target.adds>2
L 2.11 serpent_sting,if=!ticking&target.time_to_die>=10
M 130.33 explosive_shot,if=(remains<2.0)
N 13.87 kill_shot
O 18.01 black_arrow,if=!ticking&target.time_to_die>=8
P 15.45 dire_beast,if=enabled
Q 2.00 stampede
R 4.49 rapid_fire
S 1.80 readiness,wait_for_rapid_fire=1
T 85.47 arcane_shot,if=focus>=67
U 0.00 fervor,if=enabled&focus<=50
V 85.08 cobra_shot

Sample Sequence

89BFGLMOPQMMMRSFGMPTTTMLMMTTTVOGMMMMRVVTTTMVMMMGPTTTMVOVVMTTGVVMTVMMMTVTTGMPOVVMMMMVTTGVMVMMMTVTFOMGMMMPVVTMVTTV8GMMMTVOVMVTTMGMMPVVTMTTVTTGMOVVVMMMTVTTGMPVVTMTVOVMMGMMVTTVFMTVVMGMMPOVTTMMMMVRTGTVMTVVTTMMMOVGVMPMMMTTV8TTMMGMMVVOVMVMMMTGVPTMVTTTVMTVGOVFMVTMMMVTTGVMPMMMVTOVMQGTVTMVVTTMVVGMMMOPVTTMVVTGMMMMTVTTVMVOGVMNNPT8VMMMMTVGFNMNTTOVMVVNGM7MMNPTRSFGMNMMMNOLPTMVTMGMMNNRTTVMTVMMMNGNOVMTVMMMNNPTGMVTTM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.28% 11.28% 1965

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_SV_T14H"
origin="unknown"
level=90
race=orc
spec=survival
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/blood_fury
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking&target.time_to_die>=10
actions+=/explosive_shot,if=(remains<2.0)
actions+=/kill_shot
actions+=/black_arrow,if=!ticking&target.time_to_die>=8
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=67
actions+=/fervor,if=enabled&focus<=50
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Mage_Arcane_T14H : 126593 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
126592.6 126592.6 77.03 / 0.06% 6504 / 5.1% 16.2 7663.6 7494.6 Mana 0.03% 42.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
Glyphs
  • evocation
  • mana_gem
  • slow
  • mirror_image

Charts

http://9.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:245973|183986|182187|157374|93264&chds=0,491946&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++245973++mirror_image,69CCF0,0,0,15|t++183986++nether_tempest,69CCF0,1,0,15|t++182187++arcane_barrage,69CCF0,2,0,15|t++157374++arcane_missiles,69CCF0,3,0,15|t++93264++arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:39,34,14,12,2&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chl=arcane_blast|arcane_missiles|nether_tempest|arcane_barrage|mirror_image: arcane_blast&chtt=Mage_Arcane_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:adgjklmoqrtx02478776531zywvurpmjhfdbaZZZZYYXXWWWVVVWWWWVVUTTTTTTUUVVVVVVVVVVVWWXXXXWWWVVVVWWWXXXXXXXYYZZaabbbbaaaZZZZZZYXWVVUUUUUUUUUUUUUUUUVVWWWWWWWWVVVVVVVVVVUUUUUUUUUUVVUUUTTTTTTTTTTTTTUUVWXZabceffghhijjjkjjjihgfecbaZZYXWWVUUTTTTSSTTTTSSSSSSSSSSSSSSSRRRSSSTTTUUVVVVWWWXXYYYYYYYYYYYYYYYYYYYYXXXXXXXWWWVVVUUTTTTTTTTTTTTTTTUUUVVVVVVWWWWXXXXXXWWWVVVVUUUUUTTTTSSSSTTTTUUUUUUUUVVVWWXYYZZabbcdeffghhhiiihhhgffedcbaZYXWVVUUUUTTTTTTTTTTTTUUUUUTTTTTTTTTTTTTTTTUUUUUUUVVVVVVVWWWWXXXXYYYYZZZZaaaaZZZZYYYYXXXWWVVVUUUTTTTTTTTTTUUUUVVVVVWWWWXXXXXWWWWVVVUUUUUTTTTSSSRS&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=126593|max=310865&chxp=1,1,41,100&chtt=Mage_Arcane_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,1,1,3,4,4,11,8,15,11,27,57,62,62,97,129,144,185,205,284,308,394,409,538,528,550,644,651,627,647,573,504,450,415,346,289,228,166,121,100,76,43,26,18,14,8,8,4,1&chds=0,651&chbh=5&chxt=x&chxl=0:|min=109512|avg=126593|max=139750&chxp=0,1,56,100&chtt=Mage_Arcane_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:52.1,27.1,9.5,8.5,1.8,0.9,0.0&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,ffffff&chl=arcane_blast 234.6s|arcane_missiles 122.1s|nether_tempest 43.0s|arcane_barrage 38.4s|rune_of_power 8.0s|mirror_image 3.9s|waiting 0.1s&chtt=Mage_Arcane_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Arcane_T14H 126593
alter_time_activate 0 0.0% 2.7 195.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.69 2.69 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
arcane_barrage 15505 12.3% 31.7 13.19sec 220395 182187 188506 394254 220395 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.71 31.71 0.00 0.00 1.2097 0.0000 6988684.27 6988684.27 0.00 182186.76 182186.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.75 84.35% 188506.20 67112 327226 189228.58 136978 218740 5041900 5041900 0.00
crit 4.94 15.57% 394253.52 141746 673997 393352.62 0 671352 1946784 1946784 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1500.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage. Consumes all Arcane Charges. Arcane Barrage's damage is increased by $36032s1% per Arcane Charge, and it hits $36032s3 additional nearby $Ltarget:targets; per Arcane Charge for $44425s2% damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.235000
  • base_dd_min:1482.80
  • base_dd_max:1812.31
arcane_blast 48628 38.4% 150.0 2.99sec 145811 93264 124650 260834 145811 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 150.04 150.04 0.00 0.00 1.5634 0.0000 21877219.28 21877219.28 0.00 93264.01 93264.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.47 84.29% 124650.28 43080 280352 124786.79 114485 136225 15764371 15764371 0.00
crit 23.44 15.62% 260833.76 90736 577525 261178.92 189309 355967 6112848 6112848 0.00
miss 0.13 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.$?s86209[ Also applies the Slow spell to any target it damages if no target is currently affected by your Slow.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.045000
  • base_dd_min:672.94
  • base_dd_max:782.07
arcane_missiles 42703 33.7% 69.4 6.38sec 276944 157374 0 0 0 0.0% 0.0% 0.0% 0.0% 346.4 47607 99744 55724 15.6% 0.1% 23.2%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.41 69.41 346.37 344.95 1.7598 0.3020 19221687.13 19221687.13 0.00 157374.22 157374.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 290.7 84.27% 47607.49 16367 85838 47623.35 37252 53266 13838947 13838947 0.00
crit 54.0 15.64% 99744.11 35167 176826 99775.37 74600 122570 5382741 5382741 0.00
miss 0.3 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up|buff.arcane_missiles.stack=2
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:Launches five waves of Arcane Missiles at the enemy over $5143d, causing $7268s1 Arcane damage per wave. Generates an Arcane Charge. Arcane Missiles' damage is increased by $36032s1% per Arcane Charge. Arcane Missiles has a chance to be activated after each of your damaging spell casts. Limit $79683s1 charges.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:$@spelldesc5143
Direct Damage
  • may_crit:true
  • direct_power_mod:0.295000
  • base_dd_min:392.37
  • base_dd_max:392.37
arcane_power 0 0.0% 5.3 94.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
berserking 0 0.0% 2.9 188.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.90 2.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
mirror_image 0 (2169) 0.0% (1.7%) 3.0 181.15sec 323017 245973 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.3132 0.0000 0.00 0.00 0.00 245973.17 245973.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 17586 13.9% 35.1 13.00sec 225833 183986 0 0 0 0.0% 0.1% 0.0% 0.0% 535.2 12650 26373 14792 15.6% 0.0% 91.1%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.06 35.06 535.20 535.20 1.2275 0.7669 7916720.83 7916720.83 0.00 17457.21 183985.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.02 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 451.7 84.39% 12649.84 7252 20397 12653.91 11780 13310 5713424 5713424 0.00
crit 83.5 15.61% 26373.11 14939 42019 26385.22 23707 29058 2203297 2203297 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 5.4 91.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.43 5.43 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
rune_of_power 0 0.0% 7.5 63.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.49 7.49 0.00 0.00 1.0741 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:(null)
  • description:Places a Rune of Power on the ground, which lasts for $116011d. While standing in your own Rune of Power, your mana regeneration is increased by $116014s1% and your spell damage is increased by $116014s2%. Only $116011s1 Runes of Power can be placed at one time.$?s56380[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.
pet - mirror_image 11207 / 2169
arcane_blast 11207 1.7% 147.1 2.68sec 6587 3831 5637 11470 6587 16.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.09 147.09 0.00 0.00 1.7194 0.0000 968888.30 968888.30 0.00 3831.19 3831.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.87 83.54% 5636.78 2517 7286 5637.41 5239 6072 692595 692595 0.00
crit 24.09 16.38% 11470.30 5033 14571 11472.65 8813 13641 276293 276293 0.00
miss 0.13 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88084
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:866.45
  • base_dd_max:1006.95

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.7 0.0 194.7sec 194.7sec 3.57% 3.57%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.6%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_charge 32.7 189.4 13.2sec 2.0sec 82.15% 96.10%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:14.3%
  • arcane_charge_2:10.8%
  • arcane_charge_3:10.6%
  • arcane_charge_4:8.0%
  • arcane_charge_5:8.9%
  • arcane_charge_6:29.8%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_missiles 37.2 30.5 12.1sec 6.6sec 51.24% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_missiles
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_missiles_1:48.5%
  • arcane_missiles_2:2.8%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to $79683s1 charges and lasts $79683d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
arcane_power 5.7 2.3 86.2sec 58.6sec 20.52% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_power_1:20.5%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
  • max_stacks:
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
berserking 3.8 1.3 127.4sec 87.6sec 8.90% 13.49%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:8.9%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 11.9sec 10.31% 13.87%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.3%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.7 1.8 62.1sec 48.8sec 35.20% 35.20%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.2%
jade_serpent_potion 2.2 0.8 82.7sec 77.3sec 11.40% 11.40%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.4%
jade_spirit 9.1 0.6 51.6sec 48.1sec 23.80% 24.41%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.8%
lightweave_embroidery_3 7.5 1.0 63.3sec 55.2sec 25.35% 25.35%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.4%
presence_of_mind 5.4 0.0 91.1sec 91.1sec 1.23% 1.73%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.2%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
relic_of_yulon 9.3 0.8 50.4sec 46.2sec 30.76% 30.76%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.8%
rune_of_power 7.5 2.7 64.5sec 49.3sec 96.77% 96.74%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_power_1:96.8%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Mana regeneration increased by $w1%. Spell damage increased by $w2%.$?$w3=0[][ Health restored by $w3% per second.]
  • description:$@spelldesc116011
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.1 181.2sec 8.0sec 92.53% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.2%
  • arcane_charge_6:11.4%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.0 181.2sec 8.0sec 92.53% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.2%
  • arcane_charge_6:11.4%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 46.1 181.2sec 8.0sec 92.53% 93.93%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.4%
  • arcane_charge_2:1.4%
  • arcane_charge_3:1.3%
  • arcane_charge_4:1.2%
  • arcane_charge_5:1.2%
  • arcane_charge_6:11.4%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mage_armor

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:3000.20

    Stack Uptimes

    • mage_armor_1:100.0%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by $6117s1. The duration of all harmful Magic effects used against you is reduced by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T14H
alter_time_activate Mana 2.7 8864.8 3300.0 3300.0 0.0
arcane_barrage Mana 31.7 48599.0 1532.6 1532.6 143.8
arcane_blast Mana 150.0 3216201.3 21435.9 21435.9 6.8
mirror_image Mana 3.0 17997.0 6000.0 6000.0 53.8
nether_tempest Mana 35.1 161007.1 4592.9 4592.9 49.2
time_warp Mana 0.1 600.0 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 1629977.99 904.59 134931.81 7.65%
mana_gem Mana 3.40 190921.49 56231.11 34972.78 15.48%
rune_of_power Mana 1743.12 1556175.11 892.75 153588.74 8.98%
Resource RPS-Gain RPS-Loss
Mana 7494.59 7663.61
Combat End Resource Mean Min Max
Health 458253.00 458253.00 458253.00
Mana 153849.75 6549.65 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
arcane_charge_0 12.6%
arcane_charge_1 12.3%
arcane_charge_2 11.7%
arcane_charge_3 10.8%
arcane_charge_4 10.5%
arcane_charge_5 9.1%
arcane_charge_6 33.0%
dps_rotation 100.0%
water_elemental-arcane_charge_0 12.6%
water_elemental-arcane_charge_1 12.3%
water_elemental-arcane_charge_2 11.7%
water_elemental-arcane_charge_3 10.8%
water_elemental-arcane_charge_4 10.5%
water_elemental-arcane_charge_5 9.1%
water_elemental-arcane_charge_6 33.0%
water_elemental-dps_rotation 100.0%
Uptimes %
Mana Cap 8.0%
water_elemental-Mana Cap 8.0%
mirror_image-Mana Cap 8.0%

Procs

Count Interval
hat_donor 83.5 5.3sec
mana_gem 3.4 154.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 126592.60
Minimum 109512.14
Maximum 139750.03
Spread ( max - min ) 30237.89
Range [ ( max - min ) / 2 * 100% ] 11.94%
Standard Deviation 3929.9253
5th Percentile 119811.28
95th Percentile 132818.59
( 95th Percentile - 5th Percentile ) 13007.31
Mean Distribution
Standard Deviation 39.2993
95.00% Confidence Intervall ( 126515.58 - 126669.63 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3702
0.1 Scale Factor Error with Delta=300 131841
0.05 Scale Factor Error with Delta=300 527366
0.01 Scale Factor Error with Delta=300 13184153
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 126592.60

Damage

Sample Data
Count 10000
Mean 56004311.51

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 316.98
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 mage_armor
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.05 time_warp,if=target.health.pct<25|time>5
A 0.24 arcane_power,if=target.time_to_die<18
B 0.15 berserking,if=target.time_to_die<18
C 2.69 alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
D 0.00 arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
E 36.69 arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
F 6.51 rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
G 1.00 jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
H 3.40 mana_gem,if=mana.pct<84&buff.alter_time.down
I 3.00 mirror_image
J 5.02 arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
K 2.75 berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
L 5.43 presence_of_mind,if=buff.alter_time.down
M 35.06 nether_tempest,if=!ticking
N 115.96 arcane_blast,if=mana.pct>92
O 32.72 arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
P 18.98 arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Q 12.73 arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
R 34.62 arcane_blast
S 0.00 arcane_barrage,moving=1
T 0.00 fire_blast,moving=1
U 0.00 ice_lance,moving=1

Sample Sequence

ILMNNJNKNCEENQREEMNEONQRRNROMNQRNNNROQMNNENENENMOQNNNNNFMONQONNNEMNONHNPOLNMNJGNONQRNMNNENENMOPNNNFNMNENOPNNNMENONPRNMNNONPRNMNNPNNINLMNNPRFNJNKNMRCEENQREOHNMENOPRRNEMENONPRRMNPNNNNPEMNNNOFNPRMNNNPNELNNEMNOJNROQRMRORPONNMNENONPRMFNNENONMQONNENEMNONHNPONMNNINELNOMPRNNNPNFMEJNEKNRRRCEEMEQEOQRRPRMOPNNNNOMNRORREMORRRREO

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 21602 19208 18083
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 32448 27105 7907
Spell Hit 14.91% 14.91% 5070
Spell Crit 17.57% 11.62% 1879
Spell Haste 17.31% 11.72% 4983
Mana Per 5 17597 16759 0
Attack Power 117 100 0
Melee Hit 14.91% 14.91% 5070
Melee Crit 11.76% 6.75% 1879
Melee Haste 11.72% 11.72% 4983
Swing Speed 22.90% 11.72% 4983
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 58.98% 38.98% 6892

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Arcane_T14H"
origin="unknown"
level=90
race=troll
spec=arcane
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
glyphs=evocation/mana_gem/slow/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/mage_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/arcane_power,if=target.time_to_die<18
actions+=/berserking,if=target.time_to_die<18
actions+=/alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
actions+=/arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
actions+=/rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/mirror_image
actions+=/arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
actions+=/berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/arcane_blast,if=mana.pct>92
actions+=/arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
actions+=/arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
actions+=/arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
actions+=/arcane_blast
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=crit_hit
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3
chest=robes_of_the_unknown_fear,id=87169,gems=160int_320mastery_120int,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=320mastery_80int_160hit_160int_120haste,reforge=hit_mastery
legs=leggings_of_the_burning_scroll,id=87009,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=320mastery_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18083
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5070
# gear_crit_rating=1879
# gear_haste_rating=4983
# gear_mastery_rating=6892
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Fire_T14H : 130204 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
130203.7 130203.7 98.84 / 0.08% 8291 / 6.4% 22.1 5765.2 5343.2 Mana 0.00% 40.3 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
Glyphs
  • evocation
  • fire_blast
  • counterspell
  • mirror_image

Charts

http://4.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:440129|293169|136569|64823|52551&chds=0,880259&chco=69CCF0,C41F3B,69CCF0,C41F3B,C41F3B&chm=t++440129++mirror_image,69CCF0,0,0,15|t++293169++pyroblast,C41F3B,1,0,15|t++136569++nether_tempest,69CCF0,2,0,15|t++64823++fireball,C41F3B,3,0,15|t++52551++inferno_blast,C41F3B,4,0,15&chtt=Mage_Fire_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,30,14,13,9,3,2&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,C41F3B,69CCF0,C41F3B,C41F3B&chl=pyroblast|fireball|combustion|ignite|nether_tempest|inferno_blast|mirror_image: fireball&chtt=Mage_Fire_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:RUXaegjlnoqtwy13468776521yxusqolkigeeccbbbbaaaaZZZZYYYYYYYYXXWWWWWWWWXXXXXYYYZZZaabbcccbaaZZZYYXXWVUUTTSSRRRSSTTUUVVWXXYYZZZZZZZaaaaZYXWWVUUTTTSSSSSSSSSSTUVWXXYYZZZZZZZZZZZZYYYXWVUTTSSSRSSSTUUVWXYYZabceefgggggggfeedccbbaaaZZZYYYYXXWWVVVUUUUTTTTTTSSSSSSSTTTTUUVVWWXXYZZabbccdddccbbaaZYYXWWVUUTSSSRSSTTTUUUVVVWWWWWXXXXYYYYYYXWWVVUUUUUUUUUUVVVVVWWXYYYZZZZZZYYYXXXXWWWWVVUUTTTTTTUVWXXYZabbccdefgghhhhhggfeddcbbaaaZZZZZYYYYYXWWVVVVVUUUUUUUTTTTTTUUUVVWWXXXYYYZZZZaaabbbbaaZZYYXXWWWVVVVUUUUUUVVWWXXYYYYZZZZZZZZZZaZZZZYYXWWVVVVUUVVVVVVVVVWWXYYYYYYYYYYXWWWVVVUUUTT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=130204|max=310104&chxp=1,1,42,100&chtt=Mage_Fire_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,2,0,5,1,7,8,25,23,46,69,83,116,184,234,293,360,445,482,547,580,651,676,621,667,650,506,495,454,390,286,272,186,158,121,102,66,55,41,38,25,13,5,4,1,1,2,2&chds=0,676&chbh=5&chxt=x&chxl=0:|min=109344|avg=130204|max=150396&chxp=0,1,51,100&chtt=Mage_Fire_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:59.7,13.3,10.8,8.7,6.9,0.6&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,69CCF0,69CCF0,C41F3B,69CCF0&chl=fireball 269.0s|pyroblast 59.7s|evocation 48.5s|nether_tempest 39.2s|inferno_blast 31.1s|mirror_image 2.6s&chtt=Mage_Fire_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Fire_T14H 130204
alter_time_activate 0 0.0% 2.8 187.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.84 2.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
berserking 0 0.0% 2.9 187.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
combustion 17966 13.8% 12.1 37.62sec 664949 0 46484 96472 61017 29.1% 0.0% 0.0% 0.0% 163.8 33978 70827 44766 29.3% 0.0% 26.9%

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.14 12.14 163.85 163.85 0.0000 0.7386 8075733.53 8075733.53 0.00 66732.22 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.61 70.87% 46484.47 34298 60186 46499.65 40015 52512 400106 400106 0.00
crit 3.53 29.10% 96471.69 70654 123983 95019.13 0 123983 340941 340941 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.9 70.73% 33978.21 0 86154 34044.41 25779 45251 3937419 3937419 0.00
crit 48.0 29.27% 70826.58 0 177477 70988.88 53319 96319 3397268 3397268 0.00
DPS Timeline Chart

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die<12
Spelldata
  • id:11129
  • name:Combustion
  • school:fire
  • tooltip:(null)
  • description:Instantly deals $s2 Fire damage and stuns the target for $118271d. Burns the target for additional damage over $83853d based on the Pyroblast and Ignite effects already on the target. When cast, resets the cooldown of your Inferno Blast ability.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:952.31
  • base_dd_max:1129.24
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:26487.78
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
evocation 0 0.0% 10.1 46.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 40.0 0 0 0 28.7% 0.0% 10.3%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.06 10.06 40.04 40.04 4.8219 1.1554 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.5 71.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 11.5 28.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
fireball 38751 29.8% 155.2 2.88sec 112388 64823 76675 159154 112725 43.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 155.17 154.71 0.00 0.00 1.7338 0.0000 17439739.73 17439739.73 0.00 64822.83 64822.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.01 56.24% 76674.52 56592 99306 76711.87 73972 79857 6671373 6671373 0.00
crit 67.66 43.73% 159153.87 116579 204571 159247.98 153479 165867 10768367 10768367 0.00
miss 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
ignite 16473 12.7% 229.6 1.94sec 32300 0 0 0 0 0.0% 0.0% 0.0% 0.0% 214.8 34530 0 34530 0.0% 0.0% 95.3%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.60 229.60 214.77 214.77 0.0000 2.0000 7416047.45 7416047.45 0.00 17264.93 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 229.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 214.8 100.00% 34529.81 0 152548 34567.56 28716 40866 7416047 7416047 0.00
DPS Timeline Chart

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:$@spelldesc12846
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:17912.83
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
inferno_blast 3627 2.8% 25.6 17.56sec 63796 52551 0 63811 63796 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inferno_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.59 25.59 0.00 0.00 1.2140 0.0000 1632693.18 1632693.18 0.00 52550.55 52550.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 25.59 99.98% 63810.98 52989 81827 63854.88 60782 68214 1632693 1632693 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inferno_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.react&buff.pyroblast.down
Spelldata
  • id:108853
  • name:Inferno Blast
  • school:fire
  • tooltip:(null)
  • description:Blasts the enemy for $s1 Fire damage, and is guaranteed to critical strike. Upon impact, it spreads any $?s89926&s44457[Living Bomb, ][]Pyroblast, Ignite, and Combustion effects to up to 2 nearby enemy targets within $118280A1 yards. $?s89926&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards. ][]$?s89926&s112948[Also instantly triggers your Frost Bomb effect. ][]Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:571.39
  • base_dd_max:677.55
mirror_image 0 (2597) 0.0% (2.0%) 3.0 181.48sec 388246 440129 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.8821 0.0000 0.00 0.00 0.00 440129.41 440129.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 11903 9.1% 32.4 14.01sec 165378 136569 0 0 0 0.0% 0.0% 0.0% 0.0% 499.3 8181 16948 10732 29.1% 0.0% 83.9%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.40 32.40 499.31 499.31 1.2109 0.7573 5358819.91 5358819.91 0.00 12839.80 136568.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.39 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 354.0 70.89% 8180.68 7527 10539 8183.63 8004 8388 2895814 2895814 0.00
crit 145.3 29.11% 16948.03 15505 21711 16954.93 16426 17707 2463006 2463006 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 5.3 94.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pyroblast 38886 29.9% 49.6 8.91sec 352624 293169 150729 313115 221766 43.8% 0.0% 0.0% 0.0% 180.4 24637 51173 36227 43.7% 0.0% 90.9%

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.65 49.47 180.43 180.43 1.2028 2.2705 17506295.31 17506295.31 0.00 37296.95 293169.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.80 56.21% 150729.17 101866 196627 150805.33 141319 165182 4190678 4190678 0.00
crit 21.65 43.77% 313115.22 209843 405052 313346.81 281121 352855 6779195 6779195 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.6 56.32% 24636.51 16669 32176 24648.68 22965 26221 2503559 2503559 0.00
crit 78.8 43.68% 51172.88 34339 66282 51198.47 47720 55410 4032863 4032863 0.00
DPS Timeline Chart

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d. Getting two single-target direct-damage Fire critical strikes in a row will make your next Pyroblast instant cast, cost no mana, and deal $s3% additional damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.200000
  • base_dd_min:2017.24
  • base_dd_max:2562.19
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.360000
  • base_td:374.68
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - mirror_image 13440 / 2597
fireball 13440 2.0% 148.6 2.66sec 7812 4606 6008 12112 7839 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.57 148.06 0.00 0.00 1.6962 0.0000 1160621.25 1160621.25 0.00 4605.64 4605.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.57 69.95% 6008.04 4988 6868 6010.42 5791 6262 622262 622262 0.00
crit 44.45 30.02% 12111.52 9977 13737 12116.51 11351 12942 538359 538359 0.00
miss 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:88082
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88082
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.812000
  • base_dd_min:1657.70
  • base_dd_max:2114.08

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.8 0.0 187.4sec 187.4sec 3.77% 3.77%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.8%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
berserking 4.3 1.0 111.2sec 86.5sec 8.77% 15.94%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:8.8%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 11.2sec 10.37% 15.46%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.4%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.6 1.6 62.0sec 49.9sec 35.05% 35.05%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.0%
heating_up 73.1 0.2 6.1sec 6.1sec 25.51% 38.65%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • heating_up_1:25.5%
  • heating_up_2:0.0%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
invocation 10.0 2.8 47.3sec 36.2sec 88.13% 92.91%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:88.1%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.1 1.0 372.9sec 349.4sec 11.63% 11.63%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.6%
jade_spirit 9.0 0.8 51.9sec 47.4sec 24.14% 25.64%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:24.1%
lightweave_embroidery_3 7.4 1.1 64.6sec 55.5sec 25.35% 25.35%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.3%
presence_of_mind 5.3 0.0 92.8sec 92.8sec 0.38% 1.29%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:0.4%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
pyroblast 46.8 1.8 9.5sec 9.1sec 17.78% 93.88%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyroblast
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • pyroblast_1:17.8%

Spelldata details

  • id:48108
  • name:Pyroblast!
  • tooltip:Your next Pyroblast spell is instant cast, costs no mana, and deals $11366s3% additional damage.
  • description:Getting two direct-damage critical strikes in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
relic_of_yulon 9.4 1.0 50.0sec 44.5sec 31.24% 31.24%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:31.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
molten_armor

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_armor_1:100.0%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by $s1%. Reduces all physical damage taken by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T14H
alter_time_activate Mana 2.8 8522.4 3000.0 3000.0 0.0
combustion Mana 12.1 364347.0 30000.0 30000.0 22.2
fireball Mana 155.2 1862088.0 12000.0 12000.0 9.4
inferno_blast Mana 25.6 153555.0 6000.0 6000.0 10.6
mirror_image Mana 3.0 17936.4 6000.0 6000.0 64.7
nether_tempest Mana 32.4 145815.8 4500.0 4500.0 36.8
pyroblast Mana 49.6 45567.0 917.8 917.8 384.2
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 838400.39 465.29 46692.67 5.28%
evocation Mana 40.04 1406067.12 35113.58 823271.74 36.93%
mana_gem Mana 3.00 163209.31 54403.10 36760.33 18.38%
Resource RPS-Gain RPS-Loss
Mana 5343.25 5765.25
Combat End Resource Mean Min Max
Health 458253.00 458253.00 458253.00
Mana 217689.69 76594.93 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.7%
dpm_rotation 99.3%
water_elemental-dps_rotation 0.7%
water_elemental-dpm_rotation 99.3%
mirror_image-dps_rotation 0.7%
mirror_image-dpm_rotation 99.3%
Uptimes %
Mana Cap 1.1%
water_elemental-Mana Cap 1.1%
mirror_image-Mana Cap 1.1%

Procs

Count Interval
hat_donor 272.1 1.6sec
mana_gem 3.0 125.9sec
test_for_crit_hotstreak 241.9 1.8sec
crit_test_hotstreak 118.4 3.7sec
hotstreak 45.8 9.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 130203.69
Minimum 109344.41
Maximum 150395.95
Spread ( max - min ) 41051.54
Range [ ( max - min ) / 2 * 100% ] 15.76%
Standard Deviation 5042.9865
5th Percentile 122137.83
95th Percentile 138719.67
( 95th Percentile - 5th Percentile ) 16581.84
Mean Distribution
Standard Deviation 50.4299
95.00% Confidence Intervall ( 130104.85 - 130302.53 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5762
0.1 Scale Factor Error with Delta=300 217099
0.05 Scale Factor Error with Delta=300 868398
0.01 Scale Factor Error with Delta=300 21709972
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 130203.69

Damage

Sample Data
Count 10000
Mean 57429329.10

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 302.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 molten_armor
4 0.00 snapshot_stats
5 0.00 evocation
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.00 time_warp,if=target.health.pct<25|time>5
A 2.83 berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
B 0.32 combustion,if=target.time_to_die<12
C 11.82 combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
D 0.00 combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
E 9.06 evocation,if=buff.invocation.down&buff.alter_time.down
F 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
G 0.09 berserking,if=target.time_to_die<18
H 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
I 2.84 alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
J 0.00 evocation,if=mana.pct<10&target.time_to_die>=30
K 46.23 pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
L 3.42 pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
M 25.59 inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
N 2.99 mirror_image
O 5.26 presence_of_mind,if=buff.alter_time.down
P 32.40 nether_tempest,if=!ticking
Q 155.75 fireball
R 0.00 inferno_blast,moving=1
S 0.00 ice_lance,moving=1

Sample Sequence

NAOPQQMIKQCQQMQKQPQQHQQMKQQQQPQMKQQQQQMKPQQCQQEQPQQQMKQQPQKQMQKQKPCKMQKQQQOLEPQQQQKQPQQQCQQQPQQQMKQQPHQEKMKQPQKQCQQQPQQQQQQPQQMKNOQEAPQQQCQQQQMIKPQQQKQKQKPQMKQQQQMKCPQQEQPQQQQQQKHMKPQQQKQCQQPOLQQKQEPQQQQQQPQMQKQCQQPQMKQQQKPEQQMKQPQQQQCQQPQQMKQKNOLPMKQQEAPQQQCQQQQPQQQQQQQMIKPFQQQKQQPMKCQKEPQQQQQQKPQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 20852 18494 17403
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 31623 26391 7907
Spell Hit 14.97% 14.97% 5091
Spell Crit 31.05% 20.12% 7144
Spell Haste 17.82% 12.21% 5190
Mana Per 5 8837 8416 0
Attack Power 117 100 0
Melee Hit 14.97% 14.97% 5091
Melee Crit 20.53% 15.52% 7144
Melee Haste 12.21% 12.21% 5190
Swing Speed 23.43% 12.21% 5190
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 24.95% 17.45% 2175

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Fire_T14H"
origin="unknown"
level=90
race=troll
spec=fire
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
glyphs=evocation/fire_blast/counterspell/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/molten_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
actions+=/combustion,if=target.time_to_die<12
actions+=/combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking,if=target.time_to_die<18
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
actions+=/evocation,if=mana.pct<10&target.time_to_die>=30
actions+=/pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
actions+=/pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
actions+=/inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
actions+=/mirror_image
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/fireball
actions+=/inferno_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=haste_crit
chest=robes_of_the_burning_scroll,id=87010,gems=320crit_320crit_180haste,enchant=80all,reforge=haste_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_crit
hands=gloves_of_the_burning_scroll,id=87007,enchant=170mastery,reforge=hit_crit
waist=belt_of_malleable_amber,id=86981,gems=320crit_160crit_160hit_120haste,reforge=haste_crit
legs=dreadwoven_leggings_of_failure,id=87174,gems=80int_160crit_80int_160hit_120int,enchant=285int_165crit,reforge=haste_crit
feet=sandals_of_the_blackest_night,id=87162,gems=320crit_60mastery,enchant=175hit,reforge=haste_hit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17403
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5091
# gear_crit_rating=7144
# gear_haste_rating=5190
# gear_mastery_rating=2175
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Frost_T14H : 125547 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
125546.7 125546.7 47.97 / 0.04% 4002 / 3.2% 19.2 5261.8 5061.2 Mana 0.00% 48.3 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
Glyphs
  • evocation
  • icy_veins
  • ice_lance

Charts

http://8.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:323887|252164|181755|181032|122611|65704&chds=0,647774&chco=69CCF0,0070DE,0070DE,0070DE,0070DE,0070DE&chm=t++323887++mirror_image,69CCF0,0,0,15|t++252164++frozen_orb,0070DE,1,0,15|t++181755++frostfire_bolt,0070DE,2,0,15|t++181032++ice_lance,0070DE,3,0,15|t++122611++frost_bomb,0070DE,4,0,15|t++65704++frostbolt,0070DE,5,0,15&chtt=Mage_Frost_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:24,19,17,16,15,8,7,7,5,5,2,0,0&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,C41F3B,0070DE&chl=frostbolt|ice_lance|water_elemental: waterbolt|frostfire_bolt|frost_bomb|mini_ice_lance|mini_frostbolt|mini_frostfire_bolt|water_elemental: mini_waterbolt|frozen_orb|mirror_image: frostbolt|mirror_image: fire_blast|water_elemental: freeze&chtt=Mage_Frost_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:QTVZchjiklmqux023576686631xwwtsqoljhgfedcaXXVVVVVUUVUUUUUVVVWXYZabbbbccdddddddddccbaZYYXWVUUUUTUUVVWWWWXXYZabddddddededdcdcdddddccbbaZZZYXXWWWWWWVUUTTUVVWXXXXXXXXXXWWWWWWWWWWVVUUTTSSRRSTVWXYYYYZZabcefgijkkkjjihhggggffedcbbaaZZYXWVUTTSSSSSSSSSSTTTTUVWXXYZZZaaaaaaaabaaaaZZYYXXWVVVUUUVVVVWWWWWXXYZZabbbbbbbbaaaaaaabbbaaZZYYXXXWVVVVUUUUTTSSTTUUVVWWWXXXXXXXXXXXXXXXWWVVUUTTSTTUVVWXYZZabbcdfghijkkkkjjiihggfeeddcbaaZZYYXXWVUTTTSSSSSSTTTTTUUVVWXYZaaabbbbbbbaaaaZZYYXWWVUUTTSTTTTUUUVVVVWWXXYZaaabbbbbbbbbbbbccccbbaZZYYXXWWVVVUUUTTTTTTTUUVVVVVWWWVVUUTSSRRRRQQQQPP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=125547|max=288318&chxp=1,1,44,100&chtt=Mage_Frost_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,0,2,2,7,5,7,16,23,28,39,49,71,116,128,167,222,284,335,381,441,482,572,581,629,563,642,552,568,490,439,430,327,283,274,213,173,120,97,83,46,42,20,15,12,8,5,5,2,1&chds=0,642&chbh=5&chxt=x&chxl=0:|min=116009|avg=125547|max=134501&chxp=0,1,52,100&chtt=Mage_Frost_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.4,14.9,12.5,12.3,10.0,2.0,0.7&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,69CCF0,0070DE,69CCF0&chl=frostbolt 213.7s|ice_lance 67.2s|frostfire_bolt 56.4s|frost_bomb 55.5s|evocation 45.1s|frozen_orb 9.1s|mirror_image 3.3s&chtt=Mage_Frost_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Frost_T14H 125547
alter_time_activate 0 0.0% 2.9 184.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.85 2.85 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
blood_fury 0 0.0% 4.0 129.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 3.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<12
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
evocation 0 0.0% 10.1 46.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 40.2 0 0 0 18.3% 0.0% 9.5%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.10 10.10 40.20 40.20 4.4650 1.0658 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.8 81.69% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.4 18.31% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frost_bomb 15100 12.0% 48.7 9.25sec 139546 122611 0 0 0 0.0% 0.0% 0.0% 0.0% 48.3 117046 243199 140651 18.7% 0.0% 38.7%

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.72 48.72 48.34 48.34 1.1381 3.6038 6798928.63 6798928.63 0.00 29604.71 122611.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.3 81.29% 117046.01 88466 161232 117087.64 111516 123425 4599194 4599194 0.00
crit 9.0 18.71% 243198.93 182241 332137 243333.33 182241 332137 2199734 2199734 0.00
DPS Timeline Chart

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:6.73
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d.
  • description:Places a Frost Bomb on the target. After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d. Frost Bomb's countdown and cooldown are reduced by haste.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:$@spelldesc112948
Direct Damage
  • may_crit:true
  • direct_power_mod:2.462000
  • base_dd_min:3285.74
  • base_dd_max:3285.74
frostbolt 24047 (31191) 19.2% (24.8%) 146.4 3.03sec 95921 65704 61925 127112 74202 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.40 145.92 0.00 0.00 1.4599 0.0000 10827893.51 10827893.51 0.00 65704.00 65704.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.44 81.17% 61924.78 22087 91784 61940.60 57923 67047 7334464 7334464 0.00
crit 27.48 18.83% 127111.93 45499 189076 127146.84 97269 152840 3493430 3493430 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.250000
  • base_dd_min:1144.86
  • base_dd_max:1457.09
frostfire_bolt 15908 (22752) 12.7% (18.1%) 49.6 8.90sec 206495 181755 76062 154547 144872 87.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.60 49.45 0.00 0.00 1.1361 0.0000 7163679.30 7163679.30 0.00 181754.59 181754.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.10 12.33% 76062.36 28142 116466 76035.12 0 115217 463638 463638 0.00
crit 43.35 87.67% 154546.55 72465 250605 154641.07 135661 177955 6700041 6700041 0.00
DPS Timeline Chart

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.brain_freeze.up
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][$s2] Frostfire damage and slowing the target by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
frozen_orb 5088 4.1% 7.6 62.39sec 301351 252164 0 0 0 0.0% 0.0% 0.0% 0.0% 75.6 25152 52305 30295 18.9% 0.0% 16.8%

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.60 7.60 75.64 75.64 1.1951 1.0000 2291410.72 2291410.72 0.00 27045.91 252163.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.3 81.06% 25152.45 18358 33460 25164.76 23525 27236 1542129 1542129 0.00
crit 14.3 18.94% 52305.14 37818 68929 52332.84 45737 62896 749282 749282 0.00
DPS Timeline Chart

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains20&buff.alter_time.down
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:(null)
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal $84721s2 Frost damage to all nearby enemy targets for $d. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by $84721s1% for $84721d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by $s1%.
  • description:$@spelldesc84714
Direct Damage
  • may_crit:true
  • direct_power_mod:0.511000
  • base_dd_min:593.76
  • base_dd_max:763.41
ice_lance 19317 (27022) 15.4% (21.5%) 59.1 7.42sec 205976 181032 77514 157531 147636 87.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.10 58.97 0.00 0.00 1.1378 0.0000 8706756.47 8706756.47 0.00 181032.23 181032.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.29 12.37% 77513.63 29155 119211 77537.02 0 112597 565284 565284 0.00
crit 51.68 87.63% 157531.06 60059 257549 157465.60 130585 183667 8141473 8141473 0.00
DPS Timeline Chart

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.fingers_of_frost.up
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:Deals $?a44544[${$m1*1.25} to ${$M1*1.25}][$s1] Frost damage to an enemy target$?s56377&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]$?s56377&a44544[, and ${$m1*1.25*$56377m2/100} to ${$M1*1.25*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is quadrupled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
icy_veins 0 0.0% 5.3 93.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<22
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
mini_frostbolt 7144 5.7% 0.0 1.#Rsec 0 0 33940 70653 41125 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 78.17 0.00 0.00 0.0000 0.0000 3214890.84 3214890.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.87 80.43% 33940.00 23854 43592 33969.85 32078 36249 2133937 2133937 0.00
crit 15.30 19.57% 70653.35 49139 89801 70710.11 62707 89801 1080954 1080954 0.00
DPS Timeline Chart

Action details: mini_frostbolt

Static Values
  • id:131079
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131079
  • name:Frostbolt
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc116
Direct Damage
  • may_crit:true
  • direct_power_mod:1.350000
  • base_dd_min:1236.44
  • base_dd_max:1573.66
mini_frostfire_bolt 6844 5.4% 0.0 1.#Rsec 0 0 43777 94394 88796 88.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 34.68 0.00 0.00 0.0000 0.0000 3079463.96 3079463.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.84 11.06% 43776.53 39258 57394 42708.92 0 57394 167905 167905 0.00
crit 30.84 88.94% 94394.45 64697 118232 94495.11 85631 105821 2911559 2911559 0.00
DPS Timeline Chart

Action details: mini_frostfire_bolt

Static Values
  • id:131081
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131081
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:(null)
  • description:$@spelldesc44614
Direct Damage
  • may_crit:true
  • direct_power_mod:1.674000
  • base_dd_min:1533.19
  • base_dd_max:1951.33
mini_ice_lance 7705 6.1% 0.0 1.#Rsec 0 0 40028 86661 81425 88.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 42.56 0.00 0.00 0.0000 0.0000 3465850.75 3465850.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.78 11.23% 40028.49 29155 52853 39564.10 0 52853 191312 191312 0.00
crit 37.79 88.77% 86661.02 60059 108878 86832.44 81026 96150 3274539 3274539 0.00
DPS Timeline Chart

Action details: mini_ice_lance

Static Values
  • id:131080
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131080
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc30455
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
mirror_image 0 (2396) 0.0% (1.9%) 2.9 183.10sec 367640 323887 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 1.1351 0.0000 0.00 0.00 0.00 323887.00 323887.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
presence_of_mind 0 0.0% 5.5 90.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.47 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pet - water_elemental 22000 / 22000
freeze 98 0.1% 17.2 26.78sec 2577 0 2172 4356 2577 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.20 17.20 0.00 0.00 0.0000 0.0000 44324.29 44324.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.02 81.48% 2172.12 1669 2539 2172.40 2017 2293 30447 30447 0.00
crit 3.19 18.52% 4356.15 3337 5049 4204.91 0 5049 13877 13877 0.00
DPS Timeline Chart

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:owner.buff.fingers_of_frost.stack=0
Spelldata
  • id:33395
  • name:Freeze
  • school:frost
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect. $?s112965[Grants the Mage a charge of Fingers of Frost for each target hit by Freeze.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.023000
  • base_dd_min:394.72
  • base_dd_max:458.72
mini_waterbolt 5177 4.1% 0.0 1.#Rsec 0 0 14501 29387 17410 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 133.76 0.00 0.00 0.0000 0.0000 2328729.42 2328729.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.62 80.46% 14500.68 8152 18473 14516.66 13697 15592 1560582 1560582 0.00
crit 26.14 19.54% 29387.02 20217 36946 29418.46 26064 33171 768147 768147 0.00
DPS Timeline Chart

Action details: mini_waterbolt

Static Values
  • id:131581
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131581
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.426000
  • base_dd_min:387.95
  • base_dd_max:498.79
waterbolt 16724 (21901) 13.3% (17.4%) 245.5 1.83sec 40157 21926 25977 51771 30837 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 245.54 244.22 0.00 0.00 1.8315 0.0000 7531209.10 7531209.10 0.00 21925.93 21925.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.21 81.16% 25977.17 7654 41030 25981.55 24512 27577 5148859 5148859 0.00
crit 46.02 18.84% 51771.32 18983 82061 51778.58 42323 60906 2382350 2382350 0.00
DPS Timeline Chart

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:364.27
  • base_dd_max:468.35
pet - mirror_image 12681 / 2396
fire_blast 1903 0.3% 42.6 28.36sec 3783 0 3157 6384 3783 19.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.62 42.62 0.00 0.00 0.0000 0.0000 161207.25 161207.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.35 80.60% 3156.55 2889 3733 3158.83 2959 3362 108417 108417 0.00
crit 8.27 19.40% 6383.92 5777 7465 6388.19 0 7465 52791 52791 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59637
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.005000
  • base_dd_min:984.34
  • base_dd_max:1105.55
frostbolt 10778 1.6% 194.3 5.89sec 4696 3655 3928 7941 4710 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 194.25 193.66 0.00 0.00 1.2847 0.0000 912154.28 912154.28 0.00 3655.27 3655.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 155.92 80.51% 3927.62 2923 4683 3929.89 3719 4127 612377 612377 0.00
crit 37.75 19.49% 7941.49 5845 9366 7946.39 7369 8673 299777 299777 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.017000
  • base_dd_min:1004.56
  • base_dd_max:1110.30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.9 0.0 184.6sec 184.6sec 3.79% 3.79%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.8%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.0 1.0 128.1sec 96.1sec 14.25% 14.25%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.2%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 14.0sec 10.37% 13.13%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.4%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 49.9 1.3 9.0sec 8.7sec 21.08% 21.08%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:21.1%

Spelldata details

  • id:44549
  • name:Brain Freeze
  • tooltip:(null)
  • description:Your most recently applied Nether Tempest, Living Bomb, or Frost Bomb spell has a chance when it deals damage to grant you the Brain Freeze effect. The Brain Freeze effect causes your next Frostfire Bolt to be instant cast, cost no mana, and act as if your target were frozen for $57761d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 7.3 1.3 65.0sec 54.0sec 33.11% 33.11%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.1%
fingers_of_frost 46.7 15.5 9.6sec 7.2sec 30.46% 100.00%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:12.00%
  • default_value:-1.00

Stack Uptimes

  • fingers_of_frost_1:23.3%
  • fingers_of_frost_2:7.1%

Spelldata details

  • id:112965
  • name:Fingers of Frost
  • tooltip:(null)
  • description:Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a $s1% chance, your Blizzard ticks have a $s2% chance, and your successful Scorches have a $s3% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by $44544s2% for $44544d. Limit $44544s1 charges.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
icy_veins 5.4 2.6 91.8sec 58.0sec 26.33% 31.07%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • icy_veins_1:26.3%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
invocation 10.0 2.8 47.0sec 36.0sec 88.52% 91.49%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:88.5%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 1.0 98.0sec 80.7sec 11.44% 11.44%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:11.4%
jade_spirit 8.3 0.8 56.2sec 50.7sec 22.08% 27.91%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.1%
lightweave_embroidery_3 7.1 0.9 66.9sec 58.0sec 24.38% 24.38%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:24.4%
presence_of_mind 5.5 0.0 90.8sec 90.8sec 1.15% 1.20%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.1%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
relic_of_yulon 8.7 1.0 53.8sec 47.5sec 29.38% 29.38%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
frost_armor

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • frost_armor_1:100.0%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Spell haste increased by $7302w1%. Attackers are slowed.
  • description:Increases your spell haste by $7302s1%. If an enemy strikes the caster, their movement is slowed by $7321s2% for $7321d. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T14H
alter_time_activate Mana 2.9 8554.8 3000.0 3000.0 0.0
frost_bomb Mana 48.7 182706.0 3750.0 3750.0 37.2
frostbolt Mana 146.4 1756802.4 12000.0 12000.0 8.0
frozen_orb Mana 7.6 228114.0 30000.0 30000.0 10.0
ice_lance Mana 59.1 177291.3 3000.0 3000.0 68.7
mirror_image Mana 2.9 17517.6 6000.0 6000.0 61.3
time_warp Mana 0.0 3.6 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 862472.19 478.64 78767.99 8.37%
evocation Mana 40.20 1223020.93 30424.24 1204521.36 49.62%
mana_gem Mana 3.00 195087.92 65029.31 15616.29 7.41%
Resource RPS-Gain RPS-Loss
Mana 5061.19 5261.83
Combat End Resource Mean Min Max
Health 458267.00 458267.00 458267.00
Mana 229020.87 117414.67 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.5%
dpm_rotation 99.5%
water_elemental 100.0%
water_elemental-dps_rotation 0.5%
water_elemental-dpm_rotation 99.5%
water_elemental-water_elemental 100.0%
Uptimes %
Mana Cap 1.0%
water_elemental-Mana Cap 1.0%
mirror_image-Mana Cap 1.0%

Procs

Count Interval
mana_gem 3.0 130.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 125546.72
Minimum 116009.29
Maximum 134501.13
Spread ( max - min ) 18491.85
Range [ ( max - min ) / 2 * 100% ] 7.36%
Standard Deviation 2447.2564
5th Percentile 121572.89
95th Percentile 129577.79
( 95th Percentile - 5th Percentile ) 8004.91
Mean Distribution
Standard Deviation 24.4726
95.00% Confidence Intervall ( 125498.75 - 125594.68 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1459
0.1 Scale Factor Error with Delta=300 51126
0.05 Scale Factor Error with Delta=300 204504
0.01 Scale Factor Error with Delta=300 5112609
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 125546.72

Damage

Sample Data
Count 10000
Mean 45548874.20

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 362.81
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 frost_armor
4 0.00 water_elemental
5 0.00 snapshot_stats
6 0.00 evocation
7 0.00 jade_serpent_potion
Default action list
# count action,conditions
8 0.00 counterspell,if=target.debuff.casting.react
9 0.00 cold_snap,if=health.pct<30
A 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
B 0.00 time_warp,if=target.health.pct<25|time>5
C 5.47 presence_of_mind,if=buff.alter_time.down
D 17.20 water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
E 0.25 icy_veins,if=target.time_to_die<22
F 0.18 blood_fury,if=target.time_to_die<12
G 4.33 frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
H 6.18 ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
I 0.00 frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
J 0.65 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
K 2.61 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
L 5.02 icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
M 0.00 icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
N 48.84 frost_bomb,if=!ticking
O 0.01 icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
P 2.92 mirror_image
Q 9.10 evocation,if=buff.invocation.down&buff.alter_time.down
R 0.00 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
S 1.00 jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
T 3.79 blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
U 7.89 frostbolt,if=debuff.frostbolt.stack<3
V 2.83 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
W 0.02 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
X 45.28 frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Y 0.00 ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Z 52.27 ice_lance,if=buff.fingers_of_frost.react
a 5.00 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
b 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
c 138.99 frostbolt
d 0.00 fire_blast,moving=1
e 0.00 ice_lance,moving=1

Sample Sequence

CDKLNPTUUUUUNJJbcccNcccccNccVGGHNccXZXZDNZccXccNZcQNXZccXZNDaZZccXZNcccXZcNcccZZXCDNZcQLNSXccXZcNcccXDcZNZccZXaNZcccXbcNcQDTXcNZccXZcNcccXccNccDcXZZNcccCXcQKLNPZccXZZDNcZccccNVGHcGccNXZccXZDNZccXccNQXZcNccaXZDcNZbccZXcNTcccXCccNcccXcQLNZDcZcXcNcccXZcNcccXacNZZDcZZXcNQXccNcccXcDcNZccXccNcccXCZccNZcDcZPQKLNXZccXTcNZcccDcVGHNccXZXcNcccXccNDcZcQNXcccXZNZacZXcNZ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 128 122 80
Agility 131 125 80
Stamina 22276 20251 20183
Intellect 22000 19587 18443
Spirit 559 559 350
Health 458267 429917 0
Mana 300000 300000 0
Spell Power 32886 27484 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 20.77% 14.82% 3706
Spell Haste 28.33% 16.40% 6969
Mana Per 5 9625 8730 0
Attack Power 119 102 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.79% 9.79% 3706
Melee Haste 16.40% 16.40% 6969
Swing Speed 28.04% 16.40% 6969
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.66% 21.66% 1700

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Frost_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
glyphs=evocation/icy_veins/ice_lance

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/frost_armor
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/cold_snap,if=health.pct<30
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
actions+=/icy_veins,if=target.time_to_die<22
actions+=/blood_fury,if=target.time_to_die<12
actions+=/frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
actions+=/ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
actions+=/frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
actions+=/frost_bomb,if=!ticking
actions+=/icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
actions+=/mirror_image
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
actions+=/jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
actions+=/blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
actions+=/frostbolt,if=debuff.frostbolt.stack<3
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.fingers_of_frost.react
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/frostbolt
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=mastery_crit
chest=robes_of_the_burning_scroll,id=87010,gems=160int_160int,enchant=80all,reforge=crit_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=160int_160int_160int
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=160int,enchant=175hit,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18443
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3706
# gear_haste_rating=6969
# gear_mastery_rating=1700
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Monk_Windwalker_1h_T14H : 114512 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114512.2 114512.2 61.98 / 0.05% 5220 / 4.6% 8310.7 12.9 12.8 Energy 7.29% 53.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

Charts

http://8.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:160751|106358|89637|37888|22152|18878|12972&chds=0,321502&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++160751++rising_sun_kick,C79C6E,0,0,15|t++106358++fists_of_fury,C79C6E,1,0,15|t++89637++blackout_kick,C79C6E,2,0,15|t++37888++tiger_palm,C79C6E,3,0,15|t++22152++melee_main_hand,C79C6E,4,0,15|t++18878++jab,C79C6E,5,0,15|t++12972++melee_off_hand,C79C6E,6,0,15&chtt=Monk_Windwalker_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,18,17,11,11,9,6,5,4,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473&chl=blackout_kick|melee_main_hand|rising_sun_kick|fists_of_fury|melee_off_hand|tiger_strikes_melee|jab|xuen_the_white_tiger: crackling_tiger_lightning|tiger_palm|blackout_kick_dot|xuen_the_white_tiger: melee&chtt=Monk_Windwalker_1h_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:0001122344478767776541110zzyxvvvuuuuutssrrrrqponmmllllkjjjjkkllllllmmnnnnmmmmllllkkjjjjiiihhhhhhhggggggggggggggggghhhhiiiijjjkkkkkkllllllllkkkkjjjjjiiiihhhhhhggggggggggggfgghijjklmnnoppqrrsstuuuuuuuutttssssrrrrqqqppppoonnmmmllkkkjjjiiiiiiiiiiiiiijjjjjjkkkkkkkkkkkkkkjjjjjjjiiiiiihhhhhhhgggggggghhhhhhhiiiiiijjjjjjjjjkkkkkkkkkkkkkkkkkjjjjjjiiiiiihhhhhhhhhijjkllmnooopqqrrrsttttttsssssssssssssssrrrrrrqqppoonnmmlllkkjjjjiiiiiiiijjjjjjjjjjjjjjjjjjjjjkkkkkkkkkkkkkjjjjjjjjjjiiiiiiiiiijjjjjjjjjjjjjjjkjjjjjjjjjjjjjjjjjjjjjjjjjiiiiiiihhhhhhhhiiiiiiijiijjjjjkkll&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=114512|max=179116&chxp=1,1,64,100&chtt=Monk_Windwalker_1h_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,5,6,0,8,11,26,35,56,81,99,141,162,244,293,363,422,464,546,567,572,639,611,598,548,561,484,465,388,332,274,228,169,181,110,89,68,53,31,21,15,9,7,4,7,1,1,3,0,1&chds=0,639&chbh=5&chxt=x&chxl=0:|min=103472|avg=114512|max=127903&chxp=0,1,45,100&chtt=Monk_Windwalker_1h_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:33.5,25.9,11.2,11.1,10.4,0.7,7.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ffffff&chl=jab 151.1s|blackout_kick 116.6s|rising_sun_kick 50.6s|fists_of_fury 49.9s|tiger_palm 46.8s|invoke_xuen 3.1s|waiting 32.9s&chtt=Monk_Windwalker_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Monk_Windwalker_1h_T14H 114512
berserking 0 0.0% 3.0 180.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
blackout_kick 23208 20.3% 112.5 3.94sec 92909 89637 65195 135138 92909 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.46 112.46 0.00 0.00 1.0365 0.0000 10448118.37 10448118.37 0.00 89637.25 89637.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.90 60.38% 65194.76 56287 75768 65199.63 64068 66579 4426542 4426542 0.00
crit 44.56 39.62% 135138.07 115950 156082 135165.08 131961 138993 6021577 6021577 0.00
DPS Timeline Chart

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combo_breaker_bok.react
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:(null)
  • description:Kick with a blast of Chi energy, dealing ${8*$<low>} to ${8*$<high>} Physical damage.$?s128595[ If behind the target, you deal an additional $m2% damage over $128531d. If in front of the target, you are instantly healed for $m2% of the damage done.][] $?s117967[ Also causes you to gain Shuffle, increasing your parry chance by $115307s1% and your Stagger amount by an additional $115307s2% for $115307d.][]$?s116645[ Also empowers you with Serpent's Zeal, causing you and your summoned Jade Serpent Statue to heal nearby injured targets equal to $127722m1% of your auto-attack damage. Stacks up to 2 times.][]
blackout_kick_dot 3461 3.0% 112.4 3.94sec 13869 0 0 0 0 0.0% 0.0% 0.0% 0.0% 340.1 4583 0 4583 0.0% 0.0% 75.5%

Stats details: blackout_kick_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.37 112.37 340.07 340.07 0.0000 1.0000 1558464.79 1558464.79 0.00 4582.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 340.1 100.00% 4582.81 1911 13178 4584.54 3687 5599 1558465 1558465 0.00
DPS Timeline Chart

Action details: blackout_kick_dot

Static Values
  • id:128531
  • school:physical
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128531
  • name:Blackout Kick
  • school:physical
  • tooltip:$w1 damage every $t1 sec.
  • description:$@spelldesc100784
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:9280.62
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
energizing_brew 0 0.0% 7.0 62.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: energizing_brew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.01 7.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: energizing_brew

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35
Spelldata
  • id:115288
  • name:Energizing Brew
  • school:physical
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
fists_of_fury 11756 10.3% 15.4 26.11sec 343913 106358 0 0 0 0.0% 0.0% 0.0% 0.0% 61.5 60804 125711 86283 39.3% 0.0% 10.2%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 61.52 61.52 3.2336 0.7491 5307880.82 5307880.82 0.00 106357.57 106357.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.4 60.75% 60804.13 58389 71032 60810.99 59279 63192 2272214 2272214 0.00
crit 24.1 39.25% 125710.91 120282 146327 125723.58 121240 131203 3035667 3035667 0.00
DPS Timeline Chart

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w2 damage every $t2 sec. $?s125671[Parrying all attacks.][]
  • description:Pummel all targets in front of you with rapid hand strikes, stunning them and dealing ${7.5*$<low>} to ${7.5*$<high>} damage immediately and every $113656t2 sec for $113656d. Damage is spread evenly over all targets.$?s125671[ Your parry chance is increased by 100% while channeling.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: fists_of_fury_tick

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
invoke_xuen 0 0.0% 3.0 180.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: invoke_xuen

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: invoke_xuen

Static Values
  • id:123904
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.invoke_xuen.enabled
Spelldata
  • id:123904
  • name:Invoke Xuen, the White Tiger
  • school:nature
  • tooltip:(null)
  • description:Invokes the White Tiger Celestial, summoning an effigy at the command of the caster. The effigy will assist you, attacking your primary target and also inflicting tiger lightning every $123999t1 sec to 3 nearby enemies within $123996A1 yards dealing $123996o1 damage over $123996d. Lasts for $d. |CFFFFFFFFBrewmaster|R Xuen will also taunt the target, forcing it to attack him.
jab 6333 5.5% 145.7 3.09sec 19567 18878 13729 28461 19567 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: jab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.74 145.74 0.00 0.00 1.0365 0.0000 2851580.75 2851580.75 0.00 18877.51 18877.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.99 60.37% 13729.22 11858 15962 13730.45 13500 14017 1208011 1208011 0.00
crit 57.75 39.63% 28460.58 24428 32882 28466.48 27783 29154 1643570 1643570 0.00
DPS Timeline Chart

Action details: jab

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
Spelldata
  • id:100780
  • name:Jab
  • school:physical
  • tooltip:(null)
  • description:You Jab the target, dealing ${1.5*$<low>} to ${1.5*$<high>} damage and generating $s2 Chi.
melee_main_hand 19878 17.4% 223.5 2.01sec 40043 22152 33703 70676 40043 39.7% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 223.45 223.45 0.00 0.00 1.8076 0.0000 8947550.72 8947550.72 0.00 22152.12 22152.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.56 17.26% 33702.58 28015 41457 33703.96 32451 35526 1299467 1299467 0.00
crit 88.82 39.75% 70675.55 59409 85402 70694.83 68715 72602 6277106 6277106 0.00
glance 53.57 23.97% 25593.04 21629 31093 25598.30 24851 26585 1370978 1370978 0.00
miss 42.51 19.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 11642 10.2% 224.9 2.00sec 23302 12972 19579 41130 23302 39.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.86 224.86 0.00 0.00 1.7964 0.0000 5239784.83 5239784.83 0.00 12971.66 12971.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.74 17.23% 19579.06 16662 24536 19579.45 18655 20505 758520 758520 0.00
crit 89.43 39.77% 41129.64 33343 50544 41142.26 39979 42445 3678117 3678117 0.00
glance 53.96 23.99% 14885.29 12497 18402 14888.40 14396 15529 803148 803148 0.00
miss 42.74 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rising_sun_kick 18068 15.8% 48.8 9.28sec 166618 160751 117029 242370 166618 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.84 48.84 0.00 0.00 1.0365 0.0000 8137226.23 8137226.23 0.00 160751.21 160751.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.52 60.44% 117029.18 98421 136382 117033.35 114092 120271 3454245 3454245 0.00
crit 19.32 39.56% 242370.26 202748 280948 242435.48 234067 253276 4682981 4682981 0.00
DPS Timeline Chart

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.rising_sun_kick.remains<=3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:(null)
  • description:You kick upwards, dealing ${14.4*$<low>} to ${14.4*$<high>} damage and applying Mortal Wounds to the target. Also causes all targets within $130320A1 yards to take an increased $130320m1% damage from your abilities for $130320d. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
tiger_palm 3943 3.4% 45.2 9.97sec 39270 37888 27463 56911 39270 40.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.20 45.20 0.00 0.00 1.0365 0.0000 1774969.65 1774969.65 0.00 37887.84 37887.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.08 59.91% 27462.75 23716 31925 27465.08 26615 28479 743614 743614 0.00
crit 18.12 40.09% 56910.83 48855 65765 56925.99 54606 60048 1031355 1031355 0.00
DPS Timeline Chart

Action details: tiger_palm

Static Values
  • id:100787
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.tiger_power.stack<3|buff.tiger_power.remains<=3
Spelldata
  • id:100787
  • name:Tiger Palm
  • school:physical
  • tooltip:(null)
  • description:Attack with the palm of your hand, dealing ${3*$<low>} to ${3*$<high>} damage. Also grants you Tiger Power, causing your attacks to ignore $125359m1% of enemies' armor for $125359d. Stacks up to $m2 times.
tiger_strikes_melee 9290 8.1% 108.6 4.11sec 38504 0 26929 56017 38504 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_strikes_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.61 108.61 0.00 0.00 0.0000 0.0000 4181855.26 4181855.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.39 60.21% 26928.83 16662 41457 26934.42 24373 29580 1760860 1760860 0.00
crit 43.22 39.79% 56017.18 34324 85402 56026.77 48396 63570 2420995 2420995 0.00
DPS Timeline Chart

Action details: tiger_strikes_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tigereye_brew_use 0 0.0% 7.3 58.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigereye_brew_use

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.27 7.27 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigereye_brew_use

Static Values
  • id:116740
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
Spelldata
  • id:116740
  • name:Tigereye Brew
  • school:physical
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
pet - xuen_the_white_tiger 24252 / 6933
crackling_tiger_lightning 17176 4.3% 22.8 18.84sec 96338 92947 0 0 0 0.0% 0.0% 0.0% 0.0% 113.4 13608 27778 19400 40.9% 0.0% 88.5%

Stats details: crackling_tiger_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.84 22.84 113.40 113.40 1.0365 1.0000 2200045.94 2200045.94 0.00 16050.06 92946.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.0 59.12% 13607.91 11910 18111 13610.03 12778 14519 912405 912405 0.00
crit 46.4 40.88% 27778.19 23821 36223 27786.69 25876 30258 1287641 1287641 0.00
DPS Timeline Chart

Action details: crackling_tiger_lightning

Static Values
  • id:123996
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123996
  • name:Crackling Tiger Lightning
  • school:nature
  • tooltip:Taking $m1 damage every $t1 sec.
  • description:$@spelldesc123904
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.459500
  • base_td:291.20
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
melee 7077 1.8% 200.3 2.00sec 4518 7123 3286 6703 4518 41.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.32 200.32 0.00 0.00 0.6343 0.0000 905101.47 905101.47 0.00 7122.97 7122.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.78 34.34% 3286.40 3023 3988 3286.60 3151 3448 226053 226053 0.00
crit 83.42 41.65% 6703.00 6045 7976 6704.05 6382 6985 559187 559187 0.00
glance 48.11 24.02% 2491.38 2267 2991 2491.66 2360 2618 119862 119862 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.035771
  • base_dd_min:1158.00
  • base_dd_max:1158.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.7sec 180.7sec 6.64% 8.71%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.55%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
combo_breaker_bok 34.8 0.1 12.7sec 12.7sec 13.14% 30.81%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_bok
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_bok_1:13.1%

Spelldata details

  • id:116768
  • name:Combo Breaker: Blackout Kick
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
combo_breaker_tp 34.1 0.8 13.0sec 12.7sec 15.80% 75.18%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_tp
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_tp_1:15.8%

Spelldata details

  • id:118864
  • name:Combo Breaker: Tiger Palm
  • tooltip:Your next Tiger Palm costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel_oh 13.8 16.6 32.5sec 14.4sec 55.94% 55.29%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:55.9%
energizing_brew 7.0 0.0 62.2sec 62.2sec 9.26% 9.27%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_energizing_brew
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • energizing_brew_1:9.3%

Spelldata details

  • id:115288
  • name:Energizing Brew
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:1.01%
relic_of_xuen 7.8 0.0 61.1sec 61.1sec 25.51% 25.51%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.5%
synapse_springs_2 7.9 0.0 60.7sec 60.7sec 17.41% 17.41%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
terror_in_the_mists 7.5 0.0 63.4sec 63.4sec 32.81% 32.81%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tiger_power 1.3 43.9 235.7sec 10.0sec 99.25% 99.52%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_power
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_power_1:0.5%
  • tiger_power_2:0.4%
  • tiger_power_3:98.3%

Spelldata details

  • id:125359
  • name:Tiger Power
  • tooltip:Your attacks ignore $m1% armor.
  • description:$@spelldesc100787
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
tiger_stance 0.0 0.0 0.0sec 0.0sec 0.08% 0.08%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_stance_1:0.1%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:(null)
  • description:Increases damage done by $m3% and increases the amount of Chi generated by your Jab and Expel Harm abilities by $m4.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
tiger_strikes 27.3 0.0 16.2sec 16.2sec 17.69% 23.76%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_strikes
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_strikes_1:2.4%
  • tiger_strikes_2:6.3%
  • tiger_strikes_3:2.4%
  • tiger_strikes_4:6.5%

Spelldata details

  • id:120273
  • name:Tiger Strikes
  • tooltip:Attack speed increased by $s1%, and the next $n autoattacks cause an extra attack.
  • description:$@spelldesc120272
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tigereye_brew 8.2 69.1 57.8sec 5.8sec 91.84% 100.00%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_1:10.9%
  • tigereye_brew_2:10.5%
  • tigereye_brew_3:9.7%
  • tigereye_brew_4:9.6%
  • tigereye_brew_5:10.0%
  • tigereye_brew_6:9.8%
  • tigereye_brew_7:9.7%
  • tigereye_brew_8:9.5%
  • tigereye_brew_9:9.5%
  • tigereye_brew_10:2.6%

Spelldata details

  • id:125195
  • name:Tigereye Brew
  • tooltip:Use Tigereye Brew to consume charges to gain 2% damage per charge.
  • description:$@spelldesc123980
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:1.01%
tigereye_brew_use 7.3 0.0 58.8sec 58.8sec 23.78% 23.78%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew_use
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_use_1:23.8%

Spelldata details

  • id:116740
  • name:Tigereye Brew
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 395.4sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
windsong_crit 7.7 2.2 53.6sec 40.8sec 23.23% 22.31%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:23.2%
windsong_haste 7.7 2.2 54.0sec 40.8sec 23.15% 22.54%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:23.2%
windsong_mastery 7.7 2.2 53.7sec 40.6sec 23.23% 22.45%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:23.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Monk_Windwalker_1h_T14H
blackout_kick Chi 112.5 155.6 1.4 1.4 67136.8
fists_of_fury Chi 15.4 46.3 3.0 3.0 114637.6
jab Energy 145.7 5829.5 40.0 40.0 489.2
rising_sun_kick Chi 48.8 97.7 2.0 2.0 83308.9
tiger_palm Chi 45.2 11.2 0.2 0.2 158244.9
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.91 5350.46 2.97 62.77 1.16%
chi Chi 145.74 312.54 2.14 0.00 0.00%
combo_breaker_savings Chi 68.63 103.27 1.50 0.00 0.00%
energizing_brew Energy 167.02 414.68 2.48 2.86 0.69%
Resource RPS-Gain RPS-Loss
Energy 12.79 12.94
Chi 0.69 0.69
Combat End Resource Mean Min Max
Health 454543.00 454543.00 454543.00
Mana 300000.00 300000.00 300000.00
Energy 36.17 0.09 100.00
Chi 1.62 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%
xuen_the_white_tiger-Energy Cap 0.8%

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 114512.17
Minimum 103471.68
Maximum 127903.17
Spread ( max - min ) 24431.49
Range [ ( max - min ) / 2 * 100% ] 10.67%
Standard Deviation 3162.2259
5th Percentile 109407.45
95th Percentile 119848.43
( 95th Percentile - 5th Percentile ) 10440.99
Mean Distribution
Standard Deviation 31.6223
95.00% Confidence Intervall ( 114450.19 - 114574.15 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 29
0.1% Error 2929
0.1 Scale Factor Error with Delta=300 85362
0.05 Scale Factor Error with Delta=300 341451
0.01 Scale Factor Error with Delta=300 8536295
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 114512.17

Damage

Sample Data
Count 10000
Mean 48447431.42

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 397.88
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 stance
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 0.00 chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 7.93 use_item,name=bonebreaker_gauntlets
9 3.01 berserking
A 3.93 rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
B 14.15 tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
C 0.00 run_action_list,name=aoe,if=num_targets>5
D 0.00 run_action_list,name=st,if=num_targets<=5
actions.st
# count action,conditions
J 7.27 tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
K 7.01 energizing_brew,if=energy<=35
L 3.01 invoke_xuen,if=talent.invoke_xuen.enabled
M 44.91 rising_sun_kick
N 15.43 fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
O 0.00 zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
P 32.77 blackout_kick,if=buff.combo_breaker_bok.react
Q 27.67 tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
R 3.38 tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
S 145.74 jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
T 79.68 blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

Sample Sequence

589LSABSBBSTSMSTSTSTSMPSTSBTSMSQTSTSKTQSMSPTSTSPMSQTSQTJSMSTSN8SMSTSQTTSMSTSQTSMQSPTSNPSASKPQSQTSMSQTSTQTJSMSNPSSMP8STSBTSMSTTSPMSTSBSMSNSQMSKTSTSQTSMSTJSQNSMSPTST9L8SMQSTSQTSMSNSTSMSTBSQMSTSTSKMQSTSTJSNSMSTSPQTSMSQT8SNSMSTSTSBPSMQSQNSMPQSTSQTSKMSQTSQTJSMPRSTSPQMSTSQTS8NSMQSQTSQTMSSTSTSMTSQTSNSMSQKTSQSTJMSSTSNSMSPBT9LS8TMSTSTSTSMSBNSMQSQTSPTS7MSQTSNPQSAJSQSKTSQTMSRSTTSTSMS8NSQTSMSTSQTSMSNSM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 184 175 80
Agility 21699 19301 18268
Stamina 22010 20009 19896
Intellect 257 245 80
Spirit 271 271 80
Health 454543 426529 0
Mana 300000 300000 0
Energy 100 100 0
Chi 4 4 0
Spell Power 0 0 0
Spell Hit 15.02% 15.02% 2552
Spell Crit 12.89% 7.89% 3564
Spell Haste 20.43% 14.70% 6246
Mana Per 5 6000 6000 0
Attack Power 48105 38927 0
Melee Hit 7.51% 7.51% 2552
Melee Crit 35.65% 28.74% 3564
Melee Haste 14.70% 14.70% 6246
Swing Speed 26.17% 14.70% 6246
Expertise 7.51% / 7.51% 7.51% / 7.51% 2555
Armor 18523 18523 18523
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.16% 16.16% 2121

Talents

Level
15 Celerity Tiger's Lust Momentum
30 Chi Wave Zen Sphere Chi Burst
45 Power Strikes Ascension Chi Brew
60 Deadly Reach Charging Ox Wave Leg Sweep
75 Healing Elixirs Dampen Harm Diffuse Magic
90 Rushing Jade Wind Invoke Xuen, the White Tiger Chi Torpedo

Profile

#!./simc

monk="Monk_Windwalker_1h_T14H"
origin="unknown"
level=90
race=troll
spec=windwalker
role=hybrid
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/stance
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=auto_attack
actions+=/chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
actions+=/virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
actions+=/tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/run_action_list,name=st,if=num_targets<=5

actions.aoe=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.aoe+=/energizing_brew,if=energy<=35
actions.aoe+=/rushing_jade_wind,if=talent.rushing_jade_wind.enabled
actions.aoe+=/rising_sun_kick,if=chi=4&(!talent.chi_burst.enabled|num_targets<=7)
actions.aoe+=/spinning_crane_kick

actions.st=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.st+=/energizing_brew,if=energy<=35
actions.st+=/invoke_xuen,if=talent.invoke_xuen.enabled
actions.st+=/rising_sun_kick
actions.st+=/fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
actions.st+=/zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
actions.st+=/blackout_kick,if=buff.combo_breaker_bok.react
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
actions.st+=/jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
actions.st+=/blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

head=red_crane_headpiece,id=87086,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=red_crane_spaulders,id=87088,gems=160agi,enchant=200agi_100crit,reforge=exp_hit
back=arrow_breaking_windcloak,id=87044,enchant=180hit
chest=red_crane_tunic,id=87084,gems=160agi_160agi,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_hit
hands=bonebreaker_gauntlets,id=86964,gems=160agi,enchant=170haste,addon=synapse_springs_mark_ii
waist=tomb_raiders_girdle,id=87022,gems=160agi_160agi_160agi
legs=red_crane_leggings,id=87087,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140agi,reforge=crit_hit
finger1=regails_band_of_the_endless,id=90503,enchant=160agi,reforge=crit_hit
finger2=painful_thorned_ring,id=86974,enchant=160agi,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=windsong,reforge=exp_hit
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=exp_haste

# Gear Summary
# gear_strength=80
# gear_agility=18268
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2555
# gear_hit_rating=2552
# gear_crit_rating=3564
# gear_haste_rating=6246
# gear_mastery_rating=2121
# gear_armor=18523
# meta_gem=agile_primal
# tier14_2pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=windsong
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Paladin_Retribution_T14H : 116184 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
116184.5 116184.5 52.43 / 0.05% 4380 / 3.8% 86.7 1281.9 1279.2 Mana 6.62% 54.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
Glyphs
  • templars_verdict
  • double_jeopardy
  • mass_exorcism

Charts

http://8.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:274264|84811|83415|64207|47864|31560|12162&chds=0,548527&chco=F58CBA,F58CBA,C79C6E,F58CBA,F58CBA,C79C6E,C79C6E&chm=t++274264++execution_sentence,F58CBA,0,0,15|t++84811++hammer_of_wrath,F58CBA,1,0,15|t++83415++templars_verdict,C79C6E,2,0,15|t++64207++exorcism,F58CBA,3,0,15|t++47864++judgment,F58CBA,4,0,15|t++31560++crusader_strike,C79C6E,5,0,15|t++12162++melee,C79C6E,6,0,15&chtt=Paladin_Retribution_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,15,14,11,9,8,6,6,5,5,4,0&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,C79C6E,C79C6E,F58CBA,F58CBA,C79C6E,F58CBA,F58CBA,F58CBA,C79C6E,F58CBA&chl=hand_of_light|hammer_of_wrath|templars_verdict|melee|censure|exorcism|crusader_strike|judgment|execution_sentence|seal_of_truth_proc|guardian_of_ancient_kings: melee|ancient_fury&chtt=Paladin_Retribution_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:hkoosvwwxyyz1357787764200xusrpnlljigfecbZYXXWVUSTSSSRQQPPPPPPPQQQRRSSSSSSTTTUUUUUUUTTSRQQQQQRRRSTTUUVVWXYYZabccccbbbaaZaaZZZYZZZZYYXWWWWWWWWVVVUUTSRRQQQQQQQQQQQQQQQQQQQQRRQRQQQPPPOPPPPPQRRSTTUVWXXYZabcddeeeeedddccccccbbaaZZYYXXWWWVUUTSSRQQPPPPPPPQQQRRRSRSSSSTTTTTTTTTSSRQQQQQPPQPPPQQQRSSTUUVWXXYZZabcceefghjklnooppqqqqqpqpoommljhgdcaZYXXWVVUUUTTTSSSSSTTTTTTTTSSSSRSSSSSTTTUUTUUUVVWXXYYYZZZZYZZYZZZaaabbbbbbbbbbbbbbaaaZYYXXWVVVUUUUUVVVVWWWWWWXXXXXXXXWWVVUUUUUUUUUUUUUUUUUUVVVWWWWWXXXXXXXYYZZabccddddeeefffffeedccaaZYXXWWVVUUUUTTTTUUUUUUUUUUTTSSSRRRRRRQQQPP&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=116184|max=284850&chxp=1,1,41,100&chtt=Paladin_Retribution_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,4,7,11,27,31,68,98,132,167,213,257,282,379,414,446,503,539,546,517,509,568,464,479,458,414,375,335,318,249,252,219,164,145,104,77,65,43,37,21,14,17,11,10,3,1,2,0,1&chds=0,568&chbh=5&chxt=x&chxl=0:|min=107994|avg=116184|max=126579&chxp=0,1,44,100&chtt=Paladin_Retribution_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.5,19.2,18.7,13.8,13.3,4.0,2.1,6.6&chds=0,100&chdls=ffffff&chco=C79C6E,F58CBA,C79C6E,F58CBA,F58CBA,F58CBA,F58CBA,ffffff&chl=crusader_strike 101.2s|hammer_of_wrath 86.7s|templars_verdict 84.1s|judgment 62.0s|exorcism 60.0s|inquisition 18.0s|execution_sentence 9.5s|waiting 29.8s&chtt=Paladin_Retribution_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Paladin_Retribution_T14H 116184
ancient_fury 506 0.4% 2.0 300.91sec 112195 0 92123 190446 112195 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 224390.44 224390.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.59 79.58% 92122.55 67595 107755 88357.55 0 107755 146631 146631 0.00
crit 0.41 20.41% 190445.71 139246 221974 69966.87 0 221974 77759 77759 0.00
DPS Timeline Chart

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86704
  • name:Ancient Fury
  • school:holy
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Power, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.107000
  • base_dd_min:229.65
  • base_dd_max:310.71
avenging_wrath 0 0.0% 5.2 95.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 5.16 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:95.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
censure 10459 9.0% 326.4 1.38sec 14424 0 0 0 0 0.0% 0.0% 0.0% 0.0% 200.2 19060 39456 23509 21.8% 0.0% 99.5%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 326.37 326.37 200.24 200.24 0.0000 2.2383 4707599.96 4707599.96 0.00 10503.16 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 326.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 156.6 78.18% 19059.68 2860 33965 19072.85 18282 19953 2983967 2983967 0.00
crit 43.7 21.82% 39456.31 11784 69968 39489.42 35278 45233 1723633 1723633 0.00
DPS Timeline Chart

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:107.34
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
crusader_strike 7090 6.1% 82.3 5.48sec 38806 31560 31519 64967 38806 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.29 82.29 0.00 0.00 1.2296 0.0000 3193309.72 3193309.72 0.00 31560.37 31560.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.35 78.20% 31519.13 28773 45511 31520.78 30408 32659 2028275 2028275 0.00
crit 17.93 21.79% 64967.05 59272 93752 64974.81 60158 73191 1165035 1165035 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:3.29
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage plus $m1 and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage plus $m1.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:632.63
  • base_dd_max:632.63
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
execution_sentence 5778 5.0% 7.8 61.08sec 333407 274264 0 0 0 0.0% 0.0% 0.0% 0.0% 77.0 27740 57034 33736 20.5% 0.0% 17.1%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 7.79 77.02 77.02 1.2156 1.0000 2598373.45 2598373.45 0.00 30040.74 274263.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.3 79.53% 27739.71 8396 193728 27779.65 19539 34672 1699216 1699216 0.00
crit 15.8 20.47% 57033.62 17296 399080 57164.30 23369 157519 899158 899158 0.00
DPS Timeline Chart

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc114916 |CFFFFFFFFStay of Execution|R If used on friendly targets, the falling hammer heals the target for ${$SPH*$114917m2/1000+26.72716306*$114917m1} healing over $114917d. This healing is dealt slowly at first and increases over time, culminating in a final burst of healing.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.222096
  • base_td:486.46
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
exorcism 8553 7.4% 51.1 8.85sec 75414 64207 62088 128732 75414 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.06 51.06 0.00 0.00 1.1746 0.0000 3851000.58 3851000.58 0.00 64206.89 64206.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.85 80.00% 62087.74 39991 106725 62115.55 56754 67472 2536495 2536495 0.00
crit 10.21 20.00% 128731.71 82382 219853 128775.56 103595 185558 1314505 1314505 0.00
DPS Timeline Chart

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:10.96
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:(null)
  • description:Forcefully attempt to expel the evil from the target with a blast of Holy Light. Causes $s1 Holy damage and generates a charge of Holy Power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.677000
  • base_dd_min:6577.24
  • base_dd_max:7342.84
guardian_of_ancient_kings 0 0.0% 2.0 300.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: guardian_of_ancient_kings

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: guardian_of_ancient_kings

Static Values
  • id:86698
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up&buff.avenging_wrath.up
Spelldata
  • id:86698
  • name:Guardian of Ancient Kings
  • school:holy
  • tooltip:Protected by a Guardian of Ancient Kings. Attacks by you and your Guardian infuse you with Ancient Power and unleash Ancient Fury when your Guardian departs.
  • description:Summons a Guardian of Ancient Kings to help you deal damage for $d. The Guardian of Ancient Kings will attack your current enemy. Both your attacks and the attacks of the Guardian will infuse you with Ancient Power that is unleashed as Ancient Fury when the Guardian departs.
hammer_of_wrath 16355 14.1% 71.7 6.26sec 102618 84811 83208 171182 102641 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.67 71.65 0.00 0.00 1.2100 0.0000 7354505.28 7354505.28 0.00 84811.40 84811.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.82 77.91% 83207.71 44873 127994 83376.74 77183 92319 4645037 4645037 0.00
crit 15.83 22.09% 171181.98 92439 263668 171488.83 138902 215163 2709468 2709468 0.00
DPS Timeline Chart

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1800.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:(null)
  • description:Hurls a magical hammer that strikes an enemy for $s1 Holy damage$?s53503[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health$?s53503[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1746.58
  • base_dd_max:1930.43
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
hand_of_light 22815 19.6% 222.8 2.02sec 46099 0 46099 0 46099 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 222.76 222.76 0.00 0.00 0.0000 0.0000 10268788.02 10268788.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 222.76 100.00% 46098.82 12956 154338 46141.44 42065 51828 10268788 10268788 0.00
DPS Timeline Chart

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:28772.85
  • base_dd_max:28772.85
inquisition 0 0.0% 15.2 30.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.19 15.19 0.00 0.00 1.1826 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
judgment 6592 5.7% 50.3 8.88sec 59069 47864 47972 99342 59069 21.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.27 50.27 0.00 0.00 1.2341 0.0000 2969470.55 2969470.55 0.00 47863.81 47863.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.41 78.40% 47971.52 32635 113049 47960.41 44668 52557 1890601 1890601 0.00
crit 10.86 21.60% 99341.61 67229 232881 99278.94 81102 145621 1078870 1078870 0.00
DPS Timeline Chart

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:4.38
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:(null)
  • description:A magic attack that unleashes the energy of a Seal to cause $s1 Holy damage$?s105424[ and generates one charge of Holy Power.]?s111529[, generate one charge of Holy Power, and apply the Physical Vulnerability debuff to a target. |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:623.49
  • base_dd_max:623.49
melee 12141 10.5% 175.3 2.56sec 31189 12162 26614 54890 31189 21.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.28 175.28 0.00 0.00 2.5644 0.0000 5466760.07 5466760.07 0.00 12162.41 12162.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.98 54.19% 26613.71 23292 37536 26622.84 25571 27716 2527847 2527847 0.00
crit 38.25 21.82% 54890.02 47981 77324 54911.71 51199 60304 2099346 2099346 0.00
glance 42.04 23.98% 19970.68 17469 28152 19977.69 18616 21659 839567 839567 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth_proc 5438 4.7% 326.4 1.38sec 7503 0 6086 12572 7503 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 326.37 326.37 0.00 0.00 0.0000 0.0000 2448767.44 2448767.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 255.06 78.15% 6085.60 4155 8705 6087.27 5948 6229 1552193 1552193 0.00
crit 71.31 21.85% 12572.42 8560 17932 12575.98 11913 13426 896574 896574 0.00
DPS Timeline Chart

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:9839.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over $31803d.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463s1% additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R $@spelldesc31803
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.12
templars_verdict 15570 13.4% 68.8 6.43sec 101892 83415 82598 170086 101892 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.82 68.82 0.00 0.00 1.2215 0.0000 7012691.42 7012691.42 0.00 83414.91 83414.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.64 77.93% 82597.69 72783 115128 82621.14 79349 85878 4430325 4430325 0.00
crit 15.18 22.06% 170086.11 149933 237163 170111.74 152498 200115 2582366 2582366 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:physical
  • tooltip:(null)
  • description:A powerful weapon strike that consumes 3 charges of Holy Power to deal $s1% weapon damage plus $s2.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:628.06
  • base_dd_max:628.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
pet - guardian_of_ancient_kings 36118 / 4886
melee 36118 4.1% 48.5 6.95sec 44681 35500 47523 0 44681 0.0% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.50 48.50 0.00 0.00 1.2586 0.0000 2167068.16 2167068.16 0.00 35499.52 35499.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.91 76.10% 47523.20 33219 57828 47523.07 43696 51334 1754100 1754100 0.00
glance 11.59 23.90% 35628.32 24914 43371 35625.09 30046 41249 412968 412968 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 245.1 300.9sec 1.3sec 13.53% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_ancient_power
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • ancient_power_1:0.1%
  • ancient_power_2:0.0%
  • ancient_power_3:0.1%
  • ancient_power_4:0.2%
  • ancient_power_5:0.1%
  • ancient_power_6:0.1%
  • ancient_power_7:0.3%
  • ancient_power_8:0.1%
  • ancient_power_9:0.0%
  • ancient_power_10:0.1%
  • ancient_power_11:0.2%
  • ancient_power_12:0.1%
  • ancient_power_13:0.1%
  • ancient_power_14:0.2%
  • ancient_power_15:0.2%
  • ancient_power_16:0.1%
  • ancient_power_17:0.1%
  • ancient_power_18:0.2%
  • ancient_power_19:0.1%
  • ancient_power_20:11.2%

Spelldata details

  • id:86700
  • name:Ancient Power
  • tooltip:Strength increased by $s1%. When Guardian of Ancient Kings departs, the Paladin releases Ancient Fury, causing Holy damage split among all enemies within $86704a1 yards.
  • description:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
avenging_wrath 5.2 0.0 95.7sec 95.7sec 33.21% 38.60%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • avenging_wrath_1:33.2%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.24%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 13.3 13.3 33.6sec 16.4sec 51.16% 50.60%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:51.2%
darkmist_vortex 7.1 0.0 66.8sec 66.8sec 31.04% 31.04%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.0%
glyph_double_jeopardy 8.9 41.3 54.1sec 8.9sec 72.72% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:72.7%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:(null)
  • description:Judging a target increases the damage of your next Judgment by $121027s1%, but only if used on a different second target.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inquisition 5.1 10.1 79.5sec 30.4sec 97.62% 99.14%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inquisition_1:97.6%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 305.9sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
relic_of_xuen 9.4 0.0 50.0sec 50.0sec 30.80% 30.80%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:30.8%
synapse_springs_2 7.8 0.0 61.1sec 61.1sec 17.12% 17.12%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T14H
crusader_strike Mana 82.3 148120.2 1800.0 1800.0 21.6
exorcism Mana 51.1 122555.0 2400.0 2400.0 31.4
hammer_of_wrath Mana 71.7 129003.8 1800.0 1800.0 57.0
inquisition Holy Power 15.2 45.6 3.0 3.0 0.0
judgment Mana 50.3 177959.7 3540.0 3540.0 16.7
templars_verdict Holy Power 68.8 206.5 3.0 3.0 33964.1
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 89031.92 49.41 46111.08 34.12%
sword_of_light Mana 224.80 487363.35 2167.96 321926.37 39.78%
holy_power_crusader_strike Holy Power 82.28 82.28 1.00 0.00 0.00%
holy_power_exorcism Holy Power 51.06 51.06 1.00 0.00 0.00%
holy_power_hammer_of_wrath Holy Power 71.65 71.65 1.00 0.00 0.00%
holy_power_judgments_of_the_bold Holy Power 50.27 50.27 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 1279.17 1281.93
Holy Power 0.57 0.56
Combat End Resource Mean Min Max
Health 463797.00 463797.00 463797.00
Mana 58764.35 54510.00 60000.00
Holy Power 3.27 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 75.6 5.9sec
the_art_of_war 35.0 12.6sec
wasted_art_of_war 3.1 106.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 116184.46
Minimum 107993.79
Maximum 126579.26
Spread ( max - min ) 18585.47
Range [ ( max - min ) / 2 * 100% ] 8.00%
Standard Deviation 2674.9218
5th Percentile 111980.06
95th Percentile 120740.81
( 95th Percentile - 5th Percentile ) 8760.74
Mean Distribution
Standard Deviation 26.7492
95.00% Confidence Intervall ( 116132.03 - 116236.89 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2036
0.1 Scale Factor Error with Delta=300 61080
0.05 Scale Factor Error with Delta=300 244323
0.01 Scale Factor Error with Delta=300 6108096
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 116184.46

Damage

Sample Data
Count 10000
Mean 50095656.92

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 406.25
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
4 0.00 seal_of_truth
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 0.00 rebuke
8 0.00 seal_of_truth,if=mana.pct>=90|seal.none
9 0.00 seal_of_insight,if=mana.pct<=20
A 1.00 mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
B 1.00 auto_attack
C 15.19 inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
D 2.00 guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
E 5.16 avenging_wrath,if=buff.inquisition.up
F 7.79 use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
G 7.79 execution_sentence,if=buff.inquisition.up
H 41.01 templars_verdict,if=holy_power=5
I 71.67 hammer_of_wrath
J 42.20 wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
K 51.06 exorcism
L 82.29 crusader_strike
M 50.27 judgment
N 27.82 templars_verdict,if=holy_power>=3

Sample Sequence

BKLMCEDFGILIMIHIKIHIKIHILIHILIHIKICIKLHMKLHMLNMLNKLMNLMLNKLMCFGKLMNLMLNKLMNLMLNMLKCKLMEIKHILJIHJIKJIHJILJIHJILJIHICFGIKJLMNLMNLKMLNMLNLMKCLMLNMLKNKLMNLMLNKKLCKFGKLMNLEIMJIHJIKJIHJILJIHJIKJICJILJIHJIKJIHJILJMHLNKMLNLMKLCMLFGNMLKNLMLNMLKNLMLCKMLNMLKNLMKEILHILJIHJILJIHJICDAJIKFGILIHJILJIHJKLMHKLMHLNMLKCLMLNMLKLMHLKNKLIMHKILCFGJILMHIKLHJIKLHEJILJIHJILJIHJICJIKJILJIHJIKJIHJILJIHJIKJIHLMIHLMCIFGKLJIHLMIHLKJIHLM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20774 18420 17360
Agility 190 181 80
Stamina 22671 20610 20440
Intellect 200 190 80
Spirit 205 205 80
Health 463797 434943 0
Mana 60000 60000 0
Holy Power 5 5 0
Spell Power 22988 18545 0
Spell Hit 15.16% 15.16% 2607
Spell Crit 13.45% 8.45% 3020
Spell Haste 24.50% 18.57% 7893
Mana Per 5 1500 1500 0
Attack Power 45978 37090 0
Melee Hit 7.67% 7.67% 2607
Melee Crit 15.05% 10.05% 3020
Melee Haste 18.57% 18.57% 7893
Swing Speed 30.43% 18.57% 7893
Expertise 7.49% 7.49% 2548
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.37% 9.74% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 42.88% 32.38% 4453

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Burden of Guilt
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence

Profile

#!./simc

paladin="Paladin_Retribution_T14H"
origin="unknown"
level=90
race=tauren
spec=retribution
role=hybrid
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
glyphs=templars_verdict/double_jeopardy/mass_exorcism

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
actions.precombat+=/seal_of_truth
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=rebuke
actions+=/seal_of_truth,if=mana.pct>=90|seal.none
actions+=/seal_of_insight,if=mana.pct<=20
actions+=/mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
actions+=/auto_attack
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
actions+=/guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
actions+=/avenging_wrath,if=buff.inquisition.up
actions+=/use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
actions+=/execution_sentence,if=buff.inquisition.up
actions+=/templars_verdict,if=holy_power=5
actions+=/hammer_of_wrath
actions+=/wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
actions+=/exorcism
actions+=/crusader_strike
actions+=/judgment
actions+=/templars_verdict,if=holy_power>=3

head=white_tiger_helmet,id=87101,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=white_tiger_battleplate,id=87099,gems=320haste_320haste_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=320haste,enchant=180str,reforge=hit_haste
hands=white_tiger_gauntlets,id=87100,gems=320haste,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=320haste_80str_160hit_80str_160haste_120haste,reforge=mastery_exp
legs=white_tiger_legplates,id=87102,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=320haste_60hit,enchant=140mastery
finger1=dread_shadow_ring,id=87158,reforge=hit_haste
finger2=ring_of_the_bladed_tempest,id=86957
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel,reforge=crit_haste

# Gear Summary
# gear_strength=17360
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2548
# gear_hit_rating=2607
# gear_crit_rating=3020
# gear_haste_rating=7893
# gear_mastery_rating=4453
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=white_tiger_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Priest_Disc_T14H : 71324 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
17259.3 17259.3 22.15 / 0.13% 1852 / 10.7% 2.1 71323.9 71323.9 36.35 / 0.05% 3043 / 4.3% 12.7 5614.9 5032.4 Mana 17.93% 31.0 100.0%
Origin http://mop.chardev.org/profile/383-Priest_Disc_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
Glyphs
  • power_word_shield
  • prayer_of_mending
  • renew

Charts

http://0.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:130407|91501|83184|74305&chds=0,260813&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++130407++power_word_shield,F58CBA,0,0,15|t++91501++greater_heal,F58CBA,1,0,15|t++83184++renew,F58CBA,2,0,15|t++74305++penance_heal,F58CBA,3,0,15&chtt=Priest_Disc_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:45,28,13,10,3&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=greater_heal|penance_heal|power_word_shield|renew|power_word_shield_glyph&chtt=Priest_Disc_T14H Healing Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:0w1y1zywzxzz558023402z3z3zz1213z1z1011zvwuvvwsuurqqorqmjnmnnqqnqnppoorsprppoqlonomqqopnnmmkjkjjhhefcbbbWXXZYZabbddefijklmnopqqqpqppoommlljiiihggfedccaaZZYYXXWWVVUUUVVWXYZabcdfgjkmnprstuttttssqqponljigfdcbbZZYYXXWWWWVVVVVVVVVWWXYZZbbddeeghjjlmooppqppppoooonnlljjhgfedcbbaZYYXXWWVVVVVVVVWXXZZbbddefggiiklnnpppppppoooonnmmkkihgfedcbaaYYXXWWVVUUUUUVVWXYZabddffhiklnoqrsststssrrqqponmkjhfedbbZZYXWWVVUUTTTUTUTUUWWXYaacdeefghijklmoopppppoooonnnnmmkkihgfedcbaZYXWWVVUUTTTTTUVWXYZbbdeffhhijklnnpopopoooonnmnmmlkjihgeeccaaZYXWVVUUTTSTSTTVVXXZacceeggiikkmmnopppppop&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=17259|max=123903&chxp=1,1,14,100&chtt=Priest_Disc_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,2,4,1,4,8,12,31,30,68,81,104,163,214,243,341,418,467,494,555,567,583,583,603,599,543,525,451,408,353,303,259,204,182,144,117,94,70,59,36,25,18,13,6,3,3,2,2,3&chds=0,603&chbh=5&chxt=x&chxl=0:|min=64493|avg=71324|max=78574&chxp=0,1,49,100&chtt=Priest_Disc_T14H HPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.4,27.2,8.9,8.4,2.1,17.9&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=greater_heal 159.5s|penance_heal 122.7s|power_word_shield 40.1s|renew 37.8s|mindbender 9.4s|waiting 80.8s&chtt=Priest_Disc_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Disc_T14H 17259
berserking 0 0.0% 3.0 181.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
divine_aegis 11890 68.9% 0.0 1.#Rsec 0 0 33850 0 33850 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 158.06 0.00 0.00 0.0000 0.0000 5350221.71 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.06 100.00% 33849.50 0 59609 33830.90 27637 39363 5350222 0 0.00
DPS Timeline Chart
greater_heal 32484 45.5% 78.5 5.66sec 185836 91501 137775 275354 185836 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 78.54 78.54 0.00 0.00 2.0310 0.0000 14595219.97 14595219.97 0.00 91500.92 91500.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.10 65.07% 137774.70 136103 142682 137777.09 136227 139477 7040549 7040549 0.00
crit 27.44 34.93% 275354.14 272205 285364 275353.15 272205 279383 7554671 7554671 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.inner_focus.up
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
greater_heal_divine_aegis 0 0.0% 27.4 16.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 27.44 27.44 0.00 0.00 0.0000 0.0000 0.00 3507739.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.44 100.00% 0.00 0 0 0.00 0 0 0 3507739 100.00
HPS Timeline Chart

Action details: greater_heal_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:85609.31
  • base_dd_max:85609.31
inner_focus 0 0.0% 15.9 29.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inner_focus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.91 15.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inner_focus

Static Values
  • id:89485
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:89485
  • name:Inner Focus
  • school:physical
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
mindbender 0 0.0% 7.2 60.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.16 7.16 0.00 0.00 1.3134 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=20
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
penance_heal 20227 28.4% 64.8 6.99sec 140709 74305 0 0 0 0.0% 0.0% 0.0% 0.0% 194.0 39755 79545 47065 18.4% 0.0% 23.7%

Stats details: penance_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 64.79 64.79 194.01 193.72 1.8937 0.5494 9117249.45 9117249.45 0.00 74305.21 74305.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 158.1 81.63% 39754.99 30374 41394 39753.81 39560 39958 6286425 6286425 0.00
crit 35.6 18.37% 79544.80 60748 82788 79540.27 77808 80818 2830824 2830824 0.00
HPS Timeline Chart

Action details: penance_heal

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9300.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.grace.down
Spelldata
  • id:47540
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: penance_heal_tick

Static Values
  • id:47666
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47666
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc47540
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:6202.59
  • base_dd_max:7008.46
penance_heal_tick_divine_aegis 0 0.0% 35.6 12.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: penance_heal_tick_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 35.59 35.59 0.00 0.00 0.0000 0.0000 0.00 1314399.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.59 100.00% 0.00 0 0 0.00 0 0 0 1314400 100.00
HPS Timeline Chart

Action details: penance_heal_tick_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:24836.30
  • base_dd_max:24836.30
power_word_shield 9392 (11627) 13.2% (16.3%) 31.9 14.48sec 164190 130407 33316 0 33316 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 31.86 126.86 0.00 0.00 1.2591 0.0000 4226512.05 4247159.30 0.49 130406.60 130406.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.86 100.00% 33316.09 0 59609 33316.18 32764 33656 4226512 4247159 0.49
HPS Timeline Chart

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:18300.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!cooldown.rapture.remains
Spelldata
  • id:17
  • name:Power Word: Shield
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:1.870900
  • base_dd_min:19428.31
  • base_dd_max:19428.31
power_word_shield_glyph 2234 3.1% 31.9 14.48sec 31552 0 26656 53326 31552 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 31.86 31.86 0.00 0.00 0.0000 0.0000 1005400.84 1005400.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.02 81.64% 26656.02 26371 27646 26656.32 26371 26929 693464 693464 0.00
crit 5.85 18.36% 53326.14 52742 55292 53169.99 0 55292 311937 311937 0.00
HPS Timeline Chart

Action details: power_word_shield_glyph

Static Values
  • id:55672
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:55672
  • name:Glyph of Power Word: Shield
  • school:physical
  • tooltip:(null)
  • description:$55672s1% of the absorb from your Power Word: Shield spell is converted into healing.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:26371.06
  • base_dd_max:26371.06
power_word_shield_glyph_divine_aegis 0 0.0% 5.8 67.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 5.85 5.85 0.00 0.00 0.0000 0.0000 0.00 144839.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.85 100.00% 0.00 0 0 0.00 0 0 0 144840 100.00
HPS Timeline Chart

Action details: power_word_shield_glyph_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:16587.60
  • base_dd_max:16587.60
renew 6986 9.8% 30.0 15.01sec 104556 83184 0 0 0 0.0% 0.0% 0.0% 0.0% 122.4 21664 43342 25662 18.4% 0.0% 65.8%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 30.05 30.05 122.43 122.43 1.2569 2.4216 3141866.28 3141866.28 0.00 9399.58 83184.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.9 81.56% 21663.55 21412 22447 21663.98 21468 21891 2163121 2163121 0.00
crit 22.6 18.44% 43342.02 42824 44894 43342.88 42824 44319 978745 978745 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!dot.renew.ticking&mana>20000
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
renew_divine_aegis 0 0.0% 22.6 18.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: renew_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 22.58 22.58 0.00 0.00 0.0000 0.0000 0.00 454435.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.58 100.00% 0.00 0 0 0.00 0 0 0 454435 100.00
HPS Timeline Chart

Action details: renew_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:12847.25
  • base_dd_max:12847.25
pet - mindbender 22932 / 5369
melee 22932 31.1% 85.5 4.56sec 28311 23703 29944 59926 28311 15.5% 15.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.47 85.47 0.00 0.00 1.1944 0.0000 2419801.46 2419801.46 0.00 23702.86 23702.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.91 45.53% 29944.34 26088 31773 29943.92 28696 31247 1165263 1165263 0.00
crit 13.26 15.51% 59926.16 52175 63547 59924.63 56036 63547 794597 794597 0.00
glance 20.48 23.96% 22462.15 19566 23830 22460.41 21327 23564 459942 459942 0.00
dodge 6.41 7.49% 0.00 0 0 0.00 0 0 0 0 0.00
miss 6.42 7.51% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 21.2 19.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.16 21.16 0.00 0.00 1.3005 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 21.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 181.0sec 6.63% 8.46%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 7.73%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
inner_focus 15.9 0.0 29.1sec 29.8sec 10.60% 20.15%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_focus
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_focus_1:10.6%

Spelldata details

  • id:89485
  • name:Inner Focus
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:45.00
  • default_chance:0.00%
jade_spirit 8.0 0.0 59.2sec 59.2sec 20.94% 21.76%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:20.9%
mindbender-shadowcrawl 21.2 0.0 19.0sec 19.0sec 85.38% 86.39%

Buff details

  • buff initial source:Priest_Disc_T14H_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:20.0%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Disc_T14H
greater_heal Mana 78.5 1109988.2 14133.1 14133.1 13.1
penance_heal Mana 64.8 602592.6 9300.0 9300.0 15.1
power_word_shield Mana 31.9 583127.7 18300.0 18300.0 9.0
renew Mana 30.0 234386.1 7800.0 7800.0 13.4
Resource Gains Type Count Total Average Overflow
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1801.91 972424.29 539.66 0.00 0.00%
mindbender Mana 72.65 871802.40 12000.00 0.00 0.00%
Rapture Mana 31.86 393375.98 12345.12 12582.00 3.10%
Resource RPS-Gain RPS-Loss
Mana 5032.39 5614.92
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 37398.26 12.70 128169.59
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 22.6 19.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 17259.28
Minimum 12913.66
Maximum 21931.38
Spread ( max - min ) 9017.72
Range [ ( max - min ) / 2 * 100% ] 26.12%
Standard Deviation 1130.2830
5th Percentile 15437.20
95th Percentile 19141.79
( 95th Percentile - 5th Percentile ) 3704.59
Mean Distribution
Standard Deviation 11.3028
95.00% Confidence Intervall ( 17237.13 - 17281.44 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 164
0.1% Error 16474
0.1 Scale Factor Error with Delta=300 10905
0.05 Scale Factor Error with Delta=300 43623
0.01 Scale Factor Error with Delta=300 1090581
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 17259.28

Damage

Sample Data
Count 10000
Mean 5350221.71

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 71323.87
Minimum 64492.67
Maximum 78573.90
Spread ( max - min ) 14081.23
Range [ ( max - min ) / 2 * 100% ] 9.87%
Standard Deviation 1854.6562
5th Percentile 68417.03
95th Percentile 74503.42
( 95th Percentile - 5th Percentile ) 6086.38
Mean Distribution
Standard Deviation 18.5466
95.00% Confidence Intervall ( 71287.52 - 71360.22 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2597
0.1 Scale Factor Error with Delta=300 29363
0.05 Scale Factor Error with Delta=300 117454
0.01 Scale Factor Error with Delta=300 2936368
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 71323.87

Heal

Sample Data
Count 10000
Mean 32086248.59

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 232.64
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=75
6 7.16 shadowfiend,if=mana.pct<=20
7 0.00 hymn_of_hope,if=pet.shadowfiend.active
8 3.00 berserking
9 15.91 inner_focus
A 0.00 power_infusion,if=talent.power_infusion.enabled
B 31.86 power_word_shield,if=!cooldown.rapture.remains
C 64.79 penance_heal,if=buff.grace.down
D 15.89 greater_heal,if=buff.inner_focus.up
E 0.00 penance_heal
F 30.05 renew,if=!dot.renew.ticking&mana>20000
G 62.96 greater_heal,if=mana>20000

Sample Sequence

89BCDFGGCBG5GFCGG9BDCFGGGBCGFGG9CBDGFC6GGBCFGGC9DBFCGGCGBFCGG9CDBFCGCC6BFGCGG9CBDFCGGCBCCFCBC9DC6FBCGGC8FGBGCG9DFBCGCCBCCFC6BC9DFGCGBGCFGGB9CDFCBCFCCBC6FGCG9BDCFGGBCGFGCG9DCCBCCF6CBGGC89DFBGCGGFBCGGC9DCCBCC6FCBGG9CDFBCGGCFGBCGG9CD

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.40% 34.90% 3577

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Disc_T14H"
origin="http://mop.chardev.org/profile/383-Priest_Disc_T14H.html"
level=90
race=troll
spec=discipline
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
glyphs=power_word_shield/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=75
actions+=/shadowfiend,if=mana.pct<=20
actions+=/hymn_of_hope,if=pet.shadowfiend.active
actions+=/berserking
actions+=/inner_focus
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/power_word_shield,if=!cooldown.rapture.remains
actions+=/penance_heal,if=buff.grace.down
actions+=/greater_heal,if=buff.inner_focus.up
actions+=/penance_heal
actions+=/renew,if=!dot.renew.ticking&mana>20000
actions+=/greater_heal,if=mana>20000

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Holy_T14H : 71132 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
2580.0 2580.0 8.48 / 0.33% 710 / 27.5% 0.0 71131.7 71131.7 49.60 / 0.07% 4143 / 5.8% 21.0 3377.3 2880.0 Mana 0.00% 36.3 100.0%
Origin http://mop.chardev.org/profile/326-Priest_Holy_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
Glyphs
  • circle_of_healing
  • prayer_of_mending
  • renew

Charts

http://9.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:129141|92660|65950|34000&chds=0,258282&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++129141++greater_heal,F58CBA,0,0,15|t++92660++flash_heal,F58CBA,1,0,15|t++65950++holy_word_serenity,F58CBA,2,0,15|t++34000++heal,F58CBA,3,0,15&chtt=Priest_Holy_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:33,16,16,14,11,10&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=heal|echo_of_light|renew|greater_heal|flash_heal|holy_word_serenity&chtt=Priest_Holy_T14H Healing Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:eiiijkkmmnnqrttvwy00122244455677777876644321110zyxwvutsrrqqpoonnnmmmllkkkjjjiiiihhhhhgggffffffffffeeeeeeeeeeeeedeeeeeeddedddddddddddddcccccccccccccccccccccccccccccccccccccccdddedeeeeeeeeeeeeeeddcccbaaZYYXXXWWWWWWWWWWWXXXYYZaaabbccddeeefffggggghhhhhhhhhhhhhhhhhhhggggggggggffffffffffeeeeeeeeeeeedddddddddddddddddddddddddddddddddcccccccccccccccccccccccccccccdddddeeeeeeeeeeeeedddddccccbbbbbbbbbcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccbcbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbcbcbcccccccd&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=2580|max=132069&chxp=1,1,2,100&chtt=Priest_Holy_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,1,0,3,1,3,9,9,21,23,44,56,96,110,180,238,298,372,441,506,567,658,651,672,643,621,585,527,487,409,362,332,258,189,176,134,84,64,43,44,40,15,7,9,4,2,4,1&chds=0,672&chbh=5&chxt=x&chxl=0:|min=60221|avg=71132|max=80950&chxp=0,1,53,100&chtt=Priest_Holy_T14H HPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:69.7,11.1,8.1,7.7,1.9,0.8,0.5,0.0&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,9482C9,F58CBA,ffffff&chl=heal 314.0s|holy_word_serenity 50.1s|flash_heal 36.6s|greater_heal 34.7s|hymn_of_hope 8.8s|shadowfiend 3.4s|renew 2.4s|waiting 0.0s&chtt=Priest_Holy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Holy_T14H 2580
berserking 0 0.0% 3.0 181.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
chakra 0 0.0% 14.9 31.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.94 14.94 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: chakra

Static Values
  • id:81208
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:81208
  • name:Chakra: Serenity
  • school:holy
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
echo_of_light 11385 16.0% 246.9 1.82sec 20731 0 0 0 0 0.0% 0.0% 0.0% 0.0% 443.6 11541 0 11541 0.0% 0.0% 98.4%

Stats details: echo_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 246.95 246.95 443.59 443.59 0.0000 1.0000 5119435.24 5119435.24 0.00 11540.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 246.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 443.6 100.00% 11540.90 2453 48728 11568.29 9484 13412 5119435 5119435 0.00
HPS Timeline Chart

Action details: echo_of_light

Static Values
  • id:77489
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:77489
  • name:Echo of Light
  • school:holy
  • tooltip:Healing $w every sec.
  • description:Heals every sec for $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:8511.80
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
flash_heal 7523 10.6% 28.7 15.25sec 118084 92660 79365 158768 118084 48.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flash_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 28.72 28.72 0.00 0.00 1.2744 0.0000 3391627.72 3391627.72 0.00 92659.83 92659.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.72 51.24% 79365.20 78504 82299 79364.72 78504 81666 1167986 1167986 0.00
crit 14.01 48.76% 158768.05 157008 164597 158769.49 157008 163332 2223642 2223642 0.00
HPS Timeline Chart

Action details: flash_heal

Static Values
  • id:2061
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.surge_of_light.up
Spelldata
  • id:2061
  • name:Flash Heal
  • school:holy
  • tooltip:(null)
  • description:Heals a friendly target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.642000
  • base_dd_min:15767.86
  • base_dd_max:18324.82
greater_heal 10081 14.0% 29.1 9.58sec 153913 129141 105618 211230 153913 45.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 29.08 29.08 0.00 0.00 1.1918 0.0000 4475645.50 4475645.50 0.00 129141.17 129141.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.78 54.27% 105618.47 104694 109756 105621.38 104694 108743 1666818 1666818 0.00
crit 13.30 45.73% 211229.75 209389 219511 211240.17 209389 219511 2808828 2808828 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.serendipity.react>=2&mana.pct>40
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
heal 23659 33.4% 149.9 2.99sec 71232 34000 49520 99060 71232 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 149.90 149.90 0.00 0.00 2.0950 0.0000 10677289.48 10677289.48 0.00 34000.43 34000.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.20 56.17% 49519.92 48973 51339 49520.75 49139 49869 4169647 4169647 0.00
crit 65.69 43.83% 99060.08 97945 102678 99061.90 98361 100049 6507643 6507643 0.00
HPS Timeline Chart

Action details: heal

Static Values
  • id:2050
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:2050
  • name:Heal
  • school:holy
  • tooltip:(null)
  • description:Heal your target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.024000
  • base_dd_min:9847.03
  • base_dd_max:11443.84
holy_word_serenity 7331 10.3% 39.4 11.55sec 83809 65950 62764 125557 83809 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_word_serenity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 39.41 39.41 0.00 0.00 1.2708 0.0000 3302784.05 3302784.05 0.00 65950.16 65950.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.20 66.48% 62764.00 62097 65101 62764.06 62217 63362 1644455 1644455 0.00
crit 13.21 33.52% 125556.83 124193 130202 125560.98 124193 128199 1658330 1658330 0.00
HPS Timeline Chart

Action details: holy_word_serenity

Static Values
  • id:88684
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.chakra_serenity.up
Spelldata
  • id:88684
  • name:Holy Word: Serenity
  • school:holy
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.300000
  • base_dd_min:12366.55
  • base_dd_max:14517.25
renew 11152 15.7% 2.0 1.#Rsec 2556637 2121998 0 0 0 0.0% 0.0% 0.0% 0.0% 182.6 19146 38303 27512 43.7% 0.0% 99.4%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.96 1.96 182.57 182.57 1.2048 2.4534 5022769.95 5022769.95 0.00 11154.65 2121998.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.8 56.33% 19146.49 18941 19857 19146.60 19040 19270 1969153 1969153 0.00
crit 79.7 43.67% 38303.37 37883 39714 38303.60 38031 38577 3053617 3053617 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:-0.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowfiend 0 0.0% 2.8 181.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 0.00 0.00 1.2343 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=65
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
pet - shadowfiend 35464 / 2580
melee 35464 100.0% 27.7 12.35sec 41851 38458 44406 88857 41851 15.3% 15.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.73 27.73 0.00 0.00 1.0882 0.0000 1160542.40 1160542.40 0.00 38457.85 38457.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.67 45.68% 44405.72 38959 47436 44407.70 40992 47436 562532 562532 0.00
crit 4.24 15.28% 88857.02 77918 94873 87775.69 0 94873 376612 376612 0.00
glance 6.65 23.97% 33302.12 29219 35577 33270.40 0 35577 221399 221399 0.00
dodge 2.10 7.57% 0.00 0 0 0.00 0 0 0 0 0.00
miss 2.08 7.49% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.5 72.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.49 5.49 0.00 0.00 1.2378 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.1sec 181.1sec 6.63% 6.49%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.57%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
hymn_of_hope 1.0 4.0 0.0sec 1.7sec 3.34% 3.34%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_hymn_of_hope
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • hymn_of_hope_1:3.3%

Spelldata details

  • id:64904
  • name:Hymn of Hope
  • tooltip:Maximum mana increased by $s2%.
  • description:Restores $64904s1% mana to $64901s2 nearby low mana friendly party or raid targets every $64901t1 sec for $64901d, and increases their total maximum mana by $64904s2% for $64904d. Maximum of $*4;s2 mana restores. The Priest must channel to maintain the spell.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
jade_spirit 8.7 0.0 54.3sec 54.3sec 22.88% 22.70%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
serendipity 8.8 20.0 51.4sec 15.2sec 73.20% 73.20%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serendipity
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serendipity_1:21.1%
  • serendipity_2:52.1%

Spelldata details

  • id:63735
  • name:Serendipity
  • tooltip:Reduces the cast time of your next Greater Heal or Prayer of Healing by $s1% and mana cost by $s2%.
  • description:When you heal with Binding Heal or Flash Heal, the cast time of your next Greater Heal or Prayer of Healing spell is reduced by $63735s1% and mana cost reduced by $63735s2%. Stacks up to 2 times. Lasts $63735d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
serenity 39.4 0.0 11.6sec 11.6sec 52.09% 38.11%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serenity
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serenity_1:52.1%

Spelldata details

  • id:88684
  • name:Holy Word: Serenity
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
  • max_stacks:
  • duration:6.00
  • cooldown:10.00
  • default_chance:0.00%
surge_of_light 28.8 2.4 15.2sec 14.0sec 8.25% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_surge_of_light
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_light_1:6.1%
  • surge_of_light_2:2.1%

Spelldata details

  • id:114255
  • name:Surge of Light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • description:You have a $109186s1% chance when you Smite, Heal, Flash Heal, Binding Heal or Greater Heal to cause your next Flash Heal to be instant cast and have no mana cost. Limit 2 charges.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
shadowfiend-shadowcrawl 5.5 0.0 72.4sec 72.4sec 83.35% 85.85%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.1%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
chakra_serenity

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_chakra_serenity
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chakra_serenity_1:100.0%

Spelldata details

  • id:81208
  • name:Chakra: Serenity
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:30.00
  • default_chance:1.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Holy_T14H
greater_heal Mana 29.1 415620.1 14292.8 14292.8 10.8
heal Mana 149.9 854403.2 5700.0 5700.0 12.5
holy_word_serenity Mana 39.4 236450.4 6000.0 6000.0 14.0
renew Mana 2.0 15323.9 7800.0 7800.0 327.8
Resource Gains Type Count Total Average Overflow
hymn_of_hope_max_mana Mana 1.00 44995.50 45000.00 0.00 0.00%
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1801.91 969109.88 537.82 0.00 0.00%
shadowfiend Mana 23.55 220011.61 9340.49 0.00 0.00%
hymn_of_hope Mana 5.00 33596.64 6720.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Mana 2879.96 3377.25
Combat End Resource Mean Min Max
Health 458421.00 458421.00 458421.00
Mana 76872.75 5430.95 162605.54
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 79.7 5.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 2579.98
Minimum 1162.09
Maximum 4273.95
Spread ( max - min ) 3111.86
Range [ ( max - min ) / 2 * 100% ] 60.31%
Standard Deviation 432.7828
5th Percentile 1903.11
95th Percentile 3323.61
( 95th Percentile - 5th Percentile ) 1420.50
Mean Distribution
Standard Deviation 4.3278
95.00% Confidence Intervall ( 2571.50 - 2588.46 )
Normalized 95.00% Confidence Intervall ( 99.67% - 100.33% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1080
0.1% Error 108094
0.1 Scale Factor Error with Delta=300 1598
0.05 Scale Factor Error with Delta=300 6395
0.01 Scale Factor Error with Delta=300 159890
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 2579.98

Damage

Sample Data
Count 10000
Mean 0.00

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 71131.73
Minimum 60220.57
Maximum 80950.38
Spread ( max - min ) 20729.81
Range [ ( max - min ) / 2 * 100% ] 14.57%
Standard Deviation 2530.8615
5th Percentile 67158.74
95th Percentile 75444.78
( 95th Percentile - 5th Percentile ) 8286.05
Mean Distribution
Standard Deviation 25.3086
95.00% Confidence Intervall ( 71082.13 - 71181.33 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 48
0.1% Error 4863
0.1 Scale Factor Error with Delta=300 54678
0.05 Scale Factor Error with Delta=300 218715
0.01 Scale Factor Error with Delta=300 5467898
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 71131.73

Heal

Sample Data
Count 10000
Mean 31989551.94

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 272.55
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=50
6 2.76 shadowfiend,if=mana.pct<=65
7 1.00 hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
8 3.00 berserking
9 14.94 chakra_serenity
A 1.96 renew,if=!ticking
B 39.41 holy_word,if=buff.chakra_serenity.up
C 29.08 greater_heal,if=buff.serendipity.react>=2&mana.pct>40
D 28.72 flash_heal,if=buff.surge_of_light.up
E 150.67 heal

Sample Sequence

89ABEEEEEEBEDEEEEBEEEEE9EBEEEDEEBEEEEEBDCCC69CCBCCCCCCCBDEDCC5CCBCCCD9CDEBEEEDDBEEEEEBE9EDEEBEEEEEBEEEEE9BEEEEEBEEEEE8BEDE9EDEBEEEEEBEEEDDBE9EDDEBEEEEEBEE679ABEEEEEBEDEEEBEE9EEDBCCCCCCDBDEEEEBE9EEEEBEEEEEBEEEE9EBEEEEEBE8EEEEBEE9EEEBEEEEDBEEEDEB9EEEDEBEDEE6BEEEE9DBEEDEEBE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.70% 17.45% 3577

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Holy_T14H"
origin="http://mop.chardev.org/profile/326-Priest_Holy_T14H.html"
level=90
race=troll
spec=holy
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
glyphs=circle_of_healing/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=50
actions+=/shadowfiend,if=mana.pct<=65
actions+=/hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
actions+=/berserking
actions+=/chakra_serenity
actions+=/renew,if=!ticking
actions+=/holy_word,if=buff.chakra_serenity.up
actions+=/greater_heal,if=buff.serendipity.react>=2&mana.pct>40
actions+=/flash_heal,if=buff.surge_of_light.up
actions+=/heal

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Shadow_T14H : 110650 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
110649.6 110649.6 42.66 / 0.04% 3535 / 3.2% 24.3 4323.0 4130.6 Mana 0.00% 35.1 100.0%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:360573|236630|196218|127388|113024|103044|102278|52376&chds=0,721146&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9&chm=t++360573++devouring_plague,9482C9,0,0,15|t++236630++shadow_word_pain,9482C9,1,0,15|t++196218++vampiric_touch,9482C9,2,0,15|t++127388++halo_damage,9482C9,3,0,15|t++113024++shadow_word_death,9482C9,4,0,15|t++103044++mind_spike,000066,5,0,15|t++102278++mind_blast,9482C9,6,0,15|t++52376++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,10,9,9,8,6,6,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mind_spike|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=Priest_Shadow_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:457787775433434441yxutromkjhggggeddcbbbbbcccccccddddddcdddccccbaaZZZZaabbbcccccdcccccbccbbaZZYXXXXXXXYYYZZaaaaaabbbbbbbaaaZZZZZZZaabbcccccccccbbbbaaaZZYYXXXXXYYZZabbbcccccccccccccccdddeffghhiijjjjjjjiihgffedccbbaaaaaabbbccccccccbbbaaaZZYYXXXWWWXXXYYZaaabbbbbccccccccbbbaaZZZZaaaabbbbbbbbaaaaaaaaZZZYYYYYZZZaabbbcccccddddddddddddddddeeeefffffffffffffeeeeddddddeefhijklmoopqqqrrrrrrrqponmllkjjiiiiiiiiiihhhhhhhggggggggghhhiiijjkkklllllllllllllllllkkkkkkkkllllllllllllllllllmmmmmmmmmmmmmmmmmmmlllllllllllmmmmmmmmmmnnnnnnoooooooonnnmmmlllllkkkkkjjjllmmmnnoopp&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=110650|max=212372&chxp=1,1,52,100&chtt=Priest_Shadow_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,5,8,16,21,42,46,76,108,137,224,249,324,404,435,487,536,596,638,643,622,561,553,527,439,422,326,303,295,239,181,170,89,79,47,39,36,20,19,15,7,4,4,1,0,2,0,0,1&chds=0,643&chbh=5&chxt=x&chxl=0:|min=103453|avg=110650|max=120355&chxp=0,1,43,100&chtt=Priest_Shadow_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.2,12.0,10.0,6.1,5.5,4.9,4.0,2.8,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 244.1s|mind_blast 53.9s|mind_spike 44.9s|vampiric_touch 27.3s|shadow_word_pain 24.9s|devouring_plague 21.9s|shadow_word_death 17.9s|halo_damage 12.7s|shadowfiend 3.0s&chtt=Priest_Shadow_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T14H 110650
berserking 0 0.0% 3.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 2.99 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6225 (17557) 5.6% (15.9%) 18.8 25.08sec 421316 360573 125076 259225 149422 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 18.77 0.00 0.00 1.1685 0.0000 2804256.51 2804256.51 0.00 360572.83 360572.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.36 81.85% 125076.41 112133 177071 125072.34 116959 134147 1921361 1921361 0.00
crit 3.41 18.15% 259225.24 230994 364766 252802.95 0 364766 882895 882895 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2706 2.4% 49.0 9.15sec 24885 0 20829 43219 24910 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.95 48.91 0.00 0.00 0.0000 0.0000 1218251.33 1218251.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.99 81.77% 20828.91 18622 29405 20829.60 19412 22531 832990 832990 0.00
crit 8.91 18.23% 43219.33 38362 60574 43236.13 0 57592 385261 385261 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8626 7.8% 18.8 25.08sec 206981 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.9 20709 42900 24759 18.3% 0.0% 25.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.77 18.77 156.89 156.89 0.0000 0.7429 3884493.82 3884493.82 0.00 33325.56 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.3 81.75% 20708.67 18622 29405 20708.23 20004 21563 2656048 2656048 0.00
crit 28.6 18.25% 42899.86 38362 60574 42898.87 39402 46938 1228446 1228446 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3605 3.3% 11.0 42.53sec 147946 127388 123910 257527 148434 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.97 10.94 0.00 0.00 1.1614 0.0000 1623555.22 1623555.22 0.00 127387.62 127387.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 81.65% 123910.49 113411 170370 123885.77 114314 137962 1106570 1106570 0.00
crit 2.01 18.35% 257526.76 233627 350962 229018.84 0 350962 516985 516985 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 12229 11.1% 46.6 9.73sec 118250 102278 98845 204861 118250 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.58 46.58 0.00 0.00 1.1562 0.0000 5508511.77 5508511.77 0.00 102278.43 102278.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.06 81.70% 98845.45 89948 142709 98861.91 95305 103123 3761761 3761761 0.00
crit 8.53 18.30% 204861.37 185293 293981 204909.40 0 266732 1746750 1746750 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 21642 (28391) 19.6% (25.7%) 138.8 3.20sec 92106 52376 0 0 0 0.0% 0.0% 0.0% 0.0% 312.7 26043 54007 31158 18.3% 0.0% 50.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.78 138.78 312.72 312.72 1.7586 0.7229 9743550.29 9743550.29 0.00 52375.82 52375.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 138.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 255.5 81.71% 26042.90 23869 37691 26049.35 25514 26636 6654394 6654394 0.00
crit 57.2 18.29% 54006.51 49170 77644 54020.92 51103 57368 3089156 3089156 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6750 6.1% 97.8 4.50sec 31073 0 25992 53864 31085 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.81 97.77 0.00 0.00 0.0000 0.0000 3039187.17 3039187.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.90 81.73% 25992.45 23869 37691 25997.85 25039 27751 2076882 2076882 0.00
crit 17.87 18.27% 53863.87 49170 77644 53881.22 49578 60263 962305 962305 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 10277 9.3% 38.9 11.17sec 119025 103044 99618 206461 119025 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.88 38.88 0.00 0.00 1.1551 0.0000 4627168.43 4627168.43 0.00 103043.50 103043.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.81 81.84% 99617.95 90737 144415 99628.60 92688 107950 3169246 3169246 0.00
crit 7.06 18.16% 206460.80 186918 297495 206222.51 0 253496 1457923 1457923 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4486 4.1% 15.3 5.51sec 131901 113024 109914 227937 131901 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.34 15.34 0.00 0.00 1.1670 0.0000 2023130.15 2023130.15 0.00 113024.03 113024.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.48 81.37% 109913.88 87347 138878 109989.08 100324 119760 1371824 1371824 0.00
crit 2.86 18.63% 227936.58 179935 286089 217284.76 0 286089 651306 651306 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9983 (13102) 9.0% (11.8%) 21.6 21.22sec 272842 236630 0 0 0 0.0% 0.0% 0.0% 0.0% 224.7 15361 31792 20003 28.2% 0.0% 98.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.62 21.62 224.74 224.74 1.1530 1.9755 4495558.86 4495558.86 0.00 12581.84 236630.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.3 71.75% 15361.46 13998 22099 15363.29 14900 15826 2477131 2477131 0.00
crit 63.5 28.25% 31792.32 28835 45524 31795.56 30145 33938 2018428 2018428 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3119 2.8% 70.3 6.34sec 19982 0 15372 31789 19995 28.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.28 70.23 0.00 0.00 0.0000 0.0000 1404341.63 1404341.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.46 71.84% 15371.78 13998 22099 15374.45 14702 16307 775599 775599 0.00
crit 19.78 28.16% 31789.06 28835 45524 31792.28 29375 35348 628743 628743 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.9 181.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.93 2.93 0.00 0.00 1.0390 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3756 3.4% 75.8 5.87sec 22321 0 19158 38580 22705 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.78 74.50 0.00 0.00 0.0000 0.0000 1691520.75 1691520.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.90 81.74% 19158.31 17405 27698 19161.09 18290 20084 1166680 1166680 0.00
crit 13.60 18.26% 38580.19 34811 55396 38593.40 34811 44241 524841 524841 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9070 (11908) 8.2% (10.8%) 23.7 19.21sec 226077 196218 0 0 0 0.0% 0.0% 0.0% 0.0% 198.7 17191 35631 20557 18.3% 0.0% 96.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.72 23.72 198.65 198.65 1.1522 2.1815 4083696.69 4083696.69 0.00 11639.12 196217.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.4 81.74% 17190.71 15681 25120 17194.13 16584 17781 2791545 2791545 0.00
crit 36.3 18.26% 35631.03 32302 51748 35639.87 33491 39348 1292152 1292152 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2838 2.6% 62.1 7.11sec 20591 0 17234 35742 20604 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.07 62.03 0.00 0.00 0.0000 0.0000 1278155.43 1278155.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.74 81.79% 17234.37 15681 25120 17237.61 16459 18147 874477 874477 0.00
crit 11.29 18.21% 35742.07 32302 51748 35750.42 32302 42025 403678 403678 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 68628 / 5339
melee 68628 4.8% 39.6 9.35sec 60151 71300 52608 106481 60151 19.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.58 39.58 0.00 0.00 0.8436 0.0000 2380691.46 2380691.46 0.00 71299.53 71299.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.29 56.32% 52608.16 39622 62482 52622.00 47467 57720 1172773 1172773 0.00
crit 7.83 19.78% 106481.03 79243 124963 106487.84 0 124963 833640 833640 0.00
glance 9.46 23.89% 39576.07 29716 46861 39586.82 31716 46861 374279 374279 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.8 74.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.83 5.83 0.00 0.00 1.0750 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.9sec 180.9sec 6.61% 11.55%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.94%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 7.6 0.0 63.4sec 63.4sec 32.84% 32.84%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
glyph_mind_spike 28.1 10.8 15.6sec 11.2sec 33.80% 37.09%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:25.7%
  • glyph_mind_spike_2:8.1%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
jade_serpent_potion 2.0 0.0 413.8sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.6sec 54.6sec 22.77% 22.73%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
relic_of_yulon 9.1 0.0 52.4sec 52.4sec 29.67% 29.67%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.7%
shadow_word_death_reset_cooldown 7.8 0.0 11.3sec 11.3sec 10.03% 48.98%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.0%
surge_of_darkness 35.5 3.7 12.3sec 11.1sec 14.76% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:13.9%
  • surge_of_darkness_2:0.8%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 7.9 0.0 60.9sec 60.9sec 17.36% 17.36%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
twist_of_fate 1.0 132.0 0.0sec 0.6sec 18.63% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.6%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:(null)
  • description:After damaging or healing a target below $s1% health, you deal $123254s1% increased damage and healing for $123254d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
shadowfiend-shadowcrawl 5.8 0.0 74.0sec 74.0sec 83.35% 80.60%

Buff details

  • buff initial source:Priest_Shadow_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:6.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
inner_fire

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
shadowform

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T14H
devouring_plague Shadow Orb 18.8 56.3 3.0 3.0 140438.6
halo_damage Mana 11.0 493830.0 45000.0 45000.0 3.3
mind_blast Mana 46.6 419251.5 9000.0 9000.0 13.1
mind_flay Mana 138.8 416348.7 3000.0 3000.0 30.7
shadow_word_death Mana 15.3 119638.7 7800.0 7800.0 16.9
shadow_word_pain Mana 21.6 285435.5 13200.0 13200.0 20.7
vampiric_touch Mana 23.7 213452.1 9000.0 9000.0 25.1
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 484175.31 268.70 56396.67 10.43%
shadowfiend Mana 39.58 175115.07 4424.47 181094.13 50.84%
Shadow Orbs from Mind Blast Shadow Orb 46.58 46.58 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.82 7.82 1.00 0.00 0.00%
Devouring Plague Health Health 205.80 0.00 0.00 2857851.84 100.00%
Vampiric Touch Mana Mana 260.69 1201955.55 4610.74 176057.55 12.78%
Resource RPS-Gain RPS-Loss
Mana 4130.58 4323.01
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 212658.96 98100.00 300000.00
Shadow Orb 1.09 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.4%
shadowfiend-Mana Cap 9.4%
lightwell-Mana Cap 9.4%

Procs

Count Interval
hat_donor 185.6 2.4sec
Shadowy Recall Extra Tick 278.9 1.6sec
Shadowy Apparition Procced 75.8 5.9sec
FDCL Mind Spike proc 39.2 11.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 110649.61
Minimum 103452.99
Maximum 120355.02
Spread ( max - min ) 16902.03
Range [ ( max - min ) / 2 * 100% ] 7.64%
Standard Deviation 2176.6462
5th Percentile 107236.73
95th Percentile 114306.30
( 95th Percentile - 5th Percentile ) 7069.56
Mean Distribution
Standard Deviation 21.7665
95.00% Confidence Intervall ( 110606.95 - 110692.27 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1486
0.1 Scale Factor Error with Delta=300 40444
0.05 Scale Factor Error with Delta=300 161777
0.01 Scale Factor Error with Delta=300 4044448
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 110649.61

Damage

Sample Data
Count 10000
Mean 47425378.05

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 263.36
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 7.90 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 18.77 devouring_plague,if=shadow_orb=3
B 2.99 berserking
C 46.67 mind_blast,if=num_targets<=4&cooldown_react
D 38.88 mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E 21.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F 15.34 shadow_word_death,if=num_targets<=4
G 23.77 vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H 10.97 halo_damage
I 2.93 shadowfiend,if=cooldown_react
J 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=2
K 72.52 mind_flay,chain=1,interrupt=1
L 0.00 shadow_word_death,moving=1
M 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N 0.00 shadow_word_pain,moving=1
O 0.00 dispersion

Sample Sequence

8ABCEGHIKCKDKGCAEKCDKGKCKEKHKDCADKDDGC8KEKCDKGKCAKEKHCDKGKCKDKEKCAKGKCK8KDEHCKGKCADKCEGKCKCAEDGDDHCDK8BKDCIKEGKCAKCDKGKEDCDHKDKCAKGKCEKDK8KCKGDKCADEHKDCDDGKCKEKDKCAGKDKCKEHK8CGKDDDKCADKEDCKGKCKCAEGHKCKDKCDBEF8AFGIKCDKFDFKCAKGEFFCHKFACFDGDKEKC9FADFKCKGFF8KECAHKFFKCGKFAFDCE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21147 18775 17679
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35789 27206 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T14H"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=shadowform
actions+=/use_item,name=guardian_serpent_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/devouring_plague,if=shadow_orb=3
actions+=/berserking
actions+=/mind_blast,if=num_targets<=4&cooldown_react
actions+=/mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/halo_damage
actions+=/shadowfiend,if=cooldown_react
actions+=/mind_sear,chain=1,interrupt=1,if=num_targets>=2
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160spi_160int_120haste
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17679
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Rogue_Assassination_T14H : 114830 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114829.5 114829.5 57.52 / 0.05% 4818 / 4.2% 6149.3 18.7 18.4 Energy 44.22% 37.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
Glyphs
  • vendetta

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:96619|79092|67645|59748|51025|31785|15860|13164|6593&chds=0,193237&chco=ABD473,C79C6E,C79C6E,C55D54,C79C6E,9482C9,9482C9,C79C6E,C79C6E&chm=t++96619++envenom,ABD473,0,0,15|t++79092++ambush,C79C6E,1,0,15|t++67645++dispatch,C79C6E,2,0,15|t++59748++rupture,C55D54,3,0,15|t++51025++mutilate,C79C6E,4,0,15|t++31785++shadow_blade,9482C9,5,0,15|t++15860++shadow_blade_offhand,9482C9,6,0,15|t++13164++melee_main_hand,C79C6E,7,0,15|t++6593++melee_off_hand,C79C6E,8,0,15&chtt=Rogue_Assassination_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,12,12,12,10,10,5,5,4,3,2,2,1&chds=0,100&chdls=ffffff&chco=ABD473,ABD473,C79C6E,ABD473,C79C6E,ABD473,C79C6E,C79C6E,9482C9,C55D54,C79C6E,9482C9,C79C6E&chl=deadly_poison_instant|venomous_wound|dispatch|deadly_poison_dot|melee_main_hand|envenom|melee_off_hand|mutilate_mh|shadow_blade|rupture|mutilate_oh|shadow_blade_offhand|ambush&chtt=Rogue_Assassination_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wxyz010112134568664300zywvttrqoommlkjihgfedcbbaaZZYYXXWXWXXXXYYZZZZaaaaaaaaaaaZaZZYYXYXXWWWWWWWWWWWWVWVWVWVWVWVWWWVWWXXYZaabbccddeeffgghggggfgffeeddcbbbaaZZYYYYXXWWWWVWVWWWWWWXXXXYZZZabccddeeffffgggggggggffeeedcccbbbaaZZZYYYXXXXWWWWWWWXXXYYYZZaabbcddeefffgggggggggggffeeddcbbbaaZZZYYYXXXXXXXXXXXXXXXYYYYYYYYZZZZaaaaaabababbbabbbbbbbbbaaaaaaaaaaaaaZZZZZZZZZabbcdeefgghijkkmmnoppqqqqrrrrrqqpoonmlkjihgfeddcbaaaZZZZZZZZZZZZZaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaaZaZZaabbccdddeeefffgghhiijjjjjjjjkjkkkjjjjiihhggfeeddcbbaaZZZZZZZZZZZZZZZZZZZZZZZZZ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=114830|max=234307&chxp=1,1,49,100&chtt=Rogue_Assassination_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,3,5,7,18,14,31,51,87,105,167,210,266,313,359,442,500,486,557,601,573,591,542,539,524,470,397,399,308,276,241,200,153,128,100,86,70,56,36,28,11,17,7,6,8,2,4,0,1,2&chds=0,601&chbh=5&chxt=x&chxl=0:|min=105506|avg=114830|max=127024&chxp=0,1,43,100&chtt=Rogue_Assassination_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:20.3,16.0,11.3,5.5,1.2,1.0,0.5,0.2,44.2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,ABD473,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=dispatch 91.3s|mutilate 72.1s|envenom 50.9s|rupture 24.6s|ambush 5.4s|vendetta 4.4s|preparation 2.1s|slice_and_dice 1.0s|waiting 199.3s&chtt=Rogue_Assassination_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Assassination_T14H 114830
ambush 953 0.8% 5.2 105.31sec 81965 79092 60242 126738 81965 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.19 5.19 0.00 0.00 1.0363 0.0000 425357.94 425357.94 0.00 79092.22 79092.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.49 67.32% 60241.88 52491 92884 60168.42 0 92884 210473 210473 0.00
crit 1.70 32.67% 126738.34 108131 191340 110189.79 0 191340 214885 214885 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
berserking 0 0.0% 3.0 180.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 13681 11.9% 561.5 1.03sec 10974 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.6 29944 63557 41201 33.5% 0.0% 99.6%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 561.55 561.55 149.57 149.57 0.0000 3.0000 6162512.36 6162512.36 0.00 13733.75 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 561.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.5 66.51% 29944.28 24256 55024 29950.68 28201 31707 2978857 2978857 0.00
crit 50.1 33.49% 63557.30 49967 113348 63597.37 57844 70371 3183655 3183655 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 26700 23.2% 560.5 1.03sec 21433 0 15521 33064 21433 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 560.55 560.55 0.00 0.00 0.0000 0.0000 12013995.00 12013995.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 371.63 66.30% 15521.39 12428 28181 15526.82 14854 16452 5768172 5768172 0.00
crit 188.90 33.70% 33063.90 25603 58052 33083.36 31118 36095 6245823 6245823 0.00
miss 0.02 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
dispatch 13725 12.0% 88.1 5.03sec 70115 67645 51366 107576 70115 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.10 88.10 0.00 0.00 1.0365 0.0000 6177304.74 6177304.74 0.00 67644.60 67644.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.71 66.64% 51366.18 44183 81091 51368.64 48483 54877 3015775 3015775 0.00
crit 29.39 33.36% 107575.63 91016 167048 107612.92 98454 119457 3161529 3161529 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispatch

Static Values
  • id:111240
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:111240
  • name:Dispatch
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that exploits the vulnerability of foes with less than 35% health remaining, causing $m2% weapon damage plus $m1 to the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:486.06
  • base_dd_max:486.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.00
envenom 10930 9.5% 49.1 9.07sec 100145 96619 72251 154477 100145 33.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.09 49.09 0.00 0.00 1.0365 0.0000 4916435.51 4916435.51 0.00 96618.56 96618.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.44 66.07% 72250.72 48416 139672 72271.80 63062 83811 2343553 2343553 0.00
crit 16.66 33.93% 154477.36 99738 287725 154644.01 124825 190976 2572882 2572882 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4&action.envenom_hot.ticks_remain<2
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.560000
  • base_dd_min:400.06
  • base_dd_max:400.06
melee_main_hand 11029 9.6% 357.3 1.26sec 13915 13164 12382 26357 13915 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 357.30 357.30 0.00 0.00 1.0570 0.0000 4971604.14 4971604.14 0.00 13164.44 13164.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.58 24.23% 12381.83 10924 20356 12381.27 11699 13377 1071965 1071965 0.00
crit 117.16 32.79% 26357.10 22503 41933 26365.02 25021 27993 3087918 3087918 0.00
glance 85.75 24.00% 9465.84 8193 15267 9467.29 8933 10311 811721 811721 0.00
miss 67.81 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 5528 4.8% 357.1 1.26sec 6979 6593 6212 13233 6979 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 357.05 357.05 0.00 0.00 1.0586 0.0000 2491931.52 2491931.52 0.00 6592.86 6592.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.42 24.20% 6211.81 5462 10178 6211.69 5911 6602 536803 536803 0.00
crit 116.98 32.76% 13232.54 11251 20967 13236.36 12546 14091 1547900 1547900 0.00
glance 85.71 24.00% 4751.23 4096 7633 4752.01 4498 5126 407228 407228 0.00
miss 67.95 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 0 (8168) 0.0% (7.1%) 69.5 4.22sec 52887 51025 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.54 69.54 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 51024.75 51024.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards $s1 combo $lpoint:points;.
mutilate_mh 5416 4.7% 69.5 4.22sec 35068 0 25448 54043 35068 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.53 69.53 0.00 0.00 0.0000 0.0000 2438340.73 2438340.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.14 66.36% 25448.08 21645 39905 25452.69 23858 27104 1174210 1174210 0.00
crit 23.39 33.64% 54043.01 44590 82204 54082.36 48790 60907 1264131 1264131 0.00
DPS Timeline Chart

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
mutilate_oh 2752 2.4% 69.5 4.22sec 17821 0 12932 27465 17821 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.53 69.53 0.00 0.00 0.0000 0.0000 1239166.20 1239166.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.14 66.36% 12931.71 11012 20224 12934.04 12104 13756 596655 596655 0.00
crit 23.39 33.64% 27465.14 22684 41662 27489.62 24313 30665 642511 642511 0.00
DPS Timeline Chart

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
preparation 0 0.0% 2.0 300.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0362 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 3266 2.8% 23.8 19.21sec 61931 59748 0 0 0 0.0% 0.0% 0.0% 0.0% 222.4 4794 10154 6613 33.9% 0.0% 98.7%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.75 23.75 222.42 222.42 1.0365 2.0000 1470988.71 1470988.71 0.00 3133.32 59747.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.9 66.06% 4793.98 1822 8889 4795.11 4247 5306 704362 704362 0.00
crit 75.5 33.94% 10154.37 3753 18311 10159.64 8777 11742 766627 766627 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2|(combo_points=5&ticks_remain<3)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.056000
  • base_td:360.18
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 4637 4.0% 69.7 5.37sec 29803 31785 21068 44134 29803 37.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.65 69.65 0.00 0.00 0.9376 0.0000 2075811.17 2075811.17 0.00 31784.94 31784.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.27 62.12% 21067.76 16239 30261 21050.52 18458 23259 911610 911610 0.00
crit 26.38 37.87% 44133.95 33453 62338 44071.77 36432 49555 1164201 1164201 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 2308 2.0% 69.4 5.39sec 14896 15860 10550 22062 14896 37.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.35 69.35 0.00 0.00 0.9392 0.0000 1033067.49 1033067.49 0.00 15860.16 15860.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.16 62.24% 10549.82 8120 15131 10541.52 9235 11535 455376 455376 0.00
crit 26.19 37.76% 22061.77 16726 31169 22026.34 18581 24717 577692 577692 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 2.9 180.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
slice_and_dice 0 0.0% 1.0 1.#Rsec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0359 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.down
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 14.8 31.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.80 14.80 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.2 105.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.19 4.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
vendetta 0 0.0% 4.3 120.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.27 4.27 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
venomous_wound 13903 12.1% 166.8 2.68sec 37540 0 27303 57930 37540 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.85 166.85 0.00 0.00 0.0000 0.0000 6263367.14 6263367.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.07 66.57% 27303.36 22192 50069 27310.07 25804 29060 3032644 3032644 0.00
crit 55.77 33.43% 57929.71 45715 103143 57964.21 52928 64293 3230723 3230723 0.00
miss 0.01 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:79136
  • name:Venomous Wound
  • school:nature
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.160000
  • base_dd_min:685.46
  • base_dd_max:685.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.5sec 180.5sec 6.65% 7.23%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
blindside 20.7 0.0 13.8sec 13.8sec 8.87% 8.87%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_blindside
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • blindside_1:8.9%

Spelldata details

  • id:121153
  • name:Blindside
  • tooltip:You may use Dispatch with no cost, regardless of your enemy target's health.
  • description:$@spelldesc121152
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.58%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.8 7.8 37.5sec 22.0sec 40.78% 40.70%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:40.8%
dancing_steel_oh 10.8 6.2 40.1sec 24.8sec 36.30% 37.25%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:36.3%
envenom 33.6 15.5 13.3sec 9.1sec 58.92% 60.80%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • envenom_1:58.9%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
  • max_stacks:
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 7.8 0.0 61.4sec 61.4sec 25.43% 25.43%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.4%
shadow_blades 2.9 0.0 180.8sec 180.8sec 15.25% 15.59%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:15.3%
slice_and_dice 1.0 49.1 322.2sec 9.0sec 99.77% 99.85%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.8%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

synapse_springs_2 8.0 0.0 60.5sec 60.5sec 17.47% 17.47%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
terror_in_the_mists 7.6 0.0 63.1sec 63.1sec 33.02% 33.02%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:33.0%
tricks_of_the_trade 14.8 0.0 31.2sec 31.2sec 19.56% 100.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.6%
tricks_of_the_trade_trigger 14.8 0.0 31.1sec 31.1sec 1.41% 1.41%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.4%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.2 0.0 105.5sec 105.5sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

virmens_bite_potion 2.0 0.0 413.5sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T14H
dispatch Energy 88.1 2020.6 22.9 22.9 3057.1
envenom Energy 49.1 1718.3 35.0 35.0 2861.3
mutilate Energy 69.5 3824.4 55.0 55.0 961.6
rupture Energy 23.8 593.8 25.0 25.0 2477.2
slice_and_dice Energy 1.0 25.0 25.0 25.0 0.0
tricks_of_the_trade Energy 14.8 222.0 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.91 4990.07 2.77 21.02 0.42%
energy_refund Energy 0.01 0.21 31.94 0.00 0.00%
relentless_strikes Energy 65.86 1646.54 25.00 0.00 0.00%
venomous_vim Energy 166.85 1667.91 10.00 0.56 0.03%
Resource RPS-Gain RPS-Loss
Energy 18.43 18.65
Combat End Resource Mean Min Max
Health 457343.00 457343.00 457343.00
Energy 20.81 0.01 65.31
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.3%

Procs

Count Interval
hat_donor 170.0 2.8sec
seal_fate 69.6 6.5sec
venomous_wounds 166.8 2.7sec
no_revealing_strike 542.4 1.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 114829.54
Minimum 105506.18
Maximum 127023.99
Spread ( max - min ) 21517.81
Range [ ( max - min ) / 2 * 100% ] 9.37%
Standard Deviation 2934.5122
5th Percentile 110260.99
95th Percentile 119897.59
( 95th Percentile - 5th Percentile ) 9636.60
Mean Distribution
Standard Deviation 29.3451
95.00% Confidence Intervall ( 114772.02 - 114887.06 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2508
0.1 Scale Factor Error with Delta=300 73511
0.05 Scale Factor Error with Delta=300 294046
0.01 Scale Factor Error with Delta=300 7351153
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 114829.54

Damage

Sample Data
Count 10000
Mean 51679882.63

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 282.02
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 5.19 auto_attack
9 0.00 kick
A 7.96 use_item,name=gloves_of_the_thousandfold_blades
B 3.01 berserking
C 4.19 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 5.19 ambush
E 2.92 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
F 1.00 slice_and_dice,if=buff.slice_and_dice.down
G 0.04 dispatch,if=dot.rupture.ticks_remain<2&energy>90
H 1.21 mutilate,if=dot.rupture.ticks_remain<2&energy>90
I 23.75 rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
J 4.27 vendetta
K 40.70 envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
L 8.39 envenom,if=combo_points>4
M 0.00 envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
N 88.07 dispatch,if=combo_points<5
O 14.80 tricks_of_the_trade
P 68.33 mutilate

Sample Sequence

8ABDFHIJOPNKEPNLPPIPKNPLNLPPKNPC8D7C8DKINOPPKPPKPLPAIPPKOPPINPNKPNLPPKPIOPNKPPIPPAKPNJPKOPIPPKPNKPIPOPINPKPPKPABNLPNPIENPOKNLPNLPLPNLPIPNKC8DPKPOPKPIPPKAPPJIPOPKPNKPNKPIPPKPOIPPKNNNINANNKNNNNONKNNINNNNKNN7C8DINNNNOKNNNNKNNNBIANNNJKNENNKNONINNKNNLNNNKNNNNINNONN6NKNNNAKNNINNNOINNNKNN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 120 120 0
Spell Power 0 0 0
Spell Hit 15.03% 15.03% 2549
Spell Crit 12.99% 7.99% 4786
Spell Haste 12.28% 6.93% 2945
Mana Per 5 0 0 0
Attack Power 47874 38727 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 29.81% 22.91% 4786
Melee Haste 6.93% 6.93% 2945
Swing Speed 17.62% 6.93% 2945
Expertise 7.53% / 7.53% 7.53% / 7.53% 2560
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 75.88% 58.38% 5208

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Assassination_T14H"
origin="unknown"
level=90
race=troll
spec=assassination
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
glyphs=vendetta

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=gloves_of_the_thousandfold_blades
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/dispatch,if=dot.rupture.ticks_remain<2&energy>90
actions+=/mutilate,if=dot.rupture.ticks_remain<2&energy>90
actions+=/rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
actions+=/vendetta
actions+=/envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
actions+=/envenom,if=combo_points>4
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/dispatch,if=combo_points<5
actions+=/tricks_of_the_trade
actions+=/mutilate

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi
neck=choker_of_the_unleashed_storm,id=86953
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_hit
hands=gloves_of_the_thousandfold_blades,id=87125,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_exp
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=exp_hit
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_hit

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2560
# gear_hit_rating=2549
# gear_crit_rating=4786
# gear_haste_rating=2945
# gear_mastery_rating=5208
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gloves_of_the_thousandfold_blades,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Combat_T14H : 110072 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
110072.5 110072.5 56.37 / 0.05% 4779 / 4.3% 4590.2 24.0 23.8 Energy 33.13% 45.3 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
Glyphs
  • adrenaline_rush

Charts

http://0.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:155714|139291|126772|85435|42677|34432|32761|29464|15662|13569&chds=0,311428&chco=C79C6E,C55D54,C79C6E,C79C6E,C79C6E,9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++155714++killing_spree,C79C6E,0,0,15|t++139291++rupture,C55D54,1,0,15|t++126772++eviscerate,C79C6E,2,0,15|t++85435++ambush,C79C6E,3,0,15|t++42677++sinister_strike,C79C6E,4,0,15|t++34432++shadow_blade,9482C9,5,0,15|t++32761++revealing_strike,C79C6E,6,0,15|t++29464++shadow_blade_offhand,9482C9,7,0,15|t++15662++melee_main_hand,C79C6E,8,0,15|t++13569++melee_off_hand,C79C6E,9,0,15&chtt=Rogue_Combat_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,13,11,11,10,9,8,6,5,4,3,2,2,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473,9482C9,9482C9,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|main_gauche|melee_main_hand|deadly_poison_instant|melee_off_hand|eviscerate|deadly_poison_dot|shadow_blade|shadow_blade_offhand|killing_spree_mh|rupture|killing_spree_oh|revealing_strike|ambush&chtt=Rogue_Combat_T14H Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:8434221zyyyy01331ywwwwxyz00zzzyxwvussrrqpomkjhgffeeeeeeeeeddcbbbbbbaaaaaaZZZYYXWWVVVUUUVVVWXXYZabdefghijklmnoppoonnnmmlkjiihggfeedcccccbbbaaaaaZZZYYYYXXXWWVVVUUUUTTTTTTUUUUVWXYZbcegijlmopqrsttuuuuuutsrqpnmlkjihhgffeddcbbaaZZZYYYYYYXXXXXXXXYYZZZaabbbcccddddeeeeeddddddccccccccbbbbbbbbbbcccddeeffgghhiijjjjkkkkkjjjjiihggffeedddcccbbbbaaaaaaaaaaZZZZYYYYXXXXXXXYYYYZZaabbcdefghhijkklmmnnooooonnnmmllkjjihggfeedcccbbbbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaabbbbcccddeeefffffffgggffffffffffffffggghhhiijjjkkkkklllkkkkjjiihhggfffeeddcccbbbaaaaaaaaaaaaaZZYYYYYYYYXXX&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=110072|max=207456&chxp=1,1,53,100&chtt=Rogue_Combat_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,2,4,8,18,24,34,35,97,96,172,184,237,313,372,459,499,566,669,610,627,612,610,603,490,489,429,354,298,234,201,132,126,112,81,61,45,34,16,12,9,4,7,4,1,4,1,1,1&chds=0,669&chbh=5&chxt=x&chxl=0:|min=100007|avg=110072|max=122692&chxp=0,1,44,100&chtt=Rogue_Combat_T14H DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.5,7.7,5.7,4.5,3.5,2.4,1.2,0.5,33.1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,ffffff&chl=sinister_strike 186.8s|eviscerate 34.9s|revealing_strike 25.5s|killing_spree 20.4s|slice_and_dice 15.6s|rupture 10.8s|ambush 5.5s|preparation 2.1s|waiting 149.3s&chtt=Rogue_Combat_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Combat_T14H 110072
adrenaline_rush 0 0.0% 5.2 90.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.21 5.21 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<35
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
ambush 1043 0.9% 5.3 107.57sec 88540 85435 62569 130230 88540 38.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 5.26 0.00 0.00 1.0363 0.0000 466134.48 466134.48 0.00 85435.21 85435.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.24 61.62% 62568.62 47302 126329 61963.52 0 100856 202966 202966 0.00
crit 2.02 38.38% 130229.67 97443 253390 120023.15 0 253390 263168 263168 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.25
berserking 0 0.0% 3.0 180.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 8989 8.2% 360.5 1.34sec 11231 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.4 20010 41970 27100 32.3% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 360.53 360.53 149.41 149.41 0.0000 3.0000 4049097.54 4049097.54 0.00 9033.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 360.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.2 67.71% 20009.73 14169 47888 20015.16 18797 21475 2024386 2024386 0.00
crit 48.2 32.29% 41970.23 29189 103817 41989.92 37619 47201 2024711 2024711 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 11569 10.5% 359.5 1.34sec 14486 0 10642 22454 14486 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 359.51 359.51 0.00 0.00 0.0000 0.0000 5207812.30 5207812.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.53 67.46% 10642.36 7259 25807 10644.25 10028 11529 2581135 2581135 0.00
crit 116.98 32.54% 22454.49 14953 53162 22462.08 20163 25769 2626677 2626677 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 9836 8.9% 36.8 11.96sec 120384 126772 89517 186381 120384 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.76 36.76 0.00 0.00 0.9496 0.0000 4425109.81 4425109.81 0.00 126772.18 126772.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.04 68.13% 89516.87 46249 206962 89506.76 81906 100572 2241914 2241914 0.00
crit 11.71 31.87% 186381.26 95272 411555 186415.01 157559 230972 2183196 2183196 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&buff.deep_insight.up
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
killing_spree 0 (7069) 0.0% (6.4%) 7.5 63.40sec 425100 155714 0 0 0 0.0% 0.0% 0.0% 0.0% 52.3 0 0 0 33.4% 0.0% 4.1%

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.49 7.49 52.26 52.26 2.7300 0.3556 0.00 0.00 0.00 155714.13 155714.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.8 66.61% 0.00 0 0 0.00 0 0 0 0 0.00
crit 17.5 33.39% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every $t1 sec with both weapons until 7 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 4401 4.0% 52.3 8.07sec 37917 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 27502 57891 37917 34.3% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.26 0.00 0.00 52.26 0.0000 0.0000 1981693.11 1981693.11 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.4 65.73% 27501.64 14718 43928 27482.04 23065 31989 944690 944690 0.00
crit 17.9 34.27% 57891.11 30320 90491 57845.89 47210 71563 1037004 1037004 0.00
DPS Timeline Chart

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 2668 2.4% 52.3 8.07sec 22988 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 16668 35070 22988 34.3% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.26 0.00 0.00 52.26 0.0000 0.0000 1201415.22 1201415.22 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.3 65.66% 16667.80 8916 26611 16655.13 13847 20201 571946 571946 0.00
crit 17.9 34.34% 35070.10 18367 54818 35049.40 27731 43210 629470 629470 0.00
DPS Timeline Chart

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 13784 12.5% 195.4 2.31sec 31760 0 23430 48992 31760 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 195.36 195.36 0.00 0.00 0.0000 0.0000 6204742.28 6204742.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.70 67.41% 23429.99 16937 50080 23431.74 21904 25254 3085711 3085711 0.00
crit 63.66 32.59% 48991.99 34891 103165 48994.59 44277 54715 3119031 3119031 0.00
DPS Timeline Chart

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:(null)
  • description:A vicious attack that deals damage equal to $86392s2% of a main-hand attack.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
melee_main_hand 12206 11.1% 254.4 1.77sec 21603 15662 19378 40867 21603 32.6% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 254.44 254.44 0.00 0.00 1.3794 0.0000 5496791.34 5496791.34 0.00 15661.98 15661.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.18 24.44% 19378.37 14718 42216 19380.28 17898 21520 1204956 1204956 0.00
crit 83.04 32.64% 40866.81 30320 90491 40879.10 38333 43845 3393625 3393625 0.00
glance 60.96 23.96% 14733.37 11039 32946 14735.63 13569 16276 898210 898210 0.00
miss 48.26 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 10670 9.7% 367.9 1.22sec 13062 13569 11715 24711 13062 32.6% 18.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 367.90 367.90 0.00 0.00 0.9626 0.0000 4805752.50 4805752.50 0.00 13569.32 13569.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.69 24.38% 11715.32 8916 26611 11715.68 10951 12758 1050775 1050775 0.00
crit 120.08 32.64% 24710.97 18367 54818 24717.26 23178 26519 2967346 2967346 0.00
glance 88.43 24.04% 8906.72 6687 19289 8908.75 8334 9605 787631 787631 0.00
miss 69.70 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
preparation 0 0.0% 2.0 301.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0362 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
revealing_strike 1858 1.7% 25.5 17.95sec 32825 32761 24334 50517 32825 32.4% 0.0% 0.0% 0.0% 148.8 0 0 0 32.5% 0.0% 99.1%

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.49 25.49 148.84 148.84 1.0020 3.0000 836621.60 836621.60 0.00 1772.28 32761.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.22 67.57% 24333.97 18398 50930 24336.40 21708 28492 419067 419067 0.00
crit 8.27 32.43% 50517.10 37900 104916 50512.87 0 66227 417554 417554 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.5 67.53% 0.00 0 0 0.00 0 0 0 0 0.00
crit 48.3 32.47% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:anticipation_charges<5&ticks_remain<2
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals a weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a $h% chance to generate an extra combo point.
  • description:An instant strike that deals $m1% weapon damage and exposes the target's vulnerabilities, increasing the effectiveness of your offensive finishing moves on that target by $s3%, and giving your Sinister Strikes a $h% chance to generate an extra combo point, for $d. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 3349 3.0% 11.0 39.84sec 137092 139291 0 0 0 0.0% 0.0% 0.0% 0.0% 130.7 8604 17872 11553 31.8% 0.0% 58.0%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 130.69 130.69 0.9842 2.0000 1509778.95 1509778.95 0.00 5546.40 139291.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.1 68.19% 8604.35 5548 19031 8604.30 7872 10406 766716 766716 0.00
crit 41.6 31.81% 17871.94 11428 39204 17864.21 16086 22396 743063 743063 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 6390 5.8% 72.2 5.53sec 39818 34432 29829 61687 39818 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.15 72.15 0.00 0.00 1.1564 0.0000 2873037.21 2873037.21 0.00 34432.37 34432.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.53 68.65% 29828.65 21881 63116 29815.02 27109 34024 1477449 1477449 0.00
crit 22.62 31.35% 61687.00 45074 130020 61640.05 53773 74373 1395588 1395588 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 5601 5.1% 104.3 3.82sec 24139 29464 18080 37386 24139 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.33 104.33 0.00 0.00 0.8193 0.0000 2518432.54 2518432.54 0.00 29463.97 29463.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.58 68.61% 18079.51 13255 38235 18072.27 16488 19936 1294190 1294190 0.00
crit 32.75 31.39% 37386.15 27305 78763 37352.79 32966 44338 1224243 1224243 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 5.1 92.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.10 5.10 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
sinister_strike 17708 16.1% 190.1 2.36sec 41947 42677 31090 64716 41947 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.07 190.07 0.00 0.00 0.9829 0.0000 7973102.14 7973102.14 0.00 42676.85 42676.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.71 67.71% 31090.34 23798 67542 31094.18 30020 32460 4001488 4001488 0.00
crit 61.37 32.29% 64716.42 49023 139899 64731.35 60377 69685 3971614 3971614 0.00
DPS Timeline Chart

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45
slice_and_dice 0 0.0% 15.4 30.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.39 15.39 0.00 0.00 1.0119 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.remains<2
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 15.0 30.76sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 15.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 15.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Combat_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.3 107.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.26 4.26 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 5.2 0.0 90.5sec 90.5sec 17.07% 23.99%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:17.1%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
berserking 3.0 0.0 180.5sec 180.5sec 6.65% 6.75%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 10.52%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 13.0 13.1 34.6sec 16.8sec 49.68% 50.60%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:49.7%
dancing_steel_oh 10.2 5.1 42.9sec 27.9sec 32.99% 34.03%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:33.0%
deep_insight 11.3 0.0 39.8sec 39.8sec 36.97% 38.07%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • deep_insight_1:37.0%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
killing_spree 7.5 0.0 63.3sec 63.3sec 4.97% 11.60%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • killing_spree_1:5.0%

Spelldata details

  • id:61851
  • name:Killing Spree
  • tooltip:(null)
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
  • max_stacks:
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
moderate_insight 11.5 0.0 39.4sec 39.4sec 21.77% 20.45%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:21.8%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_xuen 7.7 0.0 61.6sec 61.6sec 25.36% 25.36%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.4%
shadow_blades 5.1 0.0 92.9sec 92.9sec 20.02% 23.86%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:20.0%
shallow_insight 11.7 0.0 39.4sec 39.4sec 22.40% 21.74%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:22.4%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
slice_and_dice 1.2 14.2 239.8sec 30.1sec 99.74% 99.83%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.7%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

synapse_springs_2 7.9 0.0 60.5sec 60.5sec 17.46% 17.46%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.5%
terror_in_the_mists 7.6 0.0 63.2sec 63.2sec 32.98% 32.98%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:33.0%
tricks_of_the_trade 15.0 0.0 30.8sec 30.8sec 19.89% 100.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.9%
tricks_of_the_trade_trigger 15.0 0.0 30.8sec 30.8sec 1.10% 1.10%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.1%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.3 0.0 107.5sec 107.5sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

virmens_bite_potion 2.0 0.0 413.5sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Combat_T14H
eviscerate Energy 36.8 1286.5 35.0 35.0 3439.6
revealing_strike Energy 25.5 1019.5 40.0 40.0 820.6
rupture Energy 11.0 275.3 25.0 25.0 5483.7
sinister_strike Energy 190.1 7603.0 40.0 40.0 1048.7
slice_and_dice Energy 15.4 384.7 25.0 25.0 0.0
tricks_of_the_trade Energy 15.0 225.6 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.91 6367.23 3.53 67.25 1.05%
adrenaline_rush Energy 307.57 1117.87 3.63 5.71 0.51%
combat_potency Energy 115.78 1712.18 14.79 24.55 1.41%
relentless_strikes Energy 60.94 1523.56 25.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 23.79 23.96
Combat End Resource Mean Min Max
Health 457329.00 457329.00 457329.00
Energy 25.84 0.04 97.19
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.7%

Procs

Count Interval
hat_donor 226.6 2.1sec
main_gauche 195.4 2.3sec
no_revealing_strike 1.5 92.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 110072.45
Minimum 100006.94
Maximum 122692.04
Spread ( max - min ) 22685.09
Range [ ( max - min ) / 2 * 100% ] 10.30%
Standard Deviation 2876.2036
5th Percentile 105478.34
95th Percentile 115035.96
( 95th Percentile - 5th Percentile ) 9557.62
Mean Distribution
Standard Deviation 28.7620
95.00% Confidence Intervall ( 110016.08 - 110128.82 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2622
0.1 Scale Factor Error with Delta=300 70619
0.05 Scale Factor Error with Delta=300 282476
0.01 Scale Factor Error with Delta=300 7061921
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 110072.45

Damage

Sample Data
Count 10000
Mean 49549521.01

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 340.32
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 5.26 auto_attack
9 0.00 kick
A 7.95 use_item,name=bonebreaker_gauntlets
B 3.01 berserking
C 4.26 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 5.26 ambush
E 15.39 slice_and_dice,if=buff.slice_and_dice.remains<2
F 5.10 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
G 7.49 killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
H 5.21 adrenaline_rush,if=energy<35
I 11.01 rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
J 22.73 eviscerate,if=combo_points=5&buff.deep_insight.up
K 14.03 eviscerate,if=anticipation_charges=5
L 25.49 revealing_strike,if=anticipation_charges<5&ticks_remain<2
M 15.04 tricks_of_the_trade
N 190.07 sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

Sample Sequence

8ABDELMNNGNNNC8D7C8DKNNEFLNHNNIJNNNJNNJNNJNNJMNLNNNNNNNKNELGNNNAINNMNJNLNNNNNENNLNNMNKFNHNIJNLNJNNJNNNJNNNEANNGLMNNNNKNNNLIJNNNNENMNNLNNNNNNKNBLANENNIFMHNNNJNNJLNNNNKNGC8DNKNNLENMNNINNNJLNNJNANNNLMENNNNNNLIJNGNNJNMHNNNNEFLNNNNKNNNKNANILJNN7C8DMNJNNELNNNGNNLNNEMNNINNJNNBLNANJNNNNNNMNLENHNNNIFNJNNJNNJNLNGNNKNM6NNELNNNANKNNILNJNMNNNNEL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22209 20190 20067
Intellect 130 124 80
Spirit 158 158 80
Health 457329 429063 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2558
Spell Crit 11.78% 6.78% 4059
Spell Haste 20.14% 14.42% 6128
Mana Per 5 0 0 0
Attack Power 59843 48409 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 28.59% 21.69% 4059
Melee Haste 14.42% 14.42% 6128
Swing Speed 25.86% 14.42% 6128
Expertise 7.56% / 7.56% 7.56% / 7.56% 2572
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 35.42% 25.42% 2823

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Combat_T14H"
origin="unknown"
level=90
race=troll
spec=combat
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
glyphs=adrenaline_rush

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5&buff.deep_insight.up
actions+=/eviscerate,if=anticipation_charges=5
actions+=/revealing_strike,if=anticipation_charges<5&ticks_remain<2
actions+=/tricks_of_the_trade
actions+=/sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=crit_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20067
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2572
# gear_hit_rating=2558
# gear_crit_rating=4059
# gear_haste_rating=6128
# gear_mastery_rating=2823
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Subtlety_T14H : 120846 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
120846.3 120846.3 55.95 / 0.05% 4712 / 3.9% 5671.9 21.3 21.1 Energy 34.37% 46.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

Charts

http://4.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:185370|168197|119279|75345|63301|43924|22081|19990|10043&chds=0,370740&chco=C55D54,C79C6E,C79C6E,C79C6E,C79C6E,9482C9,9482C9,C79C6E,C79C6E&chm=t++185370++rupture,C55D54,0,0,15|t++168197++eviscerate,C79C6E,1,0,15|t++119279++ambush,C79C6E,2,0,15|t++75345++hemorrhage,C79C6E,3,0,15|t++63301++backstab,C79C6E,4,0,15|t++43924++shadow_blade,9482C9,5,0,15|t++22081++shadow_blade_offhand,9482C9,6,0,15|t++19990++melee_main_hand,C79C6E,7,0,15|t++10043++melee_off_hand,C79C6E,8,0,15&chtt=Rogue_Subtlety_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,15,14,9,9,8,7,7,5,3,3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473,C55D54,C79C6E,9482C9,C79C6E,9482C9&chl=eviscerate|backstab|melee_main_hand|deadly_poison_instant|ambush|deadly_poison_dot|rupture|melee_off_hand|shadow_blade|hemorrhage|shadow_blade_offhand&chtt=Rogue_Subtlety_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:ww23776677777875431zzzyuspnnmlkiihiiihhhhggffeddcbaZZZZYYWWVVVXYaacddefghhhghhhhhggedbaZYXWVUUUUUUUUUVVVVVVVUUTUUUTTTTTUTTTVXYZabcdeefgghghhiiihfddcaZYXXWVUVUUUTTUUUUUUVVVWWWWXXXXXXXYYacegijklnnoooooooooonljhgecbaZYYXXXXXXXXXXYYYYYYYYYYYXXXXWWXXYZabbccccddeeefffffeecbaZYYYXXXWWWVVVVVVVVUUUUUUTTTTTTTTTTUVWXYZabcddeeeffgggggfeedddccccbbbbbaaaaaaaaZZYYXXXXXXXXXXXYYZbdfgijklmnnnooppppponmkigfdcaZYYXWWWVVVVUVUUUUVVVVVVWWVVVVVWWXYZZabbbccdddefffffffedccbaaZZZYYXXWWWWVVVVVVVVVVVVVVVVVVVVXYZabcddeeeefffgggggggfeeeeeeeeeeeeeeddddccbaaZYXXXWWWVVVUWVVVVVVWWWWV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=120846|max=253107&chxp=1,1,48,100&chtt=Rogue_Subtlety_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:6,7,10,17,15,43,49,90,140,186,219,242,317,427,425,522,502,536,565,545,520,535,509,468,463,408,338,332,276,237,197,168,165,124,112,69,75,38,28,23,17,13,10,5,2,2,1,1,0,1&chds=0,565&chbh=5&chxt=x&chxl=0:|min=112524|avg=120846|max=132633&chxp=0,1,41,100&chtt=Rogue_Subtlety_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.1,14.5,8.7,4.6,4.6,3.0,0.8,0.5,34.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,FFFFFF,C79C6E,ffffff&chl=backstab 131.1s|eviscerate 65.5s|ambush 39.1s|rupture 20.9s|hemorrhage 20.6s|slice_and_dice 13.3s|pool_resource 3.5s|preparation 2.1s|waiting 154.9s&chtt=Rogue_Subtlety_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Subtlety_T14H 120846
ambush 10380 8.6% 37.7 11.71sec 123628 119279 82404 174359 123628 44.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.73 37.73 0.00 0.00 1.0365 0.0000 4664032.24 4664032.24 0.00 119278.61 119278.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.81 55.17% 82403.98 49486 115791 82427.24 71649 95869 1715090 1715090 0.00
crit 16.91 44.83% 174359.47 101942 238529 174430.51 145260 200463 2948942 2948942 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=5&anticipation_charges=0
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
backstab 18439 15.3% 126.5 3.54sec 65612 63301 46863 98783 65612 36.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: backstab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.51 126.51 0.00 0.00 1.0365 0.0000 8300434.55 8300434.55 0.00 63301.21 63301.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.82 63.89% 46863.09 32742 81389 46896.02 43957 50219 3787625 3787625 0.00
crit 45.68 36.11% 98783.38 67449 167662 98878.08 88789 110362 4512810 4512810 0.00
DPS Timeline Chart

Action details: backstab

Static Values
  • id:53
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
Spelldata
  • id:53
  • name:Backstab
  • school:physical
  • tooltip:(null)
  • description:Backstab the target, causing $m2% weapon damage plus $m1 to the target. Must be behind the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:382.61
  • base_dd_max:382.61
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
berserking 0 0.0% 2.9 181.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.91 2.91 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 9640 8.0% 321.5 1.54sec 13505 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.5 20416 43095 29042 38.0% 0.0% 99.5%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 321.48 321.48 149.49 149.49 0.0000 3.0000 4341539.69 4341539.69 0.00 9680.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 321.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.6 61.97% 20416.07 14677 33334 20422.89 19508 21410 1891247 1891247 0.00
crit 56.9 38.03% 43095.40 30235 68669 43120.22 40581 46251 2450293 2450293 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 10734 8.9% 320.5 1.54sec 15071 0 10537 22325 15071 38.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 320.46 320.46 0.00 0.00 0.0000 0.0000 4829854.33 4829854.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.19 61.53% 10536.80 7519 17070 10541.45 9996 11057 2077729 2077729 0.00
crit 123.28 38.47% 22324.85 15488 35164 22338.85 21196 24072 2752125 2752125 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 24520 20.3% 63.2 7.09sec 174337 168197 118961 258515 174337 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.22 63.22 0.00 0.00 1.0365 0.0000 11021432.86 11021432.86 0.00 168196.82 168196.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.13 60.32% 118961.15 88072 197225 119011.06 105049 132137 4536381 4536381 0.00
crit 25.09 39.68% 258514.85 181428 406284 258858.15 226324 313684 6485052 6485052 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
hemorrhage 3447 2.9% 19.9 23.22sec 78095 75345 30074 63176 42606 37.9% 0.0% 0.0% 0.0% 146.7 3388 7169 4808 37.6% 0.0% 97.6%

Stats details: hemorrhage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.87 19.87 146.66 146.66 1.0365 3.0000 1551797.26 1551797.26 0.00 3369.27 75344.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.35 62.14% 30073.50 20468 49395 30080.76 25844 35002 371333 371333 0.00
crit 7.52 37.86% 63175.83 42164 99689 63252.15 0 88318 475278 475278 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.6 62.44% 3388.33 1331 9740 3390.43 2421 5123 310307 310307 0.00
crit 55.1 37.56% 7169.42 2741 20064 7174.32 4887 9755 394880 394880 0.00
DPS Timeline Chart

Action details: hemorrhage

Static Values
  • id:16511
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<4&(dot.hemorrhage.remains<4|position_front)
Spelldata
  • id:16511
  • name:Hemorrhage
  • school:physical
  • tooltip:(null)
  • description:An instant strike that deals $m2% weapon damage (${$m2*1.45}% if a dagger is equipped)$?s56807[. When used on a target that is bleeding, opens the wound further to deal][, causing profuse bleeding that deals] an additional $s4% of the direct strike's damage over $89775d. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2502.88
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.03
melee_main_hand 16677 13.8% 433.6 0.98sec 17352 19990 14698 31642 17352 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 433.55 433.55 0.00 0.00 0.8680 0.0000 7523184.03 7523184.03 0.00 19990.50 19990.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.08 20.08% 14697.55 10396 24743 14703.09 13524 15808 1279826 1279826 0.00
crit 159.97 36.90% 31642.44 21416 53851 31655.90 30119 33526 5061968 5061968 0.00
glance 104.13 24.02% 11345.80 7797 18912 11350.41 10724 12157 1181390 1181390 0.00
miss 82.37 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 8387 7.0% 434.1 0.98sec 8715 10043 7373 15876 8715 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 434.07 434.07 0.00 0.00 0.8678 0.0000 3783170.49 3783170.49 0.00 10043.09 10043.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 87.08 20.06% 7373.26 5198 12608 7375.98 6889 7913 642032 642032 0.00
crit 160.47 36.97% 15875.93 10708 26926 15883.58 14927 16810 2547565 2547565 0.00
glance 104.25 24.02% 5693.70 3899 9803 5695.70 5385 6090 593573 593573 0.00
miss 82.28 18.96% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
premeditation 0 0.0% 10.3 47.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.27 10.27 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:(null)
  • description:When used, adds $s1 combo points to your target. You must add to or use those combo points within $d or the combo points are lost.
preparation 0 0.0% 2.0 300.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 8586 7.1% 20.1 22.84sec 192131 185370 0 0 0 0.0% 0.0% 0.0% 0.0% 220.6 12381 25974 17533 37.9% 0.0% 97.9%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.13 20.13 220.58 220.58 1.0365 2.0000 3867561.04 3867561.04 0.00 8370.80 185370.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.0 62.09% 12380.59 10772 18712 12384.64 11700 13330 1695727 1695727 0.00
crit 83.6 37.91% 25973.66 22190 38547 25980.82 24429 28244 2171834 2171834 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&dot.rupture.remains<5
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 6702 5.5% 92.3 4.21sec 32382 43924 21649 45844 32382 44.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.30 92.30 0.00 0.00 0.7372 0.0000 2988796.31 2988796.31 0.00 43924.47 43924.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.35 55.64% 21649.39 15455 30133 21659.99 20297 23273 1111785 1111785 0.00
crit 40.94 44.36% 45843.72 31838 62075 45855.81 42570 49684 1877011 1877011 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 3335 2.7% 91.3 4.24sec 16289 22081 10874 23020 16289 44.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.30 91.30 0.00 0.00 0.7377 0.0000 1487134.59 1487134.59 0.00 22080.69 22080.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.59 55.41% 10873.72 7728 15067 10879.39 10098 11875 550112 550112 0.00
crit 40.70 44.59% 23020.34 15919 31037 23026.99 21375 24949 937022 937022 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 3.0 180.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
shadow_dance 0 0.0% 7.8 60.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 7.76 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
slice_and_dice 0 0.0% 13.9 35.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.87 13.87 0.00 0.00 0.9617 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 14.6 31.39sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.63 14.63 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.2 105.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.15 4.15 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.9 0.0 181.2sec 181.2sec 6.42% 7.10%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.4%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 9.90%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 12.3 8.9 36.4sec 20.5sec 43.11% 42.84%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:43.1%
dancing_steel_oh 10.5 5.3 42.1sec 27.2sec 34.11% 33.92%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:34.1%
master_of_subtlety 5.2 0.0 87.5sec 105.2sec 6.92% 6.92%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:6.9%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:(null)
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional $s1% damage.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 7.9 0.0 60.3sec 60.3sec 25.92% 25.92%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.9%
shadow_blades 3.0 0.0 180.5sec 180.5sec 15.67% 16.11%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:15.7%
shadow_dance 7.8 0.0 60.4sec 60.4sec 13.66% 13.66%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_dance_1:13.7%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
  • max_stacks:
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
slice_and_dice 3.5 10.3 132.3sec 35.0sec 99.18% 99.48%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.2%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

synapse_springs_2 7.8 0.0 60.4sec 60.4sec 17.02% 17.02%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.0%
terror_in_the_mists 7.6 0.0 62.9sec 62.9sec 33.18% 33.18%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:33.2%
tricks_of_the_trade 14.6 0.0 31.4sec 31.4sec 19.33% 100.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.3%
tricks_of_the_trade_trigger 14.6 0.0 31.4sec 31.4sec 1.38% 1.38%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.4%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.2 0.0 105.2sec 105.2sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

virmens_bite_potion 2.0 0.0 413.5sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T14H
ambush Energy 37.7 1302.9 34.5 34.5 3579.6
backstab Energy 126.5 4427.7 35.0 35.0 1874.6
eviscerate Energy 63.2 2212.7 35.0 35.0 4981.1
hemorrhage Energy 19.9 596.1 30.0 30.0 2603.2
rupture Energy 20.1 503.2 25.0 25.0 7685.2
slice_and_dice Energy 13.9 321.7 23.2 23.2 0.0
tricks_of_the_trade Energy 14.6 219.5 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1801.91 5336.50 2.96 27.07 0.50%
energetic_recovery Energy 1787.04 1775.95 0.99 11.09 0.62%
relentless_strikes Energy 96.61 2405.44 24.90 9.91 0.41%
Resource RPS-Gain RPS-Loss
Energy 21.12 21.27
Combat End Resource Mean Min Max
Health 457343.00 457343.00 457343.00
Energy 33.87 0.38 98.03
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.3%

Procs

Count Interval
hat_donor 467.8 1.9sec
honor_among_thieves 212.4 2.1sec
no_revealing_strike 558.5 1.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 120846.26
Minimum 112524.17
Maximum 132633.50
Spread ( max - min ) 20109.33
Range [ ( max - min ) / 2 * 100% ] 8.32%
Standard Deviation 2854.8233
5th Percentile 116440.27
95th Percentile 125864.19
( 95th Percentile - 5th Percentile ) 9423.92
Mean Distribution
Standard Deviation 28.5482
95.00% Confidence Intervall ( 120790.31 - 120902.22 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2143
0.1 Scale Factor Error with Delta=300 69573
0.05 Scale Factor Error with Delta=300 278292
0.01 Scale Factor Error with Delta=300 6957322
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 120846.26

Damage

Sample Data
Count 10000
Mean 54358937.39

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 350.15
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
6 0.00 premeditation
7 0.00 slice_and_dice
Default action list
# count action,conditions
8 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
9 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
A 5.15 auto_attack
B 0.00 kick
C 3.01 shadow_blades
D 9.64 pool_resource,for_next=1,extra_amount=75
E 7.76 shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
F 7.75 use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
G 2.91 berserking,if=buff.shadow_dance.up
H 2.55 pool_resource,for_next=1,extra_amount=30
I 4.15 vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
J 9.27 premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
K 37.53 ambush,if=combo_points<=5&anticipation_charges=0
L 12.87 slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
M 20.13 rupture,if=combo_points=5&dot.rupture.remains<5
N 0.20 ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
O 63.22 eviscerate,if=combo_points=5
P 17.50 hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
Q 2.37 hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
R 119.51 backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
S 14.63 tricks_of_the_trade
T 6.99 backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

Sample Sequence

ACKQMRORRORSDDDDDEFGKOKOKLKKOQMRTORIAJK9ORORRRORHIAKSORRRMPRLRRRORRORTMPSDDDDDEFKKOKOJKORLRRRMRPORRSORRORRRMPRLRRROTSOEFJKKMKOKOPRRORRLRRRMRSROPRORRORRCRMROPSLEFGJKOKOKKOKMRORROPRORROIAJKMRRRSLRROPRRORRMTTODEFJKKOKSOKLPRMRRRORRORROPRSMRRRLRRORROPEFJKMKKOKSORROR9IAKLPRMRRRORRORRSOPRMRCRORRLTOEFGJKOKOKKMKSOPORRORRORRLRRMP8RRSORRORRORPMEFJKKLKOKKSOOR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 28047 24937 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.17% 15.17% 2558
Spell Crit 11.67% 6.67% 3997
Spell Haste 20.12% 14.40% 6122
Mana Per 5 0 0 0
Attack Power 62115 50237 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 33.63% 26.16% 3997
Melee Haste 14.40% 14.40% 6122
Swing Speed 25.85% 14.40% 6122
Expertise 7.65% / 7.65% 7.65% / 7.65% 2600
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 53.37% 38.37% 2876

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Subtlety_T14H"
origin="unknown"
level=90
race=troll
spec=subtlety
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth
actions.precombat+=/premeditation
actions.precombat+=/slice_and_dice

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/shadow_blades
actions+=/pool_resource,for_next=1,extra_amount=75
actions+=/shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
actions+=/use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/pool_resource,for_next=1,extra_amount=30
actions+=/vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=5&anticipation_charges=0
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&dot.rupture.remains<5
actions+=/ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
actions+=/eviscerate,if=combo_points=5
actions+=/hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
actions+=/hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
actions+=/backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
actions+=/tricks_of_the_trade
actions+=/backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=mastery_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2600
# gear_hit_rating=2558
# gear_crit_rating=3997
# gear_haste_rating=6122
# gear_mastery_rating=2876
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Shaman_Elemental_T14H : 106995 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
106995.0 106995.0 64.66 / 0.06% 5424 / 5.1% 34.1 2864.3 2841.5 Mana 0.00% 44.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://5.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:179466|130117|111369|55924|30128&chds=0,358933&chco=C41F3B,C41F3B,00FF96,ABD473,ABD473&chm=t++179466++lava_burst,C41F3B,0,0,15|t++130117++flame_shock,C41F3B,1,0,15|t++111369++elemental_blast,00FF96,2,0,15|t++55924++lightning_bolt,ABD473,3,0,15|t++30128++earth_shock,ABD473,4,0,15&chtt=Shaman_Elemental_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,20,11,9,8,6,5,5,3,3,3,2,1,1,1,0,0,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,00FF96,ABD473,C41F3B,C41F3B,00FF96,ABD473,C41F3B,C41F3B,ABD473,C79C6E,C41F3B,00FF96,C41F3B,ABD473,00FF96,ABD473,C41F3B&chl=lava_burst|lightning_bolt|lava_burst_overload|fulmination|elemental_blast|lightning_bolt_overload|flame_shock|greater_fire_elemental: fire_melee|elemental_blast_overload|earth_shock|searing_totem: searing_bolt|lava_burst_eoe|lightning_bolt_eoe|greater_earth_elemental: earth_melee|lava_burst_overload_eoe|elemental_blast_eoe|greater_fire_elemental: fire_blast|lightning_bolt_overload_eoe|elemental_blast_overload_eoe|earth_shock_eoe|flame_shock_eoe&chtt=Shaman_Elemental_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:lortvwyyz01367867430yxvtrpnljigedcccdccccddcbbbbaZZYXXXWXXXXXXXWWWWWWWXXYYYYYXWWVVVVVVVVVVVUUTTTTTTTUUVVVVUUUUUTTTUUUVVVVUUUUUUVVVVWWXXXWWWVVVVVVVVVVVVUUUUUUUUUVVVWWVVVVVVVUUUUUUVWWXYZaabcdefghjjjjjjihgfedcbaaZYXWVUUUUVVVVVWWWWWWWVVVUUUUUUUUVVUUUTUUUUUUVVWWWWVVVUUUUUVVVVVVVVVVVVVVVWWWWWWWVVVUUUUUUVWWWWWWXXXXYYZaabcccbbbbaaaaaaabbbaaaaaaaaaaaaabbaaaZZZYYXXWWXXXYZZabcdefghijklllllkjihgfedcbaZYXWVVVVUUUUVVVVVVVVVVUUUTTTUUUUUTTTTTTTTUUUVVVVVVVVVVVUUUUVVVUUUUUUUUUUUUVVVVVVVVVVUUUUUUUUUUUUUUUUVVVVVVWWWWWVVVVVVVUUUUUUTTTTTTUUUUUUUUUUVUUUUUUTTTTTSSSSRRRRQQQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=106995|max=253890&chxp=1,1,42,100&chtt=Shaman_Elemental_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,1,5,8,12,26,34,60,89,125,170,165,271,306,345,417,457,480,520,531,567,565,585,529,539,450,436,406,361,285,271,220,167,150,116,80,65,48,39,27,24,14,9,10,1,5,2,0,4&chds=0,585&chbh=5&chxt=x&chxl=0:|min=96064|avg=106995|max=119921&chxp=0,1,46,100&chtt=Shaman_Elemental_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.0,22.9,10.6,9.0,4.1,1.4,0.5,0.5&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,00FF96,ABD473,C41F3B,C79C6E,C79C6E,C79C6E&chl=lightning_bolt 220.6s|lava_burst 103.1s|elemental_blast 47.9s|earth_shock 40.5s|flame_shock 18.6s|searing_totem 6.1s|fire_elemental_totem 2.1s|earth_elemental_totem 2.1s&chtt=Shaman_Elemental_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Elemental_T14H 106995
ascendance 0 0.0% 2.9 181.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.94 2.94 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.2 121.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.24 4.24 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 301.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 2559 (2707) 2.4% (2.5%) 33.5 12.55sec 36417 30128 26755 69621 34420 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.54 33.54 0.00 0.00 1.2087 0.0000 1154499.34 1154499.34 0.00 30128.49 30128.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.54 82.12% 26755.47 24039 35670 26761.01 25531 28324 736950 736950 0.00
crit 6.00 17.88% 69620.59 62260 92385 69548.97 0 87982 417549 417549 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 149 0.1% 2.0 108.30sec 33492 0 25969 67478 33492 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 66969.97 66969.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.64 81.88% 25968.66 24039 34233 20996.45 0 34233 42516 42516 0.00
crit 0.36 18.12% 67478.18 62260 88664 20502.67 0 88664 24454 24454 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
elemental_blast 8209 (11854) 7.7% (11.1%) 29.6 15.29sec 180454 111369 96391 250845 125193 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.59 29.54 0.00 0.00 1.6203 0.0000 3697788.98 3697788.98 0.00 111368.64 111368.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.03 81.35% 96391.09 83944 125881 96423.00 91321 101651 2316162 2316162 0.00
crit 5.51 18.65% 250844.56 217415 326032 250135.76 0 326032 1381627 1381627 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_eoe 488 0.5% 1.8 113.36sec 124828 0 96666 252367 125048 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.76 1.76 0.00 0.00 0.0000 0.0000 219659.09 219659.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.44 81.77% 96666.12 83944 132362 73556.51 0 132362 138851 138851 0.00
crit 0.32 18.23% 252366.90 217415 342818 69363.15 0 342818 80808 80808 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_overload 2978 2.8% 14.3 30.33sec 93714 0 72570 188800 93877 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.31 14.29 0.00 0.00 0.0000 0.0000 1341253.52 1341253.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.67 81.67% 72569.94 62958 99272 72596.98 65477 83647 846768 846768 0.00
crit 2.62 18.33% 188799.86 163062 257114 175826.97 0 257114 494486 494486 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
elemental_blast_overload_eoe 178 0.2% 0.9 140.22sec 93428 0 72400 188607 93559 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.86 0.86 0.00 0.00 0.0000 0.0000 80310.97 80310.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.70 81.79% 72399.60 62958 99272 36839.27 0 99272 50832 50832 0.00
crit 0.16 18.21% 188606.59 163062 257114 27355.11 0 257114 29479 29479 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
fire_elemental_totem 0 0.0% 2.0 1.#Rsec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 5336 (5372) 5.0% (5.0%) 15.3 30.44sec 158572 130117 14781 38451 18920 17.5% 0.0% 0.0% 0.0% 191.1 8639 22447 11064 17.6% 0.0% 98.5%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.26 15.26 191.07 191.07 1.2187 2.3242 2402673.34 2402673.34 0.00 5229.03 130117.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.59 82.51% 14781.38 13453 20147 14782.87 13822 16137 186078 186078 0.00
crit 2.67 17.49% 38451.12 34844 50023 36227.95 0 47515 102584 102584 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.5 82.43% 8638.74 8146 11178 8640.63 8293 9109 1360617 1360617 0.00
crit 33.6 17.57% 22446.55 21098 28951 22448.12 21246 24114 753394 753394 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 37 0.0% 0.9 153.88sec 18157 0 14355 37396 18157 16.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.91 0.91 0.00 0.00 0.0000 0.0000 16595.15 16595.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.76 83.50% 14355.15 13453 19178 7716.58 0 19178 10956 10956 0.00
crit 0.15 16.50% 37395.90 34844 47471 5235.21 0 47471 5639 5639 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 9233 8.7% 33.5 12.55sec 124215 0 96313 250616 124215 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.54 33.54 0.00 0.00 0.0000 0.0000 4166348.90 4166348.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.48 81.92% 96312.82 60617 136990 96344.82 88175 102996 2646310 2646310 0.00
crit 6.07 18.08% 250616.42 156997 354805 250327.21 0 322550 1520039 1520039 0.00
DPS Timeline Chart

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.388000
  • base_dd_min:629.69
  • base_dd_max:629.69
lava_burst 28576 (41232) 26.7% (38.5%) 88.2 5.08sec 209869 179466 0 145695 145695 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.19 88.05 0.00 0.00 1.1694 0.0000 12828187.22 12828187.22 0.00 179466.38 179466.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 88.05 100.00% 145694.89 121234 192255 145755.52 141505 149968 12828187 12828187 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_eoe 1687 1.6% 5.3 70.56sec 143403 0 51244 143859 143653 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.28 5.27 0.00 0.00 0.0000 0.0000 756577.90 756577.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.22% 51244.17 46808 63353 599.56 0 63353 600 600 0.00
crit 5.25 99.78% 143858.87 121234 192255 143060.11 0 192255 755978 755978 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_overload 10335 9.6% 43.0 10.35sec 107913 0 38502 108324 108196 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.99 42.88 0.00 0.00 0.0000 0.0000 4639093.46 4639093.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.08 0.18% 38502.03 35106 48827 2881.93 0 48051 3034 3034 0.00
crit 42.80 99.82% 108324.21 90925 144191 108369.46 101268 115772 4636059 4636059 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lava_burst_overload_eoe 633 0.6% 2.6 107.51sec 110699 0 41083 111147 110997 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.57 2.56 0.00 0.00 0.0000 0.0000 284329.40 284329.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.21% 41083.30 38617 48827 222.10 0 48827 226 226 0.00
crit 2.56 99.79% 111147.23 90925 144191 102207.83 0 144191 284103 284103 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lightning_bolt 19566 (27358) 18.3% (25.6%) 144.0 2.96sec 85669 55924 47873 124564 61384 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.03 143.76 0.00 0.00 1.5319 0.0000 8824439.26 8824439.26 0.00 55923.58 55923.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.43 82.38% 47873.30 42194 63523 47879.87 47014 48997 5669760 5669760 0.00
crit 25.33 17.62% 124563.87 109281 164523 124543.93 116892 133500 3154680 3154680 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 1137 1.1% 8.6 43.92sec 59473 0 46542 121108 59579 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.62 8.61 0.00 0.00 0.0000 0.0000 512821.71 512821.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.10 82.52% 46542.29 42194 63523 46482.46 0 58092 330567 330567 0.00
crit 1.50 17.48% 121107.77 109281 157623 93324.28 0 157623 182255 182255 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_overload 6284 5.9% 66.8 6.33sec 42409 0 33265 86519 42551 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.82 66.60 0.00 0.00 0.0000 0.0000 2833846.76 2833846.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.99 82.56% 33265.20 30139 45374 33268.54 32045 34864 1829160 1829160 0.00
crit 11.61 17.44% 86519.18 78059 117518 86536.32 78619 102742 1004687 1004687 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
lightning_bolt_overload_eoe 371 0.3% 4.0 76.35sec 42265 0 33296 86579 42399 17.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 3.95 0.00 0.00 0.0000 0.0000 167423.95 167423.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.27 82.92% 33296.04 30139 45374 31923.72 0 43471 109018 109018 0.00
crit 0.67 17.08% 86578.78 78059 112589 42226.41 0 112589 58406 58406 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
searing_totem 0 0.0% 5.9 72.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.90 5.90 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=2&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
pet - greater_fire_elemental 20713 / 5599
fire_blast 1443 0.4% 20.0 18.76sec 8658 0 6797 17167 8658 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.98 19.98 0.00 0.00 0.0000 0.0000 172979.34 172979.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.39 82.06% 6797.24 6103 8922 6796.44 6318 7306 111434 111434 0.00
crit 3.59 17.94% 17167.01 15259 22304 16853.69 0 22304 61545 61545 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 19270 4.8% 111.0 3.24sec 20823 22025 17074 43206 20823 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.96 110.96 0.00 0.00 0.9454 0.0000 2310562.01 2310562.01 0.00 22025.28 22025.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.06 57.73% 17073.93 15391 21961 17073.55 16434 17723 1093723 1093723 0.00
crit 20.23 18.23% 43206.24 38478 54902 43213.13 39399 47971 874092 874092 0.00
glance 26.67 24.04% 12850.56 11544 16471 12850.88 11868 14198 342746 342746 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 4204 / 1116
earth_melee 4204 1.0% 77.1 4.67sec 6443 4495 5767 11584 6443 17.5% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.07 77.07 0.00 0.00 1.4333 0.0000 496551.03 496551.03 0.00 4495.18 4495.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.10 58.52% 5766.99 5478 7529 5765.13 5552 6111 260105 260105 0.00
crit 13.51 17.54% 11583.61 10955 15059 11578.66 10955 12995 156547 156547 0.00
glance 18.45 23.94% 4330.27 4108 5647 4328.80 4108 4747 79899 79899 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3697 / 2524
searing_bolt 3697 2.4% 190.6 2.02sec 6007 0 4715 12260 6036 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 190.62 189.73 0.00 0.00 0.0000 0.0000 1145145.49 1145145.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 156.51 82.49% 4714.67 4185 6029 4714.83 4599 4831 737885 737885 0.00
crit 33.22 17.51% 12260.42 10840 15615 12260.69 11530 13201 407260 407260 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.9 0.0 181.5sec 181.5sec 9.71% 9.71%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:9.7%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.2 0.0 121.1sec 121.1sec 13.83% 13.83%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.8%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 14.04%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
elemental_blast_crit 10.5 0.0 40.1sec 40.1sec 17.48% 17.48%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_crit
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_crit_1:17.5%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_haste 10.5 0.0 40.1sec 40.1sec 17.51% 17.51%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_haste_1:17.5%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_mastery 10.4 0.0 40.3sec 40.3sec 17.41% 17.41%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:mastery_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_mastery_1:17.4%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_focus 67.7 64.5 6.6sec 3.4sec 57.54% 58.77%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • elemental_focus_1:30.6%
  • elemental_focus_2:26.9%

Spelldata details

  • id:16246
  • name:Clearcasting
  • tooltip:Your next $n spells have their mana cost reduced by $s1%. Spell damage increased by $s2%. Single-target healing done increased by $s4%.
  • description:After landing a critical strike with a Fire, Frost, or Nature damage spell, you enter a Clearcasting state. The Clearcasting state reduces the mana cost of your next $16246n spells by $16246s1%, increases your spell damage by $s2%, and increases single-target healing done by $s4%.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 7.4 0.0 64.7sec 64.7sec 31.99% 31.99%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.0%
jade_serpent_potion 2.0 0.0 301.9sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.3 0.0 56.7sec 56.7sec 21.81% 21.47%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.8%
relic_of_yulon 8.8 0.0 53.4sec 53.4sec 28.89% 28.89%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.9%
synapse_springs_2 7.8 0.0 61.3sec 61.3sec 17.19% 17.19%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
lightning_shield

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:7
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:31.2%
  • lightning_shield_3:22.9%
  • lightning_shield_5:20.8%
  • lightning_shield_7:25.1%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T14H
ascendance Mana 2.9 9170.9 3120.0 3120.0 0.0
bloodlust Mana 0.0 65.8 12900.0 12900.0 0.0
earth_elemental_totem Mana 2.0 33720.0 16860.0 16860.0 0.0
earth_shock Mana 33.5 254274.8 7580.9 7580.9 4.8
fire_elemental_totem Mana 2.0 32278.0 16139.0 16139.0 0.0
flame_shock Mana 15.3 99576.4 6526.8 6526.8 24.3
lava_burst Mana 88.2 337462.6 3826.6 3826.6 54.8
lightning_bolt Mana 144.0 503204.7 3493.8 3493.8 24.5
searing_totem Mana 5.9 20886.4 3540.0 3540.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 629530.89 349.37 46184.08 6.83%
rolling_thunder Mana 128.70 650846.27 5057.21 121333.93 15.71%
Resource RPS-Gain RPS-Loss
Mana 2841.48 2864.26
Combat End Resource Mean Min Max
Health 463699.00 463699.00 463699.00
Mana 289819.86 250666.00 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 33.6 13.0sec
lava_surge 38.1 11.5sec
lightning_shield_too_fast_fill 6.1 61.1sec
rolling_thunder 128.7 3.3sec
wasted_lightning_shield 45.5 17.9sec
wasted_lightning_shield_shock_cd 12.3 61.1sec
fulmination_4 2.3 105.9sec
fulmination_6 31.2 13.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 106994.97
Minimum 96064.37
Maximum 119921.08
Spread ( max - min ) 23856.71
Range [ ( max - min ) / 2 * 100% ] 11.15%
Standard Deviation 3298.8260
5th Percentile 101717.50
95th Percentile 112564.91
( 95th Percentile - 5th Percentile ) 10847.41
Mean Distribution
Standard Deviation 32.9883
95.00% Confidence Intervall ( 106930.31 - 107059.62 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3651
0.1 Scale Factor Error with Delta=300 92897
0.05 Scale Factor Error with Delta=300 371588
0.01 Scale Factor Error with Delta=300 9289716
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 106994.97

Damage

Sample Data
Count 10000
Mean 43992818.92

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 337.32
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 flametongue_weapon,weapon=main
3 0.00 lightning_shield,if=!buff.lightning_shield.up
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 wind_shear
7 0.01 bloodlust,if=target.health.pct<25|time>5
8 1.00 jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
9 0.00 run_action_list,name=single,if=num_targets=1
A 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
L 7.82 use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
M 4.24 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
N 0.00 elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
O 2.00 fire_elemental_totem,if=!active
P 2.94 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
Q 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
R 0.00 unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
S 15.26 flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
T 88.41 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
U 29.69 elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
V 30.54 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
W 3.00 earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
X 2.00 earth_elemental_totem,if=!active
Y 5.90 searing_totem,if=!totem.fire.active
Z 0.00 spiritwalkers_grace,moving=1
a 0.00 unleash_elements,moving=1
b 144.52 lightning_bolt

Sample Sequence

OLSTUXMPTTTTTTTTTTTTTTTUbbTSbbTbbVbUbbTbVbbbVTUbbbbSTYLbVUbTbbbTbbTUVbbTbbSbbTUVbbbTVbbUbTVbbbSYLTUVMbbbTbbbVbTUbTbbTbSbbTUVbTbbbbTVUbbbTSbYbUPLTTTTTTTTTTTTTUVbbbbSTbbUVbbTbbVbUTbWbbbSTYUTLMVbbbbTVUbbbbTVbbbSUTbbTVbbbTUTVbbbWbTO8SUXbLbTbbVbTUVbbbbTbSbTUVbbbbTbbbTUVbbbbTVYbUSPMTLTTTTTTTTTTTUbbTWbbbSUTbVbbbbTVbTUbbbVTbYSbTULVbbbbTVbbUbTV

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 180 171 80
Stamina 22664 20604 20442
Intellect 22230 19806 18716
Spirit 5351 5351 5180
Health 463699 434859 0
Mana 300000 300000 0
Spell Power 33139 27703 7907
Spell Hit 15.24% 15.24% 0
Spell Crit 18.87% 12.91% 1735
Spell Haste 18.78% 13.13% 5579
Mana Per 5 7500 7500 0
Attack Power 788 687 0
Melee Hit 15.24% 15.24% 0
Melee Crit 10.95% 5.95% 1735
Melee Haste 13.13% 13.13% 5579
Swing Speed 24.44% 13.13% 5579
Expertise 0.00% 0.00% 0
Armor 43524 43524 43524
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.62% 34.62% 5585

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Elemental_T14H"
origin="unknown"
level=90
race=orc
spec=elemental
role=spell
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/flametongue_weapon,weapon=main
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=ascendance
actions.ae+=/lava_beam
actions.ae+=/magma_totem,if=num_targets>2&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=2&!totem.fire.active
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking&num_targets<3
actions.ae+=/lava_burst,if=num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
actions.ae+=/earthquake,if=num_targets>4
actions.ae+=/thunderstorm,if=mana.pct_nonproc<80
actions.ae+=/chain_lightning,if=mana.pct_nonproc>10
actions.ae+=/lightning_bolt

actions.single=use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
actions.single+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
actions.single+=/fire_elemental_totem,if=!active
actions.single+=/ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/unleash_elements,moving=1
actions.single+=/lightning_bolt

head=firebirds_headpiece,id=87141,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=firebirds_shoulderwraps,id=87143,gems=160int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int
chest=mail_of_screaming_secrets,id=86951,gems=160int_80int_160mastery_120int,enchant=80all
wrists=bracers_of_tempestuous_fury,id=86962,enchant=180int,reforge=spi_mastery
hands=firebirds_gloves,id=87140,enchant=170mastery,addon=synapse_springs_mark_ii
waist=binders_chain_of_unending_summer,id=87183,gems=160int_160int
legs=firebirds_kilt,id=87142,gems=160int_60int,enchant=285int_165spi
feet=lightning_prisoners_boots,id=90515,gems=160int,enchant=170haste,reforge=spi_mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=watersoul_signet,id=90511,enchant=160int,reforge=spi_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,gems=500int,enchant=jade_spirit
off_hand=eye_of_the_ancient_spirit,id=87039,enchant=165int,reforge=spi_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20442
# gear_intellect=18716
# gear_spirit=5180
# gear_spell_power=7907
# gear_crit_rating=1735
# gear_haste_rating=5579
# gear_mastery_rating=5585
# gear_armor=43524
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=firebirds_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_2.40speed_3142min_5835max,enchant=jade_spirit

Shaman_Enhancement_T14H : 117041 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
117040.8 117040.8 60.77 / 0.05% 5109 / 4.4% 76.7 1308.1 1301.8 Mana 17.18% 38.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://4.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:183629|181228|97954|68237|67141|51581|40538|36615|18269|9584|4773&chds=0,367259&chco=ABD473,C41F3B,C41F3B,ABD473,C79C6E,ABD473,ABD473,ABD473,ABD473,C79C6E,C79C6E&chm=t++183629++stormblast,ABD473,0,0,15|t++181228++flame_shock,C41F3B,1,0,15|t++97954++lava_lash,C41F3B,2,0,15|t++68237++lightning_bolt,ABD473,3,0,15|t++67141++stormstrike,C79C6E,4,0,15|t++51581++earth_shock,ABD473,5,0,15|t++40538++unleash_elements,ABD473,6,0,15|t++36615++windlash_main_hand,ABD473,7,0,15|t++18269++windlash_off_hand,ABD473,8,0,15|t++9584++melee_main_hand,C79C6E,9,0,15|t++4773++melee_off_hand,C79C6E,10,0,15&chtt=Shaman_Enhancement_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,12,12,8,8,7,7,6,6,5,4,4,3,3,3,2,2,2,2,2,1,1,1,1,1,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,ABD473,C41F3B,C79C6E,C79C6E,C41F3B,C79C6E,C41F3B,ABD473,C79C6E,C79C6E,ABD473,ABD473,C41F3B,ABD473,C79C6E,C41F3B,ABD473,ABD473,ABD473,C79C6E,ABD473,C79C6E,C41F3B,C41F3B,C41F3B&chl=lava_lash|lightning_shield|lightning_bolt|greater_fire_elemental: fire_melee|melee_main_hand|stormstrike_mh|flame_shock|windfury_mh|flametongue_oh|earth_shock|melee_off_hand|stormstrike_oh|lightning_bolt_eoe|windlash_main_hand|searing_totem: searing_bolt|stormblast_mh|spirit_wolf: melee|unleash_flame|spirit_wolf: spirit_bite|windlash_off_hand|earth_shock_eoe|greater_earth_elemental: earth_melee|stormblast_oh|unleash_wind|unleash_flame_eoe|greater_fire_elemental: fire_blast|flame_shock_eoe&chtt=Shaman_Enhancement_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wwvuxzz024456767840yyxxxxvsrpnkkjihhggggghhgfeeeedccccdddeffeedddddddddeedddddcbaaZZZZZZYYYXXWWVUUUUUVVVVVVVVVVVVVUUUUVWXXXYXXXXYYYYZZaabcccbbaaaaaaaZaaaaaZZYXXWWWWWWWWWWWWVVVUVVWXYZabccddeeffffgghhhhgfedccbaaZYYYXXXXXWWVVVVUUUUVVVVWWWVVVVVVVWWXXXYYYYYYYYYYYZZZaaaaaaaaZZZZZZZZaaZZZYYXXWWWWWWWWWWWWWWWWXXXXYZZabbccccccccdddeeffffeeedddddeeeeeeedddcccbccccdccddddeeeeeffghiiiiiiiiihggffffffeedcbaaaZZZZZZZZZYYYXXWWWWWWVWWWWWWWVVVVVVVVWWWWWWWWWVVVVWWWWXXXXXWWWWWWWWWWWXXXWWWWVVVVVVVWWWXXXXWWWWWWWXXXXYYYYYXXXXXXYYYZZZZZZZZZYYYYYYYYYYYXXXWWVVVUUVVWWWWWVVVVWW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=117041|max=252048&chxp=1,1,46,100&chtt=Shaman_Enhancement_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,4,8,13,21,24,56,77,93,131,145,201,246,277,349,386,418,480,496,559,575,530,537,472,451,458,430,397,328,297,282,256,189,202,148,108,107,66,57,39,27,18,12,10,10,4,2,2,1&chds=0,575&chbh=5&chxt=x&chxl=0:|min=107222|avg=117041|max=128372&chxp=0,1,46,100&chtt=Shaman_Enhancement_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.2,16.2,13.9,12.6,8.4,4.0,2.0,1.6,1.1,0.5,0.5,17.2&chds=0,100&chdls=ffffff&chco=ABD473,C79C6E,C41F3B,ABD473,ABD473,C41F3B,ABD473,C79C6E,ABD473,C79C6E,C79C6E,ffffff&chl=lightning_bolt 100.0s|stormstrike 73.2s|lava_lash 62.5s|earth_shock 56.6s|unleash_elements 37.9s|flame_shock 18.2s|stormblast 8.9s|searing_totem 7.1s|feral_spirit 5.1s|earth_elemental_totem 2.1s|fire_elemental_totem 2.1s|waiting 77.4s&chtt=Shaman_Enhancement_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Enhancement_T14H 117041
ascendance 0 0.0% 2.9 182.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.92 2.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>=3
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.3 120.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.31 4.31 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 302.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 4988 (6484) 4.3% (5.6%) 43.8 10.15sec 66723 51581 32201 66746 51336 55.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.78 43.78 0.00 0.00 1.2935 0.0000 2247376.57 2247376.57 0.00 51581.34 51581.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.53 44.61% 32201.30 28637 46962 32206.19 29246 35882 628882 628882 0.00
crit 24.25 55.39% 66746.46 58993 96742 66773.79 60929 72817 1618495 1618495 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 1496 1.3% 13.1 31.79sec 51377 0 32180 66737 51377 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.11 13.11 0.00 0.00 0.0000 0.0000 673622.87 673622.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.83 44.45% 32180.04 28637 46962 32115.17 0 42386 187532 187532 0.00
crit 7.28 55.55% 66736.75 58993 96742 66698.80 0 91670 486090 486090 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
feral_spirit 0 0.0% 4.1 122.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.10 4.10 0.00 0.00 1.2515 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7200.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves that aid the Shaman in battle, lasting $d. Spirit Wolves' attacks heal them and their master for $<percent>% of damage done.
fire_elemental_totem 0 0.0% 2.0 300.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 7076 (7334) 6.1% (6.3%) 14.0 33.12sec 235731 181228 23833 49698 27858 15.6% 0.0% 0.0% 0.0% 166.7 14372 30008 16767 15.3% 0.0% 93.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 166.71 166.71 1.3007 2.5155 3185542.40 3185542.40 0.00 7545.15 181228.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.83 84.44% 23833.34 20660 34467 23841.43 21257 26517 281865 281865 0.00
crit 2.18 15.56% 49697.69 42559 71002 44907.13 0 71002 108311 108311 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.2 84.68% 14372.17 9552 21028 14378.29 13361 15454 2028989 2028989 0.00
crit 25.5 15.32% 30008.25 19676 43317 30014.39 26371 34474 766378 766378 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 258 0.2% 4.2 89.44sec 27776 0 23803 49674 27776 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.18 4.18 0.00 0.00 0.0000 0.0000 116077.55 116077.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.54 84.65% 23803.29 15892 34467 23396.53 0 32874 84202 84202 0.00
crit 0.64 15.35% 49673.98 32737 71002 23785.07 0 71002 31876 31876 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 5636 4.8% 300.6 1.50sec 8440 0 7213 15097 8440 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 300.56 300.56 0.00 0.00 0.0000 0.0000 2536740.58 2536740.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 253.78 84.43% 7212.70 4927 11554 7216.29 6957 7534 1830424 1830424 0.00
crit 46.79 15.57% 15096.95 10150 23802 15108.23 13567 16689 706317 706317 0.00
DPS Timeline Chart

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8024
  • name:Flametongue Weapon
  • school:fire
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing magical damage done by $10400s2%. Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 60 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:224.53
  • base_dd_max:224.53
improved_lava_lash 0 0.0% 39.3 11.38sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: improved_lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.29 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
DPS Timeline Chart

Action details: improved_lava_lash

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
lava_lash 13589 11.6% 40.7 11.00sec 150506 97954 108607 225969 150506 35.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.67 40.67 0.00 0.00 1.5365 0.0000 6121134.36 6121134.36 0.00 97953.82 97953.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.15 64.30% 108606.68 97621 135855 108616.89 105305 112852 2840151 2840151 0.00
crit 14.52 35.70% 225969.23 201669 279861 226056.47 214027 245260 3280983 3280983 0.00
DPS Timeline Chart

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.ticking
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target$?s55444[][ and spreading your Flame Shock from the target to up to four enemies within $105792A1 yards]. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.50
lightning_bolt 11688 (15141) 10.0% (13.0%) 77.4 5.76sec 88067 68237 42595 88457 68003 55.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.45 77.44 0.00 0.00 1.2906 0.0000 5265885.20 5265885.20 0.00 68237.02 68237.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.54 44.60% 42595.43 31490 68983 42603.41 38141 47077 1471071 1471071 0.00
crit 42.90 55.40% 88457.20 64869 142104 88501.34 81455 96360 3794814 3794814 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 3453 3.0% 22.8 18.93sec 68120 0 42751 88725 68129 55.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.83 22.82 0.00 0.00 0.0000 0.0000 1554882.80 1554882.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.22 44.80% 42751.03 31490 68983 42755.01 0 53422 437108 437108 0.00
crit 12.60 55.20% 88724.97 64869 142104 88766.34 68290 114389 1117775 1117775 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_shield 12431 10.6% 173.7 2.77sec 32212 0 20368 42129 32212 55.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.74 173.74 0.00 0.00 0.0000 0.0000 5596463.30 5596463.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.24 44.46% 20367.61 17800 30038 20373.64 19332 21586 1573180 1573180 0.00
crit 95.50 54.97% 42128.62 36669 61878 42145.25 39908 44778 4023283 4023283 0.00
none 1.00 0.58% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
melee_main_hand 7663 6.6% 220.4 2.04sec 15673 9584 13852 28920 15673 34.8% 18.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 220.36 220.36 0.00 0.00 1.6353 0.0000 3453820.61 3453820.61 0.00 9584.34 9584.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.08 22.27% 13851.79 13096 17644 13852.49 13400 14395 679789 679789 0.00
crit 76.79 34.85% 28919.84 26979 36347 28926.04 28057 30052 2220781 2220781 0.00
glance 52.82 23.97% 10474.74 9822 13233 10476.18 10144 10866 553251 553251 0.00
miss 41.68 18.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3810 3.3% 219.6 2.05sec 7822 4773 6922 14448 7822 34.8% 18.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 219.55 219.55 0.00 0.00 1.6387 0.0000 1717450.63 1717450.63 0.00 4773.45 4773.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.89 22.27% 6921.68 6548 8822 6921.95 6694 7203 338368 338368 0.00
crit 76.34 34.77% 14447.96 13489 18173 14450.61 14022 14854 1102956 1102956 0.00
glance 52.75 24.03% 5234.17 4911 6617 5234.82 5072 5443 276127 276127 0.00
miss 41.57 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_totem 0 0.0% 6.9 71.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.88 6.88 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=5&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
stormblast 0 (3652) 0.0% (3.1%) 5.8 75.04sec 282133 183629 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.78 5.78 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 183629.28 183629.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormblast

Static Values
  • id:115356
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5621.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Stormblast
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Hurl a staggering lightning blast at an enemy, dealing Nature damage equal to $115357s1% weapon damage and granting you an additional $115356s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $115356d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormblast_mh 2434 2.1% 5.8 75.04sec 188082 0 130426 273605 188082 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.78 5.78 0.00 0.00 0.0000 0.0000 1087662.01 1087662.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.45 59.73% 130425.86 115011 154947 129528.34 0 154947 450517 450517 0.00
crit 2.33 40.27% 273605.45 236922 319191 260307.22 0 319191 637145 637145 0.00
DPS Timeline Chart

Action details: stormblast_mh

Static Values
  • id:115357
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Stormblast
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormblast_oh 1217 1.0% 5.8 75.04sec 94050 0 65244 136706 94050 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.78 5.78 0.00 0.00 0.0000 0.0000 543884.14 543884.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.45 59.69% 65243.75 57505 77474 64762.58 0 77474 225208 225208 0.00
crit 2.33 40.31% 136706.18 118461 159596 130044.42 0 159596 318676 318676 0.00
DPS Timeline Chart

Action details: stormblast_oh

Static Values
  • id:115360
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Stormblast Off-Hand
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike 0 (10904) 0.0% (9.3%) 47.6 9.47sec 103160 67141 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.64 47.64 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 67140.99 67140.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5640.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormstrike_mh 7270 6.2% 47.6 9.47sec 68774 0 50090 103936 68774 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.64 47.64 0.00 0.00 0.0000 0.0000 3276570.92 3276570.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.11 65.30% 50089.95 47315 63057 50091.96 48585 51774 1558369 1558369 0.00
crit 16.53 34.70% 103935.69 97470 129898 103968.44 98406 110900 1718202 1718202 0.00
DPS Timeline Chart

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike_oh 3635 3.1% 47.6 9.47sec 34387 0 25045 51969 34387 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.64 47.64 0.00 0.00 0.0000 0.0000 1638284.07 1638284.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.11 65.30% 25044.78 23658 31529 25045.98 24252 25839 779186 779186 0.00
crit 16.53 34.70% 51968.62 48735 64949 51982.13 49671 55124 859099 859099 0.00
DPS Timeline Chart

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
unleash_elements 0 (3407) 0.0% (2.9%) 29.1 15.73sec 52782 40538 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.07 29.07 0.00 0.00 1.3020 0.0000 0.00 0.00 0.00 40538.25 40538.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unleash_elements

Static Values
  • id:73680
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4919.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73680
  • name:Unleash Elements
  • school:nature
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 1758 1.5% 29.1 15.73sec 27238 0 23383 48619 27238 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.07 29.07 0.00 0.00 0.0000 0.0000 791863.65 791863.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.63 84.72% 23382.65 20580 32550 23389.55 21647 24760 575922 575922 0.00
crit 4.44 15.28% 48619.14 42395 67053 48211.26 0 66275 215942 215942 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_flame_eoe 526 0.5% 8.7 47.76sec 27220 0 23370 48449 27220 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.70 8.70 0.00 0.00 0.0000 0.0000 236904.63 236904.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.37 84.65% 23370.11 20580 32550 23375.27 0 29891 172172 172172 0.00
crit 1.34 15.35% 48448.75 42395 67053 35918.11 0 67053 64732 64732 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_wind 1123 1.0% 29.1 15.73sec 17394 0 12603 26206 17398 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.07 29.07 0.00 0.00 0.0000 0.0000 505685.47 505685.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.82 64.75% 12603.09 11787 15408 12604.29 12034 13185 237203 237203 0.00
crit 10.25 35.25% 26205.71 24281 31740 26217.14 24281 28821 268483 268483 0.00
DPS Timeline Chart

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73681
  • name:Unleash Wind
  • school:physical
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
windfury_mh 5682 4.9% 121.5 10.94sec 21065 0 15221 31668 21065 35.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.47 121.47 0.00 0.00 0.0000 0.0000 2558728.48 2558728.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 78.31 64.47% 15220.68 14330 18878 15222.55 14757 15792 1191898 1191898 0.00
crit 43.16 35.53% 31668.41 29520 38888 31673.93 30217 33176 1366831 1366831 0.00
DPS Timeline Chart

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33757
  • name:Windfury Weapon (Passive)
  • school:nature
  • tooltip:(null)
  • description:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_main_hand 3153 2.7% 28.0 13.40sec 50267 36615 34561 72335 50267 41.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.03 28.03 0.00 0.00 1.3729 0.0000 1408872.31 1408872.31 0.00 36615.01 36615.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.37 58.42% 34560.74 30669 41319 34587.02 31489 37722 565894 565894 0.00
crit 11.65 41.58% 72335.05 63179 85118 72369.45 64193 80490 842978 842978 0.00
DPS Timeline Chart

Action details: windlash_main_hand

Static Values
  • id:114089
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Wind Lash
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_off_hand 1603 1.4% 28.5 13.18sec 25140 18269 17292 36193 25140 41.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.49 28.49 0.00 0.00 1.3761 0.0000 716159.15 716159.15 0.00 18269.37 18269.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.66 58.48% 17292.04 15335 20660 17306.15 15871 18902 288080 288080 0.00
crit 11.83 41.52% 36193.23 31590 42559 36213.17 31590 40643 428079 428079 0.00
DPS Timeline Chart

Action details: windlash_off_hand

Static Values
  • id:114093
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Wind Lash Off-Hand
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 13585 / 3557
melee 6975 1.6% 257.2 3.17sec 3198 3538 2400 4907 3198 37.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 257.22 257.22 0.00 0.00 0.9039 0.0000 822474.07 822474.07 0.00 3537.58 3537.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.46 38.67% 2400.16 2190 3326 2401.19 2239 2588 238726 238726 0.00
crit 96.07 37.35% 4907.43 4380 6651 4908.62 4524 5287 471470 471470 0.00
glance 61.68 23.98% 1820.26 1643 2494 1820.76 1677 1977 112278 112278 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 6610 1.5% 39.5 10.92sec 19769 12818 14232 29061 19769 37.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.46 39.46 0.00 0.00 1.5422 0.0000 780053.89 780053.89 0.00 12818.45 12818.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.73 62.66% 14232.10 12732 19692 14236.28 13096 15460 351894 351894 0.00
crit 14.73 37.34% 29061.05 25465 39384 29086.02 25730 33331 428159 428159 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40
pet - greater_fire_elemental 32234 / 8695
fire_blast 1877 0.4% 20.0 18.76sec 11254 0 8165 16879 11254 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.96 19.96 0.00 0.00 0.0000 0.0000 224673.34 224673.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.89 64.56% 8165.36 7084 12244 8161.80 7159 9133 105239 105239 0.00
crit 7.08 35.44% 16878.53 14168 24488 16897.32 14168 22105 119434 119434 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 30357 6.9% 133.1 2.72sec 27305 32684 20563 42693 27305 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.08 133.08 0.00 0.00 0.8354 0.0000 3633880.52 3633880.52 0.00 32683.78 32683.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.61 40.29% 20563.33 18227 30254 20563.84 18972 22121 1102491 1102491 0.00
crit 47.55 35.73% 42693.36 36454 60509 42696.30 39299 46482 2030035 2030035 0.00
glance 31.92 23.99% 15706.12 13670 22691 15706.87 14297 17286 501355 501355 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 5295 / 1418
earth_melee 5295 1.2% 95.7 3.78sec 6588 5502 5026 10283 6588 35.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.67 95.67 0.00 0.00 1.1973 0.0000 630243.04 630243.04 0.00 5502.00 5502.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.99 40.76% 5026.40 4538 6746 5025.99 4669 5486 195990 195990 0.00
crit 33.73 35.26% 10283.35 9075 13492 10283.26 9427 11127 346863 346863 0.00
glance 22.95 23.99% 3808.29 3403 5060 3808.25 3483 4217 87390 87390 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3989 / 2881
searing_bolt 3989 2.5% 201.4 2.22sec 6480 0 5551 11551 6483 15.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 201.40 201.31 0.00 0.00 0.0000 0.0000 1305102.52 1305102.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 170.03 84.46% 5550.59 4883 8353 5553.27 5363 5774 943790 943790 0.00
crit 31.28 15.54% 11551.17 10060 17207 11561.45 10513 12678 361313 361313 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.9 0.0 182.6sec 182.6sec 9.64% 9.64%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:9.6%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.3 0.0 120.7sec 120.7sec 14.10% 14.10%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.87%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.9 7.8 37.2sec 22.0sec 41.14% 40.12%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:41.1%
dancing_steel_oh 9.3 3.6 46.1sec 32.3sec 29.40% 28.62%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:29.4%
flurry 20.9 216.7 21.7sec 1.9sec 92.50% 90.12%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_flurry
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:5.2%
  • flurry_2:9.3%
  • flurry_3:17.0%
  • flurry_4:32.0%
  • flurry_5:29.1%

Spelldata details

  • id:16278
  • name:Flurry
  • tooltip:Attack speed increased by $s1%. Haste from items increased by $s2%.
  • description:$@spelldesc16282
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
maelstrom_weapon 78.2 172.6 5.8sec 1.8sec 74.00% 65.68%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • maelstrom_weapon_1:23.8%
  • maelstrom_weapon_2:21.1%
  • maelstrom_weapon_3:13.8%
  • maelstrom_weapon_4:8.4%
  • maelstrom_weapon_5:6.9%

Spelldata details

  • id:53817
  • name:Maelstrom Weapon
  • tooltip:Reduces the cast time and mana cost of your next Nature spell with a base cast time shorter than 10 seconds by $53817s1%.$?$w3!=0[ Next spell's healing effectiveness increased by $w3%.][]
  • description:$@spelldesc51530
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_xuen 7.5 0.0 63.3sec 63.3sec 24.63% 24.63%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.6%
searing_flames 41.6 292.8 10.9sec 1.3sec 93.10% 94.77%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_searing_flames
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • searing_flames_1:13.2%
  • searing_flames_2:13.2%
  • searing_flames_3:13.2%
  • searing_flames_4:13.0%
  • searing_flames_5:40.5%

Spelldata details

  • id:77657
  • name:Searing Flames
  • tooltip:(null)
  • description:When your Searing Totem deals damage or your Fire Elemental lands a melee attack, the damage dealt by your Flametongue Weapon is increased by $77661s1% for $77661d. Stacks up to 5 times. Your Lava Lash ability will consume this effect, dealing $s1% increased damage for each application present.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 7.9 0.0 60.7sec 60.7sec 17.41% 17.41%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
terror_in_the_mists 7.5 0.0 64.0sec 64.0sec 32.51% 32.51%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.5%
unleash_flame 29.1 0.0 15.7sec 15.7sec 37.95% 99.91%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_flame_1:38.0%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:1.01%
unleash_wind 29.1 0.0 15.7sec 15.7sec 23.31% 31.55%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_wind
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_wind_1:4.2%
  • unleash_wind_2:4.4%
  • unleash_wind_3:4.1%
  • unleash_wind_4:4.7%
  • unleash_wind_5:4.0%
  • unleash_wind_6:1.9%

Spelldata details

  • id:73681
  • name:Unleash Wind
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.01%
unleashed_fury_wf 29.1 0.0 15.7sec 15.7sec 51.17% 57.17%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_wf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_wf_1:51.2%

Spelldata details

  • id:118472
  • name:Unleashed Fury
  • tooltip:Your melee autoattacks can trigger Static Shock.
  • description:Your melee autoattacks can trigger Static Shock.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 60.6sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:10.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
lightning_shield

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:100.0%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Enhancement_T14H
ascendance Mana 2.9 2277.4 780.0 780.0 0.0
bloodlust Mana 0.9 3052.1 3225.0 3225.0 0.0
earth_elemental_totem Mana 2.0 8430.0 4215.0 4215.0 0.0
earth_shock Mana 43.8 94560.7 2160.0 2160.0 30.9
feral_spirit Mana 4.1 7385.8 1800.0 1800.0 0.0
fire_elemental_totem Mana 2.0 8069.5 4034.8 4034.8 0.0
flame_shock Mana 14.0 25000.5 1785.0 1785.0 132.1
lava_lash Mana 40.7 97609.0 2400.0 2400.0 62.7
searing_totem Mana 6.9 6088.7 885.0 885.0 0.0
stormblast Mana 5.8 32505.7 5621.0 5621.0 50.2
stormstrike Mana 47.6 268705.4 5640.0 5640.0 18.3
unleash_elements Mana 29.1 35751.0 1229.8 1229.8 42.9
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1801.91 99061.33 54.98 36081.66 26.70%
primal_wisdom Mana 284.30 487539.81 1714.86 365366.79 42.84%
Resource RPS-Gain RPS-Loss
Mana 1301.82 1308.11
Combat End Resource Mean Min Max
Health 459513.00 459513.00 459513.00
Mana 57139.21 45278.25 60000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
windfury_mh_maelstrom 52.5 13.3sec
windfury_mh_maelstrom_wasted 3.5 119.0sec
melee_main_hand_maelstrom 77.4 5.8sec
melee_main_hand_maelstrom_wasted 4.9 71.0sec
windlash_main_hand_maelstrom 12.1 31.9sec
windlash_main_hand_maelstrom_wasted 2.5 116.5sec
melee_off_hand_maelstrom 77.0 5.8sec
melee_off_hand_maelstrom_wasted 4.7 74.0sec
windlash_off_hand_maelstrom 12.3 31.4sec
windlash_off_hand_maelstrom_wasted 2.4 120.0sec
lava_lash_maelstrom 17.6 24.6sec
lava_lash_maelstrom_wasted 0.6 151.1sec
unleash_wind_maelstrom 12.6 34.6sec
unleash_wind_maelstrom_wasted 1.1 140.2sec
stormblast_mh_maelstrom 2.5 133.8sec
stormblast_mh_maelstrom_wasted 0.2 161.4sec
stormblast_oh_maelstrom 2.5 132.8sec
stormblast_oh_maelstrom_wasted 0.2 167.2sec
stormstrike_mh_maelstrom 20.7 20.9sec
stormstrike_mh_maelstrom_wasted 0.3 150.6sec
stormstrike_oh_maelstrom 20.6 21.0sec
stormstrike_oh_maelstrom_wasted 0.3 150.8sec
hat_donor 131.2 4.1sec
maelstrom_weapon 307.9 1.6sec
static_shock 172.7 2.8sec
swings_clipped_mh 28.6 14.7sec
swings_clipped_oh 28.5 14.7sec
uf_flame_shock 18.2 25.1sec
uf_wasted 14.7 30.0sec
wasted_maelstrom_weapon 20.6 22.4sec
windfury 40.5 11.0sec
maelstrom_weapon_stack_2 18.2 22.8sec
maelstrom_weapon_stack_3 17.7 23.3sec
maelstrom_weapon_stack_4 13.9 29.3sec
maelstrom_weapon_stack_5 27.6 16.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 117040.80
Minimum 107222.16
Maximum 128372.50
Spread ( max - min ) 21150.34
Range [ ( max - min ) / 2 * 100% ] 9.04%
Standard Deviation 3100.4337
5th Percentile 112113.31
95th Percentile 122331.73
( 95th Percentile - 5th Percentile ) 10218.42
Mean Distribution
Standard Deviation 31.0043
95.00% Confidence Intervall ( 116980.03 - 117101.57 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2695
0.1 Scale Factor Error with Delta=300 82059
0.05 Scale Factor Error with Delta=300 328237
0.01 Scale Factor Error with Delta=300 8205944
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 117040.80

Damage

Sample Data
Count 10000
Mean 45233611.68

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 291.59
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 windfury_weapon,weapon=main
3 0.00 flametongue_weapon,weapon=off
4 0.00 lightning_shield,if=!buff.lightning_shield.up
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 0.00 wind_shear
8 0.95 bloodlust,if=target.health.pct<25|time>5
9 1.00 auto_attack
A 7.93 use_item,name=firebirds_grips
B 1.00 virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
C 0.00 run_action_list,name=single,if=num_targets=1
D 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
U 4.31 blood_fury
V 0.00 elemental_mastery,if=talent.elemental_mastery.enabled
W 2.00 fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
X 2.92 ascendance,if=cooldown.strike.remains>=3
Y 6.88 searing_totem,if=!totem.fire.active
Z 29.07 unleash_elements,if=talent.unleashed_fury.enabled
a 0.00 elemental_blast,if=talent.elemental_blast.enabled
b 20.23 lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
c 5.78 stormblast
d 10.36 flame_shock,if=buff.unleash_flame.up&!ticking
e 47.64 stormstrike
f 40.67 lava_lash
g 0.00 unleash_elements
h 21.52 lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
i 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
j 0.00 lightning_bolt,if=buff.ancestral_swiftness.up
k 3.65 flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
l 43.78 earth_shock
m 4.10 feral_spirit
n 2.00 earth_elemental_totem,if=!active
o 0.00 spiritwalkers_grace,moving=1
p 35.81 lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

Sample Sequence

9AUYZde8WXcbflmncbZlfbehlfeZdbefblpZelfhhlepABfZdYbehlfpelZhflehlpfZebdhfelpZplefblUpAelYZfhedhmfebZlhefbleZlfhelpflZebdfAhelXYcZbflbclbfeZhlfeblZebdfelpZfeUhlApYefbZkmehflpepZlfheplpfeZhkpeflpZelAfWblepnfZkeblfpelpZhfehlpefZdpehlfpeUlZAhYfleXcblmfZbcdbhflebZplfebleZfhkeplfpZAeYlpfelppZpefdb

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 21403 19019 18031
Stamina 22365 20332 20170
Intellect 251 239 80
Spirit 251 251 80
Health 459513 431051 0
Mana 60000 60000 0
Spell Power 26113 21111 0
Spell Hit 15.06% 15.06% 2568
Spell Crit 14.19% 9.19% 4137
Spell Haste 13.02% 7.64% 3245
Mana Per 5 1500 1500 0
Attack Power 47478 38383 0
Melee Hit 7.55% 7.55% 2568
Melee Crit 31.81% 24.92% 4137
Melee Haste 7.64% 7.64% 3245
Swing Speed 18.40% 7.64% 3245
Expertise 7.51% / 7.51% 7.51% / 7.51% 2214
Armor 25465 25465 25465
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.22% 37.22% 6364

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Enhancement_T14H"
origin="unknown"
level=90
race=orc
spec=enhancement
role=attack
position=back
professions=engineering=600/jewelcrafting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/windfury_weapon,weapon=main
actions.precombat+=/flametongue_weapon,weapon=off
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/auto_attack
actions+=/use_item,name=firebirds_grips
actions+=/virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=blood_fury
actions.ae+=/ascendance,if=cooldown.strike.remains>=3
actions.ae+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.ae+=/magma_totem,if=num_targets>5&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=5&!totem.fire.active
actions.ae+=/fire_nova,if=(num_targets<=5&active_flame_shock=num_targets)|active_flame_shock>=5
actions.ae+=/lava_lash,if=dot.flame_shock.ticking
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>=3
actions.ae+=/unleash_elements
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking
actions.ae+=/stormblast
actions.ae+=/stormstrike
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
actions.ae+=/feral_spirit
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>1
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react>1

actions.single=blood_fury
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled
actions.single+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.single+=/ascendance,if=cooldown.strike.remains>=3
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
actions.single+=/stormblast
actions.single+=/flame_shock,if=buff.unleash_flame.up&!ticking
actions.single+=/stormstrike
actions.single+=/lava_lash
actions.single+=/unleash_elements
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
actions.single+=/lightning_bolt,if=buff.ancestral_swiftness.up
actions.single+=/flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
actions.single+=/earth_shock
actions.single+=/feral_spirit
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

head=firebirds_helmet,id=87136,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=waterborne_shoulderguards,id=90505,gems=320agi_60agi,enchant=200agi_100crit,reforge=exp_mastery
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=firebirds_cuirass,id=87134,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all,reforge=crit_hit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi
hands=firebirds_grips,id=87135,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=rangers_chain_of_unending_summer,id=87182,gems=80agi_160hit_160agi_60haste,reforge=haste_mastery
legs=firebirds_legguards,id=87137,gems=320agi_60agi,enchant=285agi_165crit,reforge=haste_mastery
feet=monstrous_stompers,id=86985,gems=80agi_160mastery_120haste,enchant=140agi,reforge=crit_mastery
finger1=painful_thorned_ring,id=86974,reforge=exp_haste
finger2=regails_band_of_the_endless,id=90503,reforge=crit_mastery
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=exp_mastery
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=18031
# gear_stamina=20170
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2214
# gear_hit_rating=2568
# gear_crit_rating=4137
# gear_haste_rating=3245
# gear_mastery_rating=6364
# gear_armor=25465
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=firebirds_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Warlock_Affliction_T14H : 126191 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
126191.4 126191.4 50.80 / 0.04% 4263 / 3.4% 18.4 6735.5 6161.3 Mana 0.00% 29.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
Glyphs
  • soul_shards

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:918344|505648|327222|252220|122621|109070|85277|27321&chds=0,1836688&chco=C79C6E,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++918344++summon_doomguard,C79C6E,0,0,15|t++505648++agony,9482C9,1,0,15|t++327222++corruption,9482C9,2,0,15|t++252220++unstable_affliction,9482C9,3,0,15|t++122621++haunt,9482C9,4,0,15|t++109070++drain_soul,9482C9,5,0,15|t++85277++malefic_grasp,9482C9,6,0,15|t++27321++soul_swap,9482C9,7,0,15&chtt=Warlock_Affliction_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,13,12,11,10,10,10,9,5,3,2,2,2,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=agony|unstable_affliction|corruption|haunt|agony_mg|malefic_grasp|unstable_affliction_mg|corruption_mg|drain_soul|agony_ds|unstable_affliction_ds|corruption_ds|doomguard: doom_bolt|soul_swap|felhunter: shadow_bite&chtt=Warlock_Affliction_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:gkoqtvxyxwy135643346786420ywwwwtrrrppqpnlkjihhhgfeeeeecbbaaabbbbbbbbcccbaaabbcccccccddcccbbbbccccbbbbaaZZYYZZZZZYYYYYXXXXYYYZZZZZZZZZZZZZZZZZZZZYYYYXXXXWWXXXYYYZZZZZaaaaabbcccccbbbaaaaaaaaaaZZZZZZZZZZZZZYYYYYYYYYXXXXXXXXXXXXXXWWWWWWVVWWWWWWWXXXXYYZZabccddeeefffffffffeeeeddccbbaaaZZYYYXXXWWWWVVVVVVVVVVVVVWWWXXXYYYZZabbccdeeffggghhhhhhhhhhggffeeeddcccbbbaaaaaaaaaaabbbcccdddeeeeffffffffffffeeedddddccdddddeeeeffgghhhiiijjjjjjjjjjjjjjjiiiiiiiiiiiihhhhggggffffffeeeeeeeeeeddddeeeeeeeefffgghhiijjkkklllllllllllkkkjjjiihhhhhggggffffeeeedddddccbbaZZZYYYYXXXWWV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=126191|max=255486&chxp=1,1,49,100&chtt=Warlock_Affliction_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,4,5,13,13,28,53,76,94,149,182,233,323,392,446,471,532,594,562,565,532,519,523,538,453,399,366,341,294,240,219,171,130,132,109,66,70,40,28,27,15,12,15,5,4,6,2,3,2&chds=0,594&chbh=5&chxt=x&chxl=0:|min=118009|avg=126191|max=136628&chxp=0,1,44,100&chtt=Warlock_Affliction_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:56.8,13.4,10.7,6.1,4.4,3.4,2.8,2.1,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=malefic_grasp 255.8s|drain_soul 60.2s|haunt 48.1s|unstable_affliction 27.7s|corruption 19.9s|agony 15.4s|life_tap 12.5s|soul_swap 9.5s|summon_doomguard 1.0s&chtt=Warlock_Affliction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Affliction_T14H 126191
agony 17253 13.7% 13.4 28.58sec 579015 505648 0 0 0 0.0% 0.0% 0.0% 0.0% 348.4 18690 38862 22277 17.8% 0.0% 99.6%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.40 22.57 348.42 348.42 1.1451 1.2883 7761695.29 7761695.29 0.00 16719.97 505647.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.5 82.22% 18690.21 11506 26025 18700.01 17631 19882 5354324 5354324 0.00
crit 61.9 17.78% 38862.48 23703 53612 38878.94 35490 42634 2407371 2407371 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_ds 3101 2.5% 39.5 2.08sec 35423 0 29684 61582 35423 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.47 39.47 0.00 0.00 0.0000 0.0000 1398323.57 1398323.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.37 82.01% 29683.64 21457 39038 29727.81 26722 33467 960928 960928 0.00
crit 7.10 17.99% 61582.49 44201 80418 61612.69 0 80418 437396 437396 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_mg 12973 10.3% 353.9 1.03sec 16496 0 13845 28800 16496 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 353.91 353.91 0.00 0.00 0.0000 0.0000 5837966.87 5837966.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.18 82.28% 13845.05 9780 19519 13851.73 12962 14907 4031444 4031444 0.00
crit 62.73 17.72% 28800.36 20147 40209 28809.45 25707 31926 1806523 1806523 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
blood_fury 0 0.0% 4.3 121.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.28 4.28 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
corruption 14503 11.5% 17.6 22.11sec 370658 327222 0 0 0 0.0% 0.0% 0.0% 0.0% 348.3 15731 32703 18732 17.7% 0.0% 99.6%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.60 26.77 348.33 348.33 1.1327 1.2886 6524803.72 6524803.72 0.00 13917.83 327221.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.8 82.32% 15731.42 12101 22018 15739.69 15073 16570 4511028 4511028 0.00
crit 61.6 17.68% 32702.95 24929 45358 32720.99 29536 35779 2013776 2013776 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_ds 2627 2.1% 39.5 2.08sec 29996 0 25120 52157 29996 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.47 39.47 0.00 0.00 0.0000 0.0000 1184082.03 1184082.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.35 81.96% 25119.81 18152 33028 25159.38 22949 28287 812751 812751 0.00
crit 7.12 18.04% 52156.84 37394 68037 52198.22 0 65257 371331 371331 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_mg 10949 8.7% 353.9 1.03sec 13921 0 11695 24315 13921 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 353.91 353.91 0.00 0.00 0.0000 0.0000 4926598.08 4926598.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.50 82.37% 11695.36 9076 16514 11702.09 11103 12367 3409243 3409243 0.00
crit 62.40 17.63% 24314.76 18697 34018 24327.83 22203 26504 1517355 1517355 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.0 81.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.03 6.03 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
drain_soul 5972 (14557) 4.7% (11.6%) 17.6 4.80sec 373263 109070 0 0 0 0.0% 0.0% 0.0% 0.0% 39.5 57194 118613 68242 18.0% 0.0% 12.4%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.59 17.59 39.47 39.47 3.4222 1.4195 2693864.45 2693864.45 0.00 109070.39 109070.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.4 82.01% 57194.41 41348 75232 57248.80 53387 61744 1851618 1851618 0.00
crit 7.1 17.99% 118612.94 85177 154978 118572.28 0 148645 842247 842247 0.00
DPS Timeline Chart

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=20
Spelldata
  • id:1120
  • name:Drain Soul
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the warlock's other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage, every $t1 seconds.
  • description:Drains the soul of the target, causing ${$m1+$SP*0.375} Shadow damage every $t1 sec and energizing one Soul Shard after it deals damage twice. If the target dies, three Soul Shards are energized. Lasts $d. If the target is at or below $s3% health when Drain Soul deals damage, it deals $s6% additional damage and causes all of your other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.390000
  • base_td:416.60
  • num_ticks:6
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
haunt 13107 10.4% 42.4 10.71sec 139091 122621 117597 244405 139926 17.6% 0.0% 0.0% 0.0% 165.6 0 0 0 0.0% 0.0% 73.5%

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.40 42.15 165.59 165.59 1.1343 2.0000 5897572.99 5897572.99 0.00 15549.72 122620.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.73 82.39% 117597.26 92764 168786 117581.54 107798 126596 4083694 4083694 0.00
crit 7.42 17.61% 244405.36 191095 347699 244321.14 0 331169 1813879 1813879 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 165.6 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight_to_target&remains
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.750000
  • base_dd_min:1869.36
  • base_dd_max:1869.36
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
life_tap 0 0.0% 11.1 38.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.06 11.06 0.00 0.00 1.1308 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 11.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<35
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
malefic_grasp 12612 (48486) 10.0% (38.4%) 102.8 3.54sec 212147 85277 0 0 0 0.0% 0.0% 0.0% 0.0% 353.9 13492 28006 16037 17.5% 0.0% 53.6%

Stats details: malefic_grasp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.84 102.84 353.91 353.91 2.4877 0.6824 5675661.77 5675661.77 0.00 85276.80 85276.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.9 82.47% 13492.13 10602 19291 13498.74 12901 14119 3937714 3937714 0.00
crit 62.1 17.53% 28006.11 21841 39739 28020.13 25963 30295 1737947 1737947 0.00
DPS Timeline Chart

Action details: malefic_grasp

Static Values
  • id:103103
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103103
  • name:Malefic Grasp
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the Warlock's other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage, every $t1 seconds.
  • description:Binds the target in twilight, causing $103103o1 Shadow damage over $103103d. Every $t1 sec, when Malefic Grasp deals damage, it causes all of your other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
soul_swap 577 0.5% 9.2 54.15sec 28317 27321 23746 49151 28317 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_swap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.17 9.17 0.00 0.00 1.0365 0.0000 259544.79 259544.79 0.00 27320.50 27320.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.52 82.01% 23746.43 17669 32150 23782.83 20614 29055 178490 178490 0.00
crit 1.65 17.99% 49150.90 36399 66228 40822.75 0 66228 81055 81055 0.00
DPS Timeline Chart

Action details: soul_swap

Static Values
  • id:86121
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:18000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.soulburn.up
Spelldata
  • id:86121
  • name:Soul Swap
  • school:shadow
  • tooltip:(null)
  • description:You instantly deal $86121s1 damage$?s56226[ and copy your Shadow damage-over-time effects from the target][, and remove your Shadow damage-over-time effects from the target]. For $86211d afterwards, the next target you cast Soul Swap: Exhale on will be afflicted by the Shadow damage-over-time effects and suffer $86121s1 damage. You cannot Soul Swap to the same target.$?s74434&!s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Corruption, Unstable Affliction and Agony.|r][]$?s74434&s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Doom, Unstable Affliction and Agony.|r][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:534.10
  • base_dd_max:534.10
soulburn 0 0.0% 9.5 52.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.52 9.52 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
Spelldata
  • id:74434
  • name:Soulburn
  • school:shadow
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
summon_doomguard 0 (2146) 0.0% (1.7%) 1.0 1.#Rsec 951404 918344 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 918343.98 918343.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
unstable_affliction 15503 12.3% 24.4 17.84sec 286444 252220 0 0 0 0.0% 0.0% 0.0% 0.0% 341.5 17162 35644 20430 17.7% 0.0% 99.6%

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.36 33.52 341.48 341.48 1.1357 1.3144 6976408.78 6976408.78 0.00 14640.94 252220.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 281.1 82.32% 17161.94 13200 24018 17171.32 16421 18200 4824070 4824070 0.00
crit 60.4 17.68% 35643.54 27193 49478 35662.33 32860 38997 2152339 2152339 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_ds 2858 2.3% 39.5 2.08sec 32646 0 27362 56812 32646 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.47 39.47 0.00 0.00 0.0000 0.0000 1288676.96 1288676.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.39 82.06% 27361.80 19800 36028 27402.67 25079 30354 886298 886298 0.00
crit 7.08 17.94% 56812.33 40789 74217 56838.66 0 74217 402379 402379 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_mg 11951 9.5% 353.9 1.03sec 15194 0 12765 26529 15194 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 353.91 353.91 0.00 0.00 0.0000 0.0000 5377161.38 5377161.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.47 82.36% 12765.32 9900 18014 12773.04 12113 13514 3720678 3720678 0.00
crit 62.44 17.64% 26528.81 20394 37108 26542.85 23798 28762 1656483 1656483 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
pet - felhunter 0 / 59
shadow_bite 0 0.0% 1.0 1.#Rsec 26285 25372 22118 44236 26285 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% -1.$%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0360 0.0000 26285.16 26285.16 0.00 25371.78 25371.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.81 81.16% 22118.11 22118 22118 17951.06 0 22118 17951 17951 0.00
crit 0.19 18.84% 44236.22 44236 44236 8334.10 0 44236 8334 8334 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:(null)
  • description:Bite the enemy, causing $s1 Shadow damage.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - doomguard 15857 / 2146
doom_bolt 15857 1.7% 21.7 2.73sec 43824 16108 36888 75079 43824 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.71 21.71 0.00 0.00 2.7207 0.0000 951404.36 951404.36 0.00 16107.75 16107.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.77 81.84% 36888.28 32420 47201 36881.03 32875 39411 655398 655398 0.00
crit 3.94 18.16% 75079.02 64840 94401 74201.50 0 94401 296007 296007 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 121.3sec 121.2sec 14.02% 14.02%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.0%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 13.11%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.0 0.0 81.2sec 81.2sec 26.31% 28.99%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.3%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 7.7 0.0 61.7sec 61.7sec 33.66% 33.66%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.7%
jade_serpent_potion 2.0 0.0 367.1sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 9.1 0.0 52.2sec 52.2sec 23.84% 23.68%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.8%
relic_of_yulon 9.2 0.0 51.3sec 51.3sec 30.28% 30.28%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.3%
soulburn 9.2 0.3 53.6sec 51.9sec 0.56% 90.16%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_soulburn
  • max_stacks:1
  • duration:30.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • soulburn_1:0.6%

Spelldata details

  • id:74434
  • name:Soulburn
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
  • max_stacks:
  • duration:30.00
  • cooldown:1.00
  • default_chance:0.00%
synapse_springs_2 7.9 0.0 61.2sec 61.2sec 17.27% 17.27%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
grimoire_of_sacrifice

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:1022.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.0%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[$@spelldesc132612][]$?$w4>0[$@spelldesc132613][]$?$w5>0[$@spelldesc132614][] $?s108415[ Maximum health increased by $108503s7%.][] Restores $108503s2% of maximum health every $108503t2 sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[$s5% to $s3][]$?c1[$s3][]$?c2[$s4][]$?c3[$s5][]%$?s108415[, increase your maximum health by $s7%,][] and regenerate $s2% of maximum health every $t2 sec. Lasts for $d. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:1200.00
  • cooldown:120.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Affliction_T14H
agony Mana 13.4 40215.0 3000.0 3000.0 193.0
corruption Mana 17.6 66012.4 3750.0 3750.0 98.8
dark_soul Mana 6.0 90463.5 15000.0 15000.0 0.0
drain_soul Mana 57.1 434420.1 7613.0 24699.8 15.1
haunt Soul Shard 42.4 42.4 1.0 1.0 139091.1
malefic_grasp Mana 456.7 2055373.2 4500.0 19986.0 10.6
soul_swap Mana 9.2 164980.8 18000.0 18000.0 1.6
soulburn Soul Shard 9.5 9.5 1.0 1.0 0.0
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 12.7
unstable_affliction Mana 24.4 109598.4 4500.0 4500.0 63.7
pet - felhunter
shadow_bite Energy 1.0 60.0 60.0 60.0 438.1
pet - doomguard
doom_bolt Energy 21.7 759.8 35.0 35.0 1252.1
Resource Gains Type Count Total Average Overflow
drain_soul Soul Shard 14.36 13.14 0.92 1.22 8.50%
life_tap Mana 11.06 812835.94 73511.25 0.00 0.00%
mp5_regen Mana 1801.91 1963455.64 1089.65 0.00 0.00%
nightfall Soul Shard 37.76 37.17 0.98 0.59 1.57%
pet - doomguard
energy_regen Energy 239.00 741.74 3.10 155.45 17.33%
Resource RPS-Gain RPS-Loss
Health 0.00 1803.89
Mana 6161.30 6735.47
Soul Shard 0.11 0.12
Combat End Resource Mean Min Max
Health -322900.62 -612593.75 -98015.00
Mana 41934.65 0.00 87419.57
Soul Shard 2.37 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 461.9 1.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 126191.39
Minimum 118009.24
Maximum 136628.19
Spread ( max - min ) 18618.95
Range [ ( max - min ) / 2 * 100% ] 7.38%
Standard Deviation 2591.7124
5th Percentile 122229.48
95th Percentile 130755.26
( 95th Percentile - 5th Percentile ) 8525.78
Mean Distribution
Standard Deviation 25.9171
95.00% Confidence Intervall ( 126140.60 - 126242.19 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1620
0.1 Scale Factor Error with Delta=300 57339
0.05 Scale Factor Error with Delta=300 229359
0.01 Scale Factor Error with Delta=300 5733994
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 126191.39

Damage

Sample Data
Count 10000
Mean 55802360.69

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 223.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.85 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.28 blood_fury
A 6.03 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 1.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>3
F 1.00 summon_doomguard
G 6.01 soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
H 9.17 soul_swap,if=buff.soulburn.up
I 42.54 haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
J 0.00 soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
K 0.00 haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
L 3.51 soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
M 0.47 agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
N 0.21 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
O 1.36 unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
P 12.94 agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
Q 17.40 corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
R 22.99 unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
S 17.34 drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
T 11.06 life_tap,if=mana.pct<35
U 57.45 malefic_grasp,chain=1
V 0.00 life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
W 0.00 fel_flame,moving=1
X 0.00 life_tap

Sample Sequence

79ACFGHIURPIQUIGHUIUIURUIQUTUIMOU7IQRUIPUAGHTUIRUQGHITUIURU9U7QUPURUTIUQURUIPUAGHTUIURIUQUGHU7TUIUIRUQUIPRUIUQIRUTUPUI9UAQRU7UIUPRUQUITUOUIUQPIRUIQRUU7IPTUIQRUAUPRUIQUTUIGHUIU8I9OSIQ7SPSRSISILHSISILHSAGSISSTHSISIGHS7SISSTIRSILHS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Soul Shard 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.67% 13.72% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 55.65% 40.14% 2972

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Affliction_T14H"
origin="unknown"
level=90
race=orc
spec=affliction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
talent_override=grimoire_of_service,if=num_targets>3
glyphs=soul_shards

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>3
actions+=/summon_doomguard
actions+=/soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
actions+=/soul_swap,if=buff.soulburn.up
actions+=/haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
actions+=/soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
actions+=/haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
actions+=/soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
actions+=/agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
actions+=/drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
actions+=/life_tap,if=mana.pct<35
actions+=/malefic_grasp,chain=1
actions+=/life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/soulburn,cycle_targets=1,if=buff.soulburn.down&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target&shard_react
actions.aoe+=/seed_of_corruption,cycle_targets=1,if=(buff.soulburn.down&!in_flight_to_target&!ticking)|(buff.soulburn.up&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target)
actions.aoe+=/haunt,cycle_targets=1,if=!in_flight_to_target&debuff.haunt.remains<cast_time+travel_time&shard_react
actions.aoe+=/life_tap,if=mana.pct<70
actions.aoe+=/fel_flame,cycle_targets=1,if=!in_flight_to_target

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warlock_Demonology_T14H : 119264 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
119264.0 119264.0 48.72 / 0.04% 4077 / 3.4% 11.5 6535.4 6040.3 Mana 0.00% 54.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
Glyphs
  • shadow_bolt

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:913416|533080|491011|81945|65838|58337|34510|10626&chds=0,1826832&chco=C79C6E,9482C9,9482C9,435133,FF6F00,C41F3B,9482C9,9482C9&chm=t++913416++summon_doomguard,C79C6E,0,0,15|t++533080++service_felguard,9482C9,1,0,15|t++491011++doom,9482C9,2,0,15|t++81945++hand_of_guldan,435133,3,0,15|t++65838++touch_of_chaos,FF6F00,4,0,15|t++58337++soul_fire,C41F3B,5,0,15|t++34510++shadow_bolt,9482C9,6,0,15|t++10626++melee,9482C9,7,0,15&chtt=Warlock_Demonology_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:27,21,17,15,14,12,12,7,7,6,6,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,C41F3B,C79C6E,9482C9,9482C9,9482C9,C79C6E,C79C6E,435133,9482C9,C79C6E,9482C9,C79C6E,435133,C79C6E&chl=touch_of_chaos|soul_fire|wild_imp: firebolt|felguard: melee|doom|shadow_bolt|corruption|felguard: felstorm|felguard: legion_strike|shadowflame|melee|service_felguard: felstorm|doomguard: doom_bolt|service_felguard: melee|hand_of_guldan|service_felguard: legion_strike&chtt=Warlock_Demonology_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:pqrtvx333434455775331100zwtomljkkkjjgggghgggeeddfeeecccccddddbbbbddddcccccdddeddeefgijhiiiiiihhgffeddccbaYYYXWWWWXYZZbbbbbcccccbdddeeeedccabaaZZZZZYYXXXXXYYYYZaabcdeefghhihhhggggffeddcbbaZZYYXXWWXXXXXWWWWWWVVVVVVVVWWWVVVWWWXXXXXYYXXYYZZbdefghijjklmmnooqpponlkihgfeeeddcbbaZYZZaaaaaZYYYXWWVVVVVVVVUVUUUUVVVWWWWXXXXXYZabcddfghhijklmmnnnnmmkjjiihgfedcbaZZYYYZZabbcccdeeeffgggggggggfeedddccbbbbbabaaaaabbbcdeefghijjjkkllllkkkjiihhffeddccbbaaaaZaZZZZZZZYZZZZZaZaZaZZZZZZZZZZZZZZZZaabcdfghijlmnopqrstuuuttsqponmlkjihgfedcbaaaaaaaaaaaaaaaaaaaaaaaaZZZaZZZZZZZYYYY&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=119264|max=235590&chxp=1,1,51,100&chtt=Warlock_Demonology_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,1,5,9,22,23,33,65,75,159,164,257,317,362,426,487,521,560,559,598,637,590,558,491,472,427,389,336,298,254,178,176,141,116,84,73,36,32,24,16,8,5,5,2,5,0,1,1,1&chds=0,637&chbh=5&chxt=x&chxl=0:|min=111004|avg=119264|max=129880&chxp=0,1,44,100&chtt=Warlock_Demonology_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.3,27.1,26.9,8.0,3.7,2.1,1.2,0.3,0.3&chds=0,100&chdls=ffffff&chco=FF6F00,9482C9,C41F3B,435133,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=touch_of_chaos 136.4s|shadow_bolt 121.9s|soul_fire 121.3s|hand_of_guldan 36.2s|life_tap 16.7s|doom 9.5s|service_felguard 5.6s|corruption 1.3s|summon_doomguard 1.3s&chtt=Warlock_Demonology_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Demonology_T14H 119264
blood_fury 0 0.0% 4.3 120.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 14.7 27.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.65 14.65 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 8795 7.4% 1.0 275.41sec 3940089 3010048 0 0 0 0.0% 0.0% 0.0% 0.0% 288.3 11507 23947 13732 17.9% 0.0% 99.2%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 288.25 288.25 1.3090 1.5513 3958213.03 3958213.03 0.00 8825.68 3010047.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.00 99.95% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.05% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 236.7 82.12% 11506.89 9509 17236 11513.72 10831 12198 2723683 2723683 0.00
crit 51.6 17.88% 23946.54 19588 35506 23960.85 21441 26657 1234530 1234530 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 6.1 80.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.06 6.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 10418 8.7% 9.2 47.21sec 508911 491011 0 0 0 0.0% 0.1% 0.0% 0.0% 39.1 99804 208473 119658 18.3% 0.0% 97.6%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.20 9.20 39.13 39.13 1.0365 11.2375 4682282.80 4682282.80 0.00 10422.03 491011.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.19 99.93% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.0 81.73% 99804.30 58981 132149 99979.88 82013 111789 3191911 3191911 0.00
crit 7.1 18.27% 208472.73 121500 272228 208802.55 0 272228 1490372 1490372 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:1068.20
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 1889 (6604) 1.6% (5.5%) 29.6 15.30sec 100478 81945 12154 25351 14499 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.55 58.66 0.00 0.00 1.2262 0.0000 850445.47 850445.47 0.00 81945.11 81945.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.19 82.16% 12154.06 0 39171 12163.15 8913 15535 585729 585729 0.00
crit 10.44 17.80% 25351.16 0 80693 25340.01 0 62605 264717 264717 0.00
miss 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
life_tap 0 0.0% 13.6 31.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.59 13.59 0.00 0.00 1.2269 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 4283 3.6% 231.4 1.93sec 8330 10626 7029 14626 8378 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 231.43 230.11 0.00 0.00 0.7839 0.0000 1927857.79 1927857.79 0.00 10625.79 10625.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 188.91 82.10% 7029.09 4896 10969 7032.62 6594 7441 1327853 1327853 0.00
crit 41.02 17.83% 14625.71 10086 22597 14633.81 12139 17045 600005 600005 0.00
miss 0.18 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.083000
  • base_dd_min:84.23
  • base_dd_max:93.09
metamorphosis 0 0.0% 20.0 23.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.01 20.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 20.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felguard 0 (6670) 0.0% (5.6%) 4.3 120.91sec 697609 533080 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 1.3086 0.0000 0.00 0.00 0.00 533080.18 533080.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Felguard who attacks the target for $d. Felguard will stun their target when summoned.
shadow_bolt 9357 7.8% 185.5 5.54sec 22685 34510 19083 39641 22685 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.48 185.48 0.00 0.00 0.6573 0.0000 4207726.13 4207726.13 0.00 34509.92 34509.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.72 82.34% 19083.13 17616 31932 19090.87 18288 20330 2914451 2914451 0.00
crit 32.62 17.59% 39641.34 36289 65780 39662.44 36697 45932 1293275 1293275 0.00
miss 0.14 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1281.84
  • base_dd_max:1281.84
shadowflame 4715 3.9% 29.3 15.32sec 72287 0 0 0 0 17.9% 0.0% 0.0% 0.0% 218.9 8093 16933 9679 17.9% 0.0% 37.3%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.32 29.32 218.95 218.95 0.0000 0.7682 2119163.25 2119163.25 0.00 12599.44 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.07 82.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.24 17.88% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.7 82.06% 8092.87 5921 20444 8103.51 6852 9149 1453985 1453985 0.00
crit 39.3 17.94% 16932.76 12197 42116 16957.19 13527 23321 665178 665178 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 15705 13.2% 74.4 5.83sec 95163 58337 0 95980 95907 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.38 73.81 0.00 0.00 1.6313 0.0000 7078708.05 7078708.05 0.00 58336.83 58336.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 73.75 99.92% 95980.40 74724 225240 96056.19 84818 105676 7078708 7078708 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:672.97
  • base_dd_max:822.52
summon_doomguard 0 (2695) 0.0% (2.2%) 1.0 1.#Rsec 1195661 913416 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.3090 0.0000 0.00 0.00 0.00 913415.79 913415.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 19940 16.7% 131.6 3.38sec 68240 65838 57364 119053 68274 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.63 131.56 0.00 0.00 1.0365 0.0000 8982264.96 8982264.96 0.00 65837.90 65837.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.10 82.16% 57364.08 40066 89771 57398.12 53544 60740 6200908 6200908 0.00
crit 23.36 17.76% 119052.73 82537 184928 119152.00 91593 143406 2781357 2781357 0.00
miss 0.10 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.corruption.remains<20
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.666000
  • base_dd_min:675.85
  • base_dd_max:746.99
pet - doomguard 19928 / 2695
doom_bolt 19928 2.2% 20.8 2.83sec 57586 20239 48371 99472 57586 18.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.76 20.76 0.00 0.00 2.8453 0.0000 1195661.27 1195661.27 0.00 20239.03 20239.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.99 81.81% 48370.74 39650 71887 48359.61 40371 54447 821625 821625 0.00
crit 3.76 18.11% 99472.32 79299 143774 98160.80 0 143774 374036 374036 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 22152 / 22152
felstorm 5562 4.7% 10.3 45.77sec 242892 0 17865 36023 21086 17.8% 0.1% 0.0% 0.0% 71.6 27026 54585 31915 17.8% 0.1% 13.6%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 71.60 71.60 0.0000 0.8562 2502395.84 2502395.84 0.00 40817.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.46 82.09% 17864.86 15297 24823 17870.56 15774 21171 151090 151090 0.00
crit 1.84 17.82% 36023.17 30595 49645 31291.34 0 49645 66149 66149 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.8 82.10% 27026.34 22946 41194 27044.09 25225 28590 1588657 1588657 0.00
crit 12.8 17.82% 54585.00 45892 82387 54624.25 46421 66807 696499 696499 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 4986 4.2% 82.5 5.54sec 27184 26226 23017 46492 27184 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.55 82.55 0.00 0.00 1.0365 0.0000 2244000.06 2244000.06 0.00 26226.29 26226.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.77 82.10% 23017.17 19886 35701 23026.29 22064 23919 1559915 1559915 0.00
crit 14.71 17.82% 46492.13 39773 71402 46526.23 39773 56606 684085 684085 0.00
dodge 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 11604 9.7% 265.5 1.67sec 19677 13189 17561 35439 19677 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 265.54 265.54 0.00 0.00 1.4919 0.0000 5225051.90 5225051.90 0.00 13188.68 13188.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 154.41 58.15% 17561.28 15297 27462 17566.22 16978 18207 2711572 2711572 0.00
crit 47.19 17.77% 35439.16 30595 54925 35452.57 32017 39565 1672239 1672239 0.00
glance 63.74 24.01% 13196.99 11473 20597 13200.55 12306 14119 841241 841241 0.00
dodge 0.10 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.11 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - wild_imp 17530 / 12645
firebolt 17530 10.6% 355.0 1.25sec 16041 7298 15158 30548 17877 17.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 354.96 318.50 0.00 0.00 2.1981 0.0000 5693754.45 5693754.45 0.00 7297.67 7297.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 261.75 82.18% 15158.01 13216 23962 15161.56 14690 15728 3967597 3967597 0.00
crit 56.51 17.74% 30547.88 26432 47924 30557.87 28344 33361 1726157 1726157 0.00
miss 0.25 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47
pet - service_felguard 32669 / 6670
felstorm 13036 2.2% 4.3 120.92sec 278341 0 19971 40278 23664 18.3% 0.1% 0.0% 0.0% 29.9 30904 62212 36663 18.5% 0.1% 27.8%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 29.85 29.85 0.0000 0.8561 1196197.52 1196197.52 0.00 46801.42 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.51 81.68% 19971.33 15297 24801 19963.48 0 24350 70101 70101 0.00
crit 0.78 18.25% 40277.90 30595 49602 23149.95 0 49602 31598 31598 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.3 81.44% 30904.31 22946 41194 30910.67 26957 33772 751370 751370 0.00
crit 5.5 18.48% 62211.56 45892 82387 62018.86 0 79092 343128 343128 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 7471 1.3% 21.8 19.41sec 31425 30276 26435 53601 31425 18.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.83 21.83 0.00 0.00 1.0379 0.0000 686141.58 686141.58 0.00 30275.85 30275.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.79 81.48% 26434.63 19886 35701 26444.97 23157 30005 470296 470296 0.00
crit 4.03 18.44% 53600.95 39773 71402 52980.10 0 71402 215846 215846 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 12162 2.1% 48.9 8.44sec 22804 16039 20180 41001 22804 18.4% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.93 48.93 0.00 0.00 1.4217 0.0000 1115703.83 1115703.83 0.00 16039.21 16039.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.12 57.47% 20179.68 15297 27462 20188.19 18096 22958 567398 567398 0.00
crit 9.02 18.43% 41001.29 30595 54925 41034.85 0 51688 369664 369664 0.00
glance 11.76 24.03% 15195.58 11473 20597 15201.03 12151 19430 178642 178642 0.00
dodge 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.3 0.0 121.0sec 120.9sec 14.07% 14.07%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.03%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.8sec 80.8sec 26.43% 34.49%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 29.4 0.4 15.6sec 15.7sec 8.60% 10.93%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:8.6%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 7.5 0.0 62.9sec 62.9sec 32.75% 32.75%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.7%
jade_serpent_potion 2.0 0.0 366.7sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.7 0.0 54.0sec 54.0sec 22.81% 23.68%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
metamorphosis 20.0 0.0 23.2sec 23.2sec 38.50% 61.79%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:38.5%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 21.3 60.8 16.5sec 5.3sec 56.31% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:23.5%
  • molten_core_2:10.1%
  • molten_core_3:5.0%
  • molten_core_4:3.2%
  • molten_core_5:2.6%
  • molten_core_6:2.3%
  • molten_core_7:2.1%
  • molten_core_8:1.8%
  • molten_core_9:1.5%
  • molten_core_10:1.2%
  • molten_core_11:0.9%
  • molten_core_12:0.7%
  • molten_core_13:0.5%
  • molten_core_14:0.3%
  • molten_core_15:0.2%
  • molten_core_16:0.1%
  • molten_core_17:0.1%
  • molten_core_18:0.0%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%
  • molten_core_24:0.0%
  • molten_core_25:0.0%
  • molten_core_26:0.0%
  • molten_core_27:0.0%
  • molten_core_28:0.0%
  • molten_core_29:0.0%
  • molten_core_30:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 9.0 0.0 52.2sec 52.2sec 29.51% 29.51%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.5%
synapse_springs_2 7.9 0.0 60.8sec 60.8sec 17.37% 17.37%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H
corruption Mana 1.0 3767.3 3750.0 3750.0 1050.7
dark_soul Mana 6.1 90880.5 15000.0 15000.0 0.0
doom Demonic Fury 9.2 552.0 60.0 60.0 8481.8
hand_of_guldan Mana 29.6 443323.5 15000.0 15000.0 6.7
shadow_bolt Mana 61.9 1020691.7 16500.0 5502.8 4.1
soul_fire Mana 58.3 1311192.0 22506.1 17627.1 5.4
soul_fire Demonic Fury 16.1 1290.0 80.0 17.3 5487.2
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.9
touch_of_chaos Demonic Fury 131.6 5265.1 40.0 40.0 1706.0
pet - doomguard
doom_bolt Energy 20.8 726.7 35.0 35.0 1645.3
pet - felguard
felstorm Energy 10.3 618.1 60.0 60.0 4048.2
legion_strike Energy 82.5 4952.9 60.0 60.0 453.1
pet - wild_imp
firebolt Energy 355.0 355.0 1.0 1.0 16040.7
pet - service_felguard
felstorm Energy 4.3 257.9 60.0 60.0 4639.0
legion_strike Energy 21.8 1310.1 60.0 60.0 523.7
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 82.49 989.83 12.00 0.00 0.00%
wild_imp Demonic Fury 354.68 1773.41 5.00 0.00 0.00%
service_felguard Demonic Fury 21.82 261.81 12.00 0.00 0.00%
corruption Demonic Fury 289.26 1157.03 4.00 0.00 0.00%
metamorphosis Demonic Fury 167.13 -1001.59 -5.99 -1.20 0.12%
shadowflame Demonic Fury 246.76 493.52 2.00 0.00 0.00%
soul_fire Demonic Fury 58.22 1746.50 30.00 0.00 0.00%
life_tap Mana 13.59 999128.15 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 61.77 1544.23 25.00 0.00 0.00%
mp5_regen Mana 1801.91 1722638.79 956.01 92.36 0.01%
pet - doomguard
energy_regen Energy 240.00 708.59 2.95 146.63 17.15%
pet - felguard
energy_regen Energy 1801.91 5468.99 3.04 0.00 0.00%
pet - service_felguard
energy_regen Energy 366.77 1116.40 3.04 34.94 3.03%
Resource RPS-Gain RPS-Loss
Health 0.00 2217.32
Mana 6040.29 6535.38
Demonic Fury 17.68 18.00
Combat End Resource Mean Min Max
Health -510030.85 -906638.75 -245037.50
Mana 78068.93 4297.72 210266.63
Demonic Fury 55.88 0.00 275.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%
felhunter-Mana Cap 0.0%
succubus-Mana Cap 0.0%
infernal-Mana Cap 0.0%
observer-Mana Cap 0.0%
shivarra-Mana Cap 0.0%
abyssal-Mana Cap 0.0%
felguard-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
service_felguard-Mana Cap 0.0%
service_imp-Mana Cap 0.0%
service_voidwalker-Mana Cap 0.0%

Procs

Count Interval
hat_donor 98.0 4.5sec
wild_imp 36.4 12.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 119264.01
Minimum 111003.79
Maximum 129879.65
Spread ( max - min ) 18875.85
Range [ ( max - min ) / 2 * 100% ] 7.91%
Standard Deviation 2485.9285
5th Percentile 115432.52
95th Percentile 123587.29
( 95th Percentile - 5th Percentile ) 8154.77
Mean Distribution
Standard Deviation 24.8593
95.00% Confidence Intervall ( 119215.29 - 119312.74 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1668
0.1 Scale Factor Error with Delta=300 52754
0.05 Scale Factor Error with Delta=300 211018
0.01 Scale Factor Error with Delta=300 5275467
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 119264.01

Damage

Sample Data
Count 10000
Mean 33806661.47

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 411.31
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.90 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.30 blood_fury
A 6.06 dark_soul
B 4.30 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 20.01 melee
F 10.30 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=num_targets>5
I 1.00 summon_doomguard
J 1.00 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
K 9.20 doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
L 20.01 metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
M 14.65 cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
N 29.55 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O 53.84 touch_of_chaos,if=dot.corruption.remains<20
P 74.94 soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Q 77.79 touch_of_chaos
R 13.59 life_tap,if=mana.pct<50
S 61.86 shadow_bolt
T 0.00 fel_flame,moving=1
U 0.00 life_tap

Sample Sequence

79ABFIJLEKKOKNSSPNLEOOOOQQMPSSNSSPPRSSSSNPLEOOOOMSFSRSNSSS7PLEOOOMPSNRSSLEOOQQQAKQQQQQQQQQQQFQQQQQQQQNPPNPPPPSNRS79BPLEOOOMPPPNRSPSFPSSLEOOOOOKMNPPPRSALEOQQQQQQQQQQQKQQQQQQQ7MNPFSNSSPPPNRSSSLEOOOOMSSNSSSPRSSLEOOFOMNPSSSLEO9AB7KOQQQQQQQQQQQQQQQQMNPPNSRSPSFSNSSLEOOOMPPPRNSPPLEOOOQ7QMPPNRSLEOQQQQMPSAFNLEKQQQQQQQQQQQQQQQQQQMNSPPPPNPPPP8P9B7LEOOOFOMNPPPRPPPPNRPLEOOOPKOMPPNPPPRALEOOPPOPPFPKPOPPQQ7NPPNPPPPPLEOOPPPONP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 543 543 343
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 32587 27225 7907
Spell Hit 14.92% 14.92% 5074
Spell Crit 19.90% 13.95% 2773
Spell Haste 17.77% 12.16% 5170
Mana Per 5 17666 16825 0
Attack Power 315 270 0
Melee Hit 14.92% 14.92% 5074
Melee Crit 12.45% 7.44% 2773
Melee Haste 12.16% 12.16% 5170
Swing Speed 23.38% 12.16% 5170
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 22.30% 17.30% 5581

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
glyphs=shadow_bolt

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/wrathguard:wrathstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
actions+=/touch_of_chaos,if=dot.corruption.remains<20
actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int
chest=shaskin_robes,id=87190,gems=80int_160mastery_80int_160mastery_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160mastery_80int_160hit_160int_120haste,reforge=haste_mastery
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit,reforge=haste_mastery
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160mastery_60mastery,enchant=140mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=343
# gear_spell_power=7907
# gear_hit_rating=5074
# gear_crit_rating=2773
# gear_haste_rating=5170
# gear_mastery_rating=5581
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felguard

Warlock_Destruction_T14H : 110899 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
110899.2 110899.2 40.36 / 0.04% 3386 / 3.1% 3.0 29582.8 29177.6 Mana 0.20% 47.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
Glyphs
  • conflagrate
  • burning_embers

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:985851|350864|153012|150237|85081|63441&chds=0,1971702&chco=C79C6E,9482C9,C41F3B,9482C9,C41F3B,C41F3B&chm=t++985851++summon_terrorguard,C79C6E,0,0,15|t++350864++shadowburn,9482C9,1,0,15|t++153012++immolate,C41F3B,2,0,15|t++150237++chaos_bolt,9482C9,3,0,15|t++85081++conflagrate,C41F3B,4,0,15|t++63441++incinerate,C41F3B,5,0,15&chtt=Warlock_Destruction_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:49,25,16,12,9,8,5,3&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C79C6E,C41F3B,C41F3B,9482C9,9482C9,9482C9&chl=incinerate|chaos_bolt|observer: melee|immolate|conflagrate|observer: tongue_lash|shadowburn|terrorguard: doom_bolt&chtt=Warlock_Destruction_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vtvvvwxx0113455572430z0yxwvutqpnnmmmmlkiihihhggffffdddededccbccbcbcdddccdddccdeffgggghhhghiiiihhhggfeeedddccbbaaZZabbbbbbccccccdcccdcccccbccccaaaaaaZabbbbbbbcbbbcdefffffghhghiihhghgggfeeeeedcbbbbZZZabaaaaaaaZZZaaaaaabbbbaabcbbabbbbaaacccccddeeeefghhhhiiijihhhhhgffeeedccddccbbbbbabbccccccbccbaabcbbbbbbbababbbbaaaabaaacdddcddeeeefhijjjjjkkjihiiihggggfeddddddccccccccddddccddccbbcccccccccbbbcccbbbcddddeggggghhhiiiikklkjjjjihhghhhgffffedccdedccbbccbbbcccbbbbbbaaabbcbabbbbaaabcbbbcdefffghijiijjkkjjkkkkiihhggfdddddcbbbbaaZZaaaZZZZaaZZZabaaZZZZZYXXXYXXXWWWV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=110899|max=212582&chxp=1,1,52,100&chtt=Warlock_Destruction_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,2,1,4,10,11,24,30,54,89,124,128,165,240,275,325,351,421,397,515,556,587,571,574,560,527,485,402,428,394,336,274,245,199,180,109,109,85,45,47,39,22,20,12,6,4,4,3,3,4&chds=0,587&chbh=5&chxt=x&chxl=0:|min=104018|avg=110899|max=118717&chxp=0,1,47,100&chtt=Warlock_Destruction_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:67.6,14.5,8.9,7.1,1.3,0.3,0.2&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,9482C9,C79C6E,ffffff&chl=incinerate 304.7s|chaos_bolt 65.4s|conflagrate 40.1s|immolate 32.2s|shadowburn 5.7s|summon_terrorguard 1.2s|waiting 0.9s&chtt=Warlock_Destruction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Destruction_T14H 110899
blood_fury 0 0.0% 4.3 120.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
chaos_bolt 21830 19.7% 28.8 12.87sec 341005 150237 0 341005 341005 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.81 28.81 0.00 0.00 2.2698 0.0000 9822920.01 9822920.01 0.00 150236.61 150236.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 28.81 100.00% 341004.94 294151 521032 341089.25 328453 353786 9822920 9822920 0.00
DPS Timeline Chart

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react&(buff.backdraft.stack<3|level<86)
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:(null)
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100)} Shadow damage. Chaos Bolt always critically strikes. In addition, the damage is increased by your critical strike chance.$?s116858[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.250000
  • base_dd_min:2163.11
  • base_dd_max:2643.80
conflagrate 7579 6.8% 38.7 11.71sec 88185 85081 67055 141615 88185 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.68 38.68 0.00 0.00 1.0365 0.0000 3410628.00 3410628.00 0.00 85080.65 85080.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.72 71.66% 67055.18 61951 90176 67066.36 63757 70009 1858441 1858441 0.00
crit 10.96 28.34% 141615.14 127619 185763 141798.43 127619 175008 1552187 1552187 0.00
DPS Timeline Chart

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.down
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by $s2%.
  • description:Target enemy instantly explodes, dealing $s1 Fire damage$?s56235[ and reducing their movement speed by $s2% for $d.][. If the target is afflicted by Immolate, their movement speed is reduced by $s2% for $17962d.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1522.19
  • base_dd_max:1682.42
dark_soul 0 0.0% 6.1 80.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.06 6.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
immolate 10932 9.9% 27.3 16.43sec 180093 153012 16535 34874 21574 27.5% 0.0% 0.0% 0.0% 200.6 16501 34827 21599 27.8% 0.0% 98.2%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.33 27.33 200.58 200.58 1.1770 2.2072 4921940.91 4921940.91 0.00 10364.64 153012.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.82 72.52% 16535.08 15322 22303 16536.81 15680 17495 327742 327742 0.00
crit 7.51 27.48% 34873.75 31564 45945 34913.38 0 42750 261867 261867 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.8 72.18% 16500.51 15322 22303 16504.79 16021 17013 2388902 2388902 0.00
crit 55.8 27.82% 34826.94 31564 45945 34851.05 33036 37165 1943431 1943431 0.00
DPS Timeline Chart

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:36000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain=5&miss_react
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Burns the enemy for ${$m1*$<mastery>} Fire damage and then an additional ${(($m2+($SP*0.3))*$<mastery>)*5} Fire damage over $d.$?s108647[ Critical strikes have a chance to generate Burning Embers.][]$?s348[][ Replaces Corruption.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.371000
  • base_dd_min:396.30
  • base_dd_max:396.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.371000
  • base_td:396.30
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
incinerate 42909 38.7% 230.4 1.93sec 83874 63441 65147 136461 84316 26.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 230.44 229.23 0.00 0.00 1.3221 0.0000 19327961.08 19327961.08 0.00 63440.67 63440.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.62 73.12% 65146.81 60712 88372 65159.21 64054 66403 10919719 10919719 0.00
crit 61.62 26.88% 136460.89 125066 182047 136517.92 130406 142756 8408242 8408242 0.00
DPS Timeline Chart

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to an enemy.$?s108647[ Generates Burning Embers. Critical strikes double this effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:1420.71
  • base_dd_max:1570.26
shadowburn 4445 4.0% 7.1 11.72sec 281960 350864 215590 446803 281960 28.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 7.11 0.00 0.00 0.8036 0.0000 2005187.09 2005187.09 0.00 350863.88 350863.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.07 71.29% 215589.98 194944 283762 215777.90 0 272166 1093084 1093084 0.00
crit 2.04 28.71% 446802.57 401585 584549 409526.27 0 560661 912103 912103 0.00
DPS Timeline Chart

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react
Spelldata
  • id:17877
  • name:Shadowburn
  • school:shadow
  • tooltip:(null)
  • description:Instantly blasts the target for ${$17877m2*(1+$77220m1*0.01)} Shadow damage. Only usable on enemies that have less than 20% health. Restores $125882m1% of your total mana after $29341d. If the target dies within $29341d, and yields experience or honor, the caster gains a Burning Ember instead.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.500000
  • base_dd_min:3364.84
  • base_dd_max:4112.58
summon_terrorguard 0 (2754) 0.0% (2.4%) 1.0 1.#Rsec 1221469 985851 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2390 0.0000 0.00 0.00 0.00 985850.80 985850.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:37500.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Terrorguard to attack the target for $112926d. The Terrorguard casts Doom Bolt until it departs. $@spelltooltip85692
pet - observer 20451 / 20451
melee 13864 12.5% 316.2 1.42sec 19740 13877 16063 32824 19740 27.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 316.23 316.23 0.00 0.00 1.4224 0.0000 6242375.30 6242375.30 0.00 13877.34 13877.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.29 48.47% 16063.02 15010 21638 16065.75 15700 16423 2462295 2462295 0.00
crit 87.11 27.55% 32824.22 30019 43276 32837.96 31532 34297 2859282 2859282 0.00
glance 75.83 23.98% 12142.19 11257 16228 12145.47 11728 12638 920798 920798 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tongue_lash 6586 5.9% 97.6 4.68sec 30363 29294 23582 48170 30363 27.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tongue_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.63 97.63 0.00 0.00 1.0365 0.0000 2964397.36 2964397.36 0.00 29293.62 29293.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.71 72.42% 23581.95 21874 31846 23586.07 23043 24219 1667367 1667367 0.00
crit 26.93 27.58% 48169.83 43747 63691 48203.77 45650 52010 1297031 1297031 0.00
DPS Timeline Chart

Action details: tongue_lash

Static Values
  • id:115778
  • school:shadow
  • resource:energy
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115778
  • name:Tongue Lash
  • school:shadow
  • tooltip:(null)
  • description:Lick the enemy, causing $s1 Shadow damage.$?s104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - terrorguard 20358 / 2754
doom_bolt 20358 2.4% 21.3 2.76sec 57463 20703 42274 93003 57463 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.26 21.26 0.00 0.00 2.7757 0.0000 1221469.14 1221469.14 0.00 20702.52 20702.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.89 70.06% 42274.34 38904 56641 42226.80 38904 45511 629558 629558 0.00
crit 6.36 29.94% 93003.45 77808 113282 93251.22 0 110588 591911 591911 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 38.7 0.0 11.7sec 11.7sec 44.54% 47.18%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • backdraft_1:10.7%
  • backdraft_2:13.8%
  • backdraft_3:20.1%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by $s1%.$?$W3>0[ Chaos Bolt's cast time reduced by $s3%][]
  • description:When you cast Conflagrate, the cast time for your next three Incinerate$?s123686[ or one Chaos Bolt][] is reduced by $117828s1%. Lasts $117828d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
blood_fury 4.3 0.0 120.9sec 121.0sec 14.07% 14.07%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:14.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.01%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 6.1 0.0 80.8sec 80.8sec 26.44% 26.58%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:26.4%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 7.2 0.0 65.8sec 65.8sec 31.33% 31.33%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:31.3%
jade_serpent_potion 2.0 0.0 366.7sec 0.0sec 10.15% 10.15%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.1%
jade_spirit 8.0 0.0 58.4sec 58.4sec 21.07% 20.94%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.1%
relic_of_yulon 8.6 0.0 54.2sec 54.2sec 28.35% 28.35%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.3%
synapse_springs_2 7.9 0.0 60.9sec 60.8sec 17.36% 17.36%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.4%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Destruction_T14H
chaos_bolt Burning Ember 28.8 28.8 1.0 1.0 341004.9
conflagrate Mana 38.7 464108.4 12000.0 12000.0 7.3
dark_soul Mana 6.1 90862.5 15000.0 15000.0 0.0
immolate Mana 27.3 983880.0 36000.0 36000.0 5.0
incinerate Mana 230.4 11753734.2 51005.6 51005.6 1.6
shadowburn Burning Ember 7.1 7.1 1.0 1.0 281960.0
summon_terrorguard Mana 1.0 37500.0 37500.0 37500.0 32.6
pet - observer
tongue_lash Energy 97.6 5857.9 60.0 60.0 506.1
pet - terrorguard
doom_bolt Energy 21.3 744.0 35.0 35.0 1641.8
Resource Gains Type Count Total Average Overflow
shadowburn Mana 6.69 301198.81 44999.37 4.19 0.00%
immolate Burning Ember 63.31 6.33 0.10 0.00 0.00%
incinerate Burning Ember 229.23 29.09 0.13 0.00 0.00%
mp5_regen Mana 1801.91 12846303.83 7129.28 304393.38 2.31%
pet - observer
energy_regen Energy 1801.91 5758.38 3.20 0.00 0.00%
pet - terrorguard
energy_regen Energy 239.00 726.68 3.04 172.41 19.18%
Resource RPS-Gain RPS-Loss
Mana 29177.64 29582.84
Burning Ember 0.08 0.08
Combat End Resource Mean Min Max
Health 490075.00 490075.00 490075.00
Mana 117575.39 32492.89 242546.81
Burning Ember 0.49 0.00 1.10
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.0%
felhunter-Mana Cap 2.0%
succubus-Mana Cap 2.0%
infernal-Mana Cap 2.0%
observer-Mana Cap 2.0%
shivarra-Mana Cap 2.0%
abyssal-Mana Cap 2.0%
service_felguard-Mana Cap 2.0%
service_imp-Mana Cap 2.0%
service_voidwalker-Mana Cap 2.0%

Procs

Count Interval
hat_donor 55.8 7.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 110899.18
Minimum 104018.34
Maximum 118716.57
Spread ( max - min ) 14698.23
Range [ ( max - min ) / 2 * 100% ] 6.63%
Standard Deviation 2059.1792
5th Percentile 107582.05
95th Percentile 114353.10
( 95th Percentile - 5th Percentile ) 6771.05
Mean Distribution
Standard Deviation 20.5918
95.00% Confidence Intervall ( 110858.82 - 110939.54 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1324
0.1 Scale Factor Error with Delta=300 36196
0.05 Scale Factor Error with Delta=300 144787
0.01 Scale Factor Error with Delta=300 3619694
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 110899.18

Damage

Sample Data
Count 10000
Mean 39488637.08

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 353.42
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 7.90 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.30 blood_fury
A 6.06 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>2
F 1.00 summon_doomguard
G 0.00 havoc,target=2,if=num_targets>1
H 7.11 shadowburn,if=ember_react
I 28.81 chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
J 38.68 conflagrate,if=buff.backdraft.down
K 27.33 immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
L 231.24 incinerate

Sample Sequence

79AFIJKLLLJLLLLKIJLLLLLLLILJLLKLLLLILJLLLLLIKLJLLLLL7LLIJKLLLLLLJLLLAIKLLLJLLILLLLIJKLLLLLLJLIKLL9L7LJLLLLIKLLJLLLLLLKIJLLLLLLLIAJLLKLLLIJLLLLLLI7JKLLLLLLLJKLILLLLLJLIKLLLLLJLILLLLKLJLILLL9ALL7JLKLILLLJLILLKLLLJLILLLLKLJLILLLLLJLLLLKILL7JLLLLLIKJLLLLALILJLKLLLLILJLLLLKILLJLLLLL8LH9LJK7LLLLLLLJHLLKLLHLLJLLLLLHKLJLLALLLHLLLJKHLLLLLLLHJ7LLLLKLLHJLLLLLLLJL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Burning Ember 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 21.66% 15.71% 3831
Spell Haste 24.62% 18.68% 7940
Mana Per 5 135520 129067 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.22% 9.21% 3831
Melee Haste 18.68% 18.68% 7940
Swing Speed 30.55% 18.68% 7940
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.61% 32.61% 1720

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Destruction_T14H"
origin="unknown"
level=90
race=orc
spec=destruction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
glyphs=conflagrate/burning_embers

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>2
actions+=/summon_doomguard
actions+=/havoc,target=2,if=num_targets>1
actions+=/shadowburn,if=ember_react
actions+=/chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
actions+=/conflagrate,if=buff.backdraft.down
actions+=/immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
actions+=/incinerate

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/rain_of_fire,if=!ticking&!in_flight
actions.aoe+=/fire_and_brimstone,if=ember_react&buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!ticking
actions.aoe+=/conflagrate,if=ember_react&buff.fire_and_brimstone.up
actions.aoe+=/incinerate,if=buff.fire_and_brimstone.up
actions.aoe+=/immolate,cycle_targets=1,if=!ticking

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3831
# gear_haste_rating=7940
# gear_mastery_rating=1720
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warrior_Arms_T14H : 114971 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114971.0 114971.0 66.80 / 0.06% 5589 / 4.9% 16565.6 6.9 7.0 Rage 0.05% 50.5 100.0%
Origin http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://6.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:183595|134618|70962|60489|52710|44896|27391|14583|12375&chds=0,367189&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++183595++execute,C79C6E,0,0,15|t++134618++dragon_roar,C79C6E,1,0,15|t++70962++mortal_strike,C79C6E,2,0,15|t++60489++slam,C79C6E,3,0,15|t++52710++overpower,C79C6E,4,0,15|t++44896++colossus_smash,C79C6E,5,0,15|t++27391++impending_victory,C79C6E,6,0,15|t++14583++melee_main_hand,C79C6E,7,0,15|t++12375++heroic_throw,C79C6E,8,0,15&chtt=Warrior_Arms_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,13,12,9,9,7,5,5,5,3,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=mortal_strike|overpower|melee_main_hand|execute|slam|opportunity_strike|heroic_strike|bloodbath|deep_wounds|colossus_smash|dragon_roar|heroic_leap|heroic_throw|impending_victory&chtt=Warrior_Arms_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:856634423100xywsrpnonlmkjjighgfffggefgdffdedcdccccbddeedhigijiklkmmlmnmmllkjkighgegfdeecddbddcdddddeededcedcecbddceedfffhfhihijikkjlkjkjjjhiifhhfghfghfhhghihihiihjjgiifhheggeggeggghhiihjjjlkjllklkjkjijhhhgggeeedeededcedddccdccdbcdbcdcdedeffgghhgijikkikljkkijjhihhgggfefedeedeecedcedcddceccdcdddeeegggihikjkmlmonopoppoppnoonnnmnlmmkmmkmmjmmjlljllklkklklljlljmljmmknmlnnnonnonopnponppnponpononnonnomnomnnlmmlmlklkkljkljlljllkmnlnonpppqpqrqsrprrpsrprrprqprqqsrstsuvtwwvyyxyxxzyxzwxywxxuwwuwvtuttusstrstqrrprroppnoonnmmmlmmkmmkmmkmmkmmkmlkmlklkllkonmonmonnpoo&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=114971|max=192711&chxp=1,1,60,100&chtt=Warrior_Arms_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,5,8,9,15,24,44,65,83,108,151,199,254,301,383,431,463,504,543,593,593,607,587,594,509,449,427,377,337,259,266,183,141,123,95,69,58,31,29,26,18,15,7,6,5,0,1,2,2&chds=0,607&chbh=5&chxt=x&chxl=0:|min=103497|avg=114971|max=128940&chxp=0,1,45,100&chtt=Warrior_Arms_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.9,25.1,17.7,12.6,7.2,2.8,2.4,1.3,0.1,0.0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=overpower 139.5s|mortal_strike 113.1s|slam 79.6s|colossus_smash 56.8s|execute 32.6s|heroic_throw 12.5s|dragon_roar 10.9s|battle_shout 5.9s|impending_victory 0.4s|waiting 0.2s&chtt=Warrior_Arms_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Arms_T14H 114971
battle_shout 0 0.0% 3.8 101.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.84 3.84 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 14.9 31.35sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.89 14.89 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.enrage.up
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 6126 5.3% 7.9 60.65sec 347242 0 0 0 0 0.0% 0.0% 0.0% 0.0% 132.4 20790 0 20790 0.0% 0.0% 29.4%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.92 129.06 132.35 132.35 0.0000 1.0000 2751578.81 2751578.81 0.00 20789.70 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.13 93.86% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.92 6.14% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.4 100.00% 20789.56 657 84150 20828.56 15010 29382 2751579 2751579 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:19798.95
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
colossus_smash 5659 4.9% 36.9 12.26sec 68981 44896 51781 108015 68981 30.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.94 36.94 0.00 0.00 1.5365 0.0000 2548185.45 2548185.45 0.00 44896.41 44896.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.57 69.21% 51781.49 44862 85078 51745.75 47183 60142 1323861 1323861 0.00
crit 11.33 30.68% 108014.63 92415 175262 107929.90 93917 136470 1224324 1224324 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.remains<=1.5
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 60.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.82 7.82 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 5926 5.2% 73.5 6.17sec 36300 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 13587 27835 17828 29.8% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.52 73.52 149.70 149.70 0.0000 3.0000 2668871.57 2668871.57 0.00 5942.58 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.1 70.24% 13587.14 11512 18442 13590.65 13095 14163 1428664 1428664 0.00
crit 44.6 29.76% 27835.25 23024 36885 27858.19 26196 29907 1240208 1240208 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3263 2.8% 7.1 65.77sec 206819 134618 0 207020 206819 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.10 7.10 0.00 0.00 1.5363 0.0000 1467876.47 1467876.47 0.00 134618.16 134618.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 7.09 99.90% 207020.16 169854 273644 207170.45 176784 231829 1467876 1467876 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 13287 11.5% 21.2 3.99sec 282089 183595 204712 443714 282089 32.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.19 21.19 0.00 0.00 1.5365 0.0000 5976556.21 5976556.21 0.00 183594.64 183594.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.29 67.43% 204712.34 137435 320425 204854.62 161789 260030 2924561 2924561 0.00
crit 6.88 32.47% 443713.54 283116 660076 444941.95 0 642503 3051995 3051995 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2333 2.0% 13.9 33.56sec 75685 0 56202 118951 75685 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.87 13.87 0.00 0.00 0.0000 0.0000 1050039.06 1050039.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.55 68.81% 56202.21 47025 75806 56203.40 49631 65306 536574 536574 0.00
crit 4.32 31.11% 118951.33 96871 156160 118655.99 0 156160 513465 513465 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 8090 7.0% 36.0 9.99sec 101244 0 77144 156463 101244 30.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.99 35.99 0.00 0.00 0.0000 0.0000 3643358.34 3643358.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.98 69.40% 77144.11 41918 301898 77103.58 51988 114583 1926744 1926744 0.00
crit 10.97 30.49% 156462.69 86350 621910 156202.75 86350 343153 1716615 1716615 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 343 0.3% 8.1 53.26sec 19015 12375 14368 30109 19017 29.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 1.5365 0.0000 154729.65 154729.65 0.00 12375.40 12375.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.72 70.27% 14368.47 13147 25165 14360.90 0 18502 82156 82156 0.00
crit 2.41 29.62% 30108.52 27084 51839 28065.60 0 51839 72574 72574 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 25 0.0% 0.3 105.09sec 42015 27391 32206 66397 42015 28.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.27 0.27 0.00 0.00 1.5339 0.0000 11394.49 11394.49 0.00 27390.61 27390.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.19 71.24% 32205.98 26344 46842 5652.76 0 46842 6222 6222 0.00
crit 0.08 28.72% 66396.64 54269 96494 4941.48 0 96494 5172 5172 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 14547 12.7% 151.9 2.96sec 43121 14583 35609 73369 43121 25.6% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 151.92 151.92 0.00 0.00 2.9569 0.0000 6551183.80 6551183.80 0.00 14583.46 14583.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.37 50.27% 35609.32 26295 50329 35615.57 32100 38984 2719373 2719373 0.00
crit 38.96 25.65% 73368.91 54167 103678 73380.19 62732 82858 2858783 2858783 0.00
glance 36.43 23.98% 26707.90 19721 37747 26714.84 23057 30493 973028 973028 0.00
dodge 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 17815 15.5% 73.6 6.16sec 109033 70962 82347 172210 109033 29.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.61 73.61 0.00 0.00 1.5365 0.0000 8025377.44 8025377.44 0.00 70962.01 70962.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.59 70.09% 82346.68 61811 116522 82359.68 74499 91392 4248331 4248331 0.00
crit 21.93 29.80% 172209.95 127331 240036 172303.29 139267 211650 3777046 3777046 0.00
dodge 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:Healing effects on you are increased by $s5%
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. Generates 10 Rage.$?s58368[ When your Mortal Strike is affecting a target, healing effects on you are increased by $s5%. ][] |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1460.66
  • base_dd_max:1460.66
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.85
opportunity_strike 10554 9.2% 189.4 2.37sec 25098 0 19162 39153 25098 29.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 189.39 189.39 0.00 0.00 0.0000 0.0000 4753236.64 4753236.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.75 70.09% 19161.65 13992 26564 19162.47 17702 20907 2543735 2543735 0.00
crit 56.43 29.80% 39152.58 27983 53129 39165.27 35055 44623 2209501 2209501 0.00
dodge 0.05 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.16 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76858
  • name:Opportunity Strike
  • school:physical
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.55
overpower 16315 14.2% 90.8 4.92sec 80988 52710 41416 86762 80988 87.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.76 90.76 0.00 0.00 1.5365 0.0000 7350669.88 7350669.88 0.00 52710.36 52710.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.42 12.58% 41415.95 31554 60395 41437.22 31554 53684 472958 472958 0.00
crit 79.27 87.34% 86762.35 65000 124414 86795.96 79693 95802 6877712 6877712 0.00
miss 0.07 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.overpower.up
Spelldata
  • id:7384
  • name:Overpower
  • school:physical
  • tooltip:(null)
  • description:Instantly overpower the enemy causing $m1% weapon damage. Cannot be blocked, dodged or parried. Overpower has a $s3% increased chance to be a critical strike. Only usable after the target dodges$?s56638[ or when activated by Taste for Blood][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
recklessness 0 0.0% 3.4 168.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.40 3.40 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
slam 10688 9.3% 51.8 6.80sec 92940 60489 71137 148253 92940 28.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.81 51.81 0.00 0.00 1.5365 0.0000 4814984.20 4814984.20 0.00 60488.99 60488.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.05 71.51% 71137.03 56587 106908 71166.12 63751 81326 2635485 2635485 0.00
crit 14.70 28.38% 148253.16 116569 220230 148394.70 121337 190617 2179499 2179499 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:(null)
  • description:Slams the opponent, causing $1464m2% weapon damage plus $1464m1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:997.04
  • base_dd_max:997.04
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 14.9 0.0 31.3sec 31.3sec 19.72% 19.72%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:19.7%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 7.9 0.0 60.6sec 60.7sec 20.88% 22.93%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.9%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 12.00%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 14.4 25.2 31.5sec 11.1sec 66.44% 65.22%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:66.4%
darkmist_vortex 7.4 0.0 64.5sec 64.5sec 32.27% 32.27%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.3%
deadly_calm 7.8 0.0 60.8sec 60.8sec 11.40% 40.87%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:2.4%
  • deadly_calm_2:2.7%
  • deadly_calm_3:6.3%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 34.2 14.0 13.3sec 9.6sec 53.02% 52.13%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:53.0%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 389.9sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
overpower 64.3 36.4 7.0sec 4.5sec 49.33% 49.33%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_overpower
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • overpower_1:49.3%
recklessness 3.4 0.0 162.6sec 168.3sec 13.56% 14.01%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.7 0.0 48.5sec 48.5sec 31.90% 31.90%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.9%
taste_for_blood 19.0 8.2 22.4sec 15.7sec 28.45% 45.88%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_taste_for_blood
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • taste_for_blood_1:19.0%
  • taste_for_blood_2:6.3%
  • taste_for_blood_3:2.2%
  • taste_for_blood_4:0.6%
  • taste_for_blood_5:0.3%

Spelldata details

  • id:125831
  • name:Taste for Blood
  • tooltip:Your next Heroic Strike or Cleave will hit for $w1% additional damage.
  • description:$@spelldesc56638
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T14H
execute Rage 21.2 635.6 30.0 30.0 9403.0
heroic_strike Rage 36.0 932.5 25.9 25.9 3907.1
impending_victory Rage 0.3 2.7 10.0 10.0 4201.5
slam Rage 51.8 1554.2 30.0 30.0 3098.0
Resource Gains Type Count Total Average Overflow
battle_shout Rage 3.84 76.88 20.00 0.00 0.00%
enrage Rage 48.24 468.44 9.71 13.99 2.90%
melee_main_hand Rage 151.80 1879.64 12.38 33.07 1.73%
mortal_strike Rage 73.61 728.77 9.90 7.29 0.99%
Resource RPS-Gain RPS-Loss
Rage 7.00 6.94
Combat End Resource Mean Min Max
Health 460269.00 460269.00 460269.00
Rage 28.88 0.20 89.20
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 1.7%

Procs

Count Interval
hat_donor 215.4 2.3sec
strikes_of_opportunity 189.4 2.4sec
sudden_death 30.3 14.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 114970.97
Minimum 103497.42
Maximum 128939.65
Spread ( max - min ) 25442.23
Range [ ( max - min ) / 2 * 100% ] 11.06%
Standard Deviation 3408.2410
5th Percentile 109551.41
95th Percentile 120728.87
( 95th Percentile - 5th Percentile ) 11177.46
Mean Distribution
Standard Deviation 34.0824
95.00% Confidence Intervall ( 114904.17 - 115037.77 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3375
0.1 Scale Factor Error with Delta=300 99161
0.05 Scale Factor Error with Delta=300 396647
0.01 Scale Factor Error with Delta=300 9916176
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 114970.97

Damage

Sample Data
Count 10000
Mean 51768042.01

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 379.55
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.40 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.92 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 14.89 berserker_rage,use_off_gcd=1,if=!buff.enrage.up
B 13.87 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.82 deadly_calm,use_off_gcd=1,if=rage>=40
D 35.99 heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
E 73.61 mortal_strike
F 36.94 colossus_smash,if=debuff.colossus_smash.remains<=1.5
G 21.19 execute
H 0.00 storm_bolt,if=talent.storm_bolt.enabled
I 90.76 overpower,if=buff.overpower.up
J 0.00 shockwave,if=talent.shockwave.enabled
K 7.10 dragon_roar,if=talent.dragon_roar.enabled
L 48.39 slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
M 8.14 heroic_throw
N 3.84 battle_shout,if=rage<70&!debuff.colossus_smash.up
O 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
P 3.41 slam,if=target.health.pct>=20
Q 0.27 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
R 0.01 battle_shout,if=rage<70

Sample Sequence

579AEFBCDIDIDEFIIEFIIDEFDIIDEFIIDAEBIFDKEDIDLMEIILEIFIDEIFL9AEDCBIDILEILMEILFEDIDINEILALEIIKEFBDILEIILEILLEIL9AFCDEDIDFLEBFIIEFIIDEILMEIIAL7EFDIKEDBFILEILLEILFEI9LCDAFDEDILMEINLEILFBEIDILEFILAEILKEILLEFIBIDEFDILE9ICFDLDAEDIMPEINLEIIIEFBDIIEDFIDIAEDILKEILLEFILEBFIL9ECDILMAEFDIDIEILNEIFDLEBFIIDEFIDLAEFIKEDFILEFILBEFIGCEGGGAEGGI796EGIFEGIGEGIMEGIIAEFBGGEFGGEFGIEFGIECFGGAEBFG9IEFGGEGIIE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20442 18104 17034
Agility 226 215 80
Stamina 22419 20381 20193
Intellect 121 115 80
Spirit 146 146 80
Health 460269 431737 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 14.89% 14.89% 2522
Spell Crit 23.65% 18.65% 10584
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 45214 36428 0
Melee Hit 7.42% 7.42% 2522
Melee Crit 28.66% 23.66% 10584
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.48% 7.48% 2542
Armor 34135 34135 34135
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.88% 10.25% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.51% 33.51% 4338

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Arms_T14H"
origin="http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html"
level=90
race=worgen
spec=arms
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!buff.enrage.up
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
actions+=/mortal_strike
actions+=/colossus_smash,if=debuff.colossus_smash.remains<=1.5
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/overpower,if=buff.overpower.up
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/slam,if=target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_mastery
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=87145,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=80str_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel

# Gear Summary
# gear_strength=17034
# gear_agility=80
# gear_stamina=20193
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2542
# gear_hit_rating=2522
# gear_crit_rating=10584
# gear_haste_rating=784
# gear_mastery_rating=4338
# gear_armor=34135
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Warrior_Fury_1h_T14H : 123721 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
123721.1 123721.1 80.84 / 0.07% 6772 / 5.5% 12916.3 9.6 9.6 Rage 5.11% 58.6 100.0%
Origin http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://4.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:232250|171862|97948|50087|35242|34303|19919|15478|13056|10518&chds=0,464500&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++232250++execute,C79C6E,0,0,15|t++171862++dragon_roar,C79C6E,1,0,15|t++97948++raging_blow,C79C6E,2,0,15|t++50087++wild_strike,C79C6E,3,0,15|t++35242++bloodthirst,C79C6E,4,0,15|t++34303++colossus_smash,C79C6E,5,0,15|t++19919++impending_victory,C79C6E,6,0,15|t++15478++melee_main_hand,C79C6E,7,0,15|t++13056++melee_off_hand,C79C6E,8,0,15|t++10518++heroic_throw,C79C6E,9,0,15&chtt=Warrior_Fury_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,13,11,9,9,8,8,7,6,4,3,2,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|melee_main_hand|melee_off_hand|bloodthirst|raging_blow_mh|heroic_strike|deep_wounds|raging_blow_oh|wild_strike|bloodbath|dragon_roar|heroic_leap|colossus_smash|impending_victory|heroic_throw&chtt=Warrior_Fury_1h_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:755423211zyywwtssplljihgffccbaaZZaaaaaaaaaaZZZYYYYYYYZZYYYZZZabbccddddeeddcccccbbbbaaZZZYYYYYYYYYYXXXXXXXXXXXXXXXXXYYYYZZZZabbbcddddddddddccbbbcbccccccdddddeeeeefffeeeedddddddddcccccbbbbaaabbbbbbbbbbbaaabbaaaaaaaaaZZZZZYYYYYXXXXWWWWWWXXYYYZZZZaaabbbbcccccccccbbbbbbaaaZZZYYYYYYYYYXXXXXXXXYYYYZZabbcddeffgghiijjjjjjjjjiiiiiiiiiiihhhiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhiiijjjkkkkkkkllllllmmmmmmmmmmmmmmlllkkkjjiiiihhhhhhhhhiiijjkkllmmnoooopppppppoooppppqqrrsttuvwwxyyzz000000zzzzyyyyxxxwwvvvutttssrrqqqppoonnnmmlllllklllllllllmmmmllllllllkkkkkkkjkjjiiiiiiiiihhg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=123721|max=236174&chxp=1,1,52,100&chtt=Warrior_Fury_1h_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,2,3,4,7,12,17,27,34,62,71,115,164,214,278,295,391,443,539,544,562,612,627,673,626,593,498,475,418,341,314,234,193,156,111,98,69,55,37,25,19,15,8,5,5,3,0,3,2&chds=0,673&chbh=5&chxt=x&chxl=0:|min=108097|avg=123721|max=140605&chxp=0,1,48,100&chtt=Warrior_Fury_1h_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.5,20.3,15.5,8.4,7.3,3.8,3.0,2.4,2.0,5.1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 146.4s|raging_blow 91.5s|wild_strike 69.8s|execute 37.8s|colossus_smash 32.7s|heroic_throw 17.2s|impending_victory 13.4s|dragon_roar 10.7s|battle_shout 8.8s|waiting 23.0s&chtt=Warrior_Fury_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T14H 123721
battle_shout 0 0.0% 5.7 72.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.72 5.72 0.00 0.00 1.5363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 13.2 35.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.19 13.19 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 5492 4.4% 8.0 60.31sec 309030 0 0 0 0 0.0% 0.0% 0.0% 0.0% 131.7 18730 0 18730 0.0% 0.0% 29.2%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.98 121.44 131.67 131.67 0.0000 1.0000 2466210.26 2466210.26 0.00 18729.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.45 93.43% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.98 6.57% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.7 100.00% 18729.87 428 110536 18777.62 12811 28489 2466210 2466210 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:26349.78
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 11454 9.3% 95.3 4.75sec 54149 35242 32867 70096 54149 57.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.28 95.28 0.00 0.00 1.5365 0.0000 5159391.10 5159391.10 0.00 35241.98 35241.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.81 42.84% 32867.28 22138 56799 32922.10 29242 37466 1341442 1341442 0.00
crit 54.47 57.16% 70096.43 45605 117006 70062.42 62469 75623 3817949 3817949 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 0 0.0% 95.3 4.75sec 0 0 0 0 0 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 95.28 95.28 0.00 0.00 0.0000 0.0000 0.00 146370.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.09 76.71% 0.00 0 0 0.00 0 0 0 91070 100.00
crit 22.19 23.29% 0.00 0 0 0.00 0 0 0 55300 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 2494 2.0% 21.3 21.57sec 52707 34303 39623 83795 52707 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.31 21.31 0.00 0.00 1.5365 0.0000 1122956.16 1122956.16 0.00 34303.40 34303.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.99 70.38% 39622.94 29285 51586 39621.49 32863 44758 594126 594126 0.00
crit 6.31 29.62% 83794.95 60327 106267 83886.26 0 102928 528830 528830 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 61.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.79 7.79 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 9774 7.9% 95.3 4.75sec 46202 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 22383 46314 29406 29.3% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.28 95.28 149.70 149.70 0.0000 3.0000 4402188.12 4402188.12 0.00 9802.07 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.8 70.65% 22383.38 15251 33529 22389.43 20206 24359 2367510 2367510 0.00
crit 43.9 29.35% 46314.37 30502 67058 46353.81 40981 52089 2034678 2034678 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 4078 3.3% 6.9 67.30sec 264051 171862 0 264051 264051 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.95 6.95 0.00 0.00 1.5364 0.0000 1833939.25 1833939.25 0.00 171861.99 171861.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 6.95 100.00% 264050.92 179952 398219 264234.87 200508 328646 1833939 1833939 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 19524 15.8% 24.6 3.43sec 356845 232250 257434 564241 356845 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.62 24.62 0.00 0.00 1.5365 0.0000 8784386.16 8784386.16 0.00 232249.85 232249.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.64 67.60% 257434.05 145759 465505 257668.24 194480 333571 4283831 4283831 0.00
crit 7.98 32.40% 564240.92 300263 958941 566162.95 0 905676 4500555 4500555 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 3021 2.4% 10.9 43.11sec 124651 0 92474 197972 124651 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.91 10.91 0.00 0.00 0.0000 0.0000 1359698.41 1359698.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.58 69.50% 92473.97 62273 137904 92402.12 65082 113017 701045 701045 0.00
crit 3.33 30.50% 197972.11 128282 284082 195065.42 0 284082 658653 658653 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 10320 8.3% 71.3 5.10sec 65171 0 49252 103905 65171 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.31 71.31 0.00 0.00 0.0000 0.0000 4647116.07 4647116.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.54 70.87% 49252.47 26177 67691 49233.92 43496 54090 2489097 2489097 0.00
crit 20.77 29.13% 103905.29 53926 139443 103964.73 82773 121827 2158019 2158019 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 402 0.3% 11.2 38.52sec 16160 10518 12287 25877 16161 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 0.00 0.00 1.5365 0.0000 181312.13 181312.13 0.00 10517.55 10517.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.02 71.50% 12287.17 8563 20677 12292.95 8681 18421 98562 98562 0.00
crit 3.20 28.50% 25877.35 17640 46282 25267.98 0 42594 82751 82751 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 593 0.5% 8.7 40.69sec 30606 19919 23327 49193 30606 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.72 8.72 0.00 0.00 1.5365 0.0000 266958.01 266958.01 0.00 19919.27 19919.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.27 71.86% 23326.83 17180 41465 23314.99 0 37278 146208 146208 0.00
crit 2.45 28.14% 49193.40 35391 85417 46132.60 0 85417 120750 120750 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 8.7 40.69sec 0 0 0 0 0 23.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.72 8.72 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.68 76.60% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.04 23.40% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 15684 12.7% 229.6 1.96sec 30754 15478 30159 62097 30754 25.2% 18.8% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.64 229.64 0.00 0.00 1.9870 0.0000 7062525.53 7062525.53 0.00 15477.71 15477.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.44 31.98% 30159.03 18839 49427 30166.56 27252 33692 2214828 2214828 0.00
crit 57.96 25.24% 62097.08 38809 101819 62109.81 54731 70142 3599141 3599141 0.00
glance 55.18 24.03% 22627.72 14130 37070 22635.41 19650 25690 1248557 1248557 0.00
miss 43.07 18.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 13233 10.7% 229.6 1.96sec 25949 13056 25449 52390 25949 25.2% 18.7% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 229.64 229.64 0.00 0.00 1.9876 0.0000 5959034.26 5959034.26 0.00 13055.52 13055.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.50 32.01% 25448.81 15896 41704 25454.33 22763 28452 1870406 1870406 0.00
crit 57.95 25.24% 52389.59 32745 85910 52399.06 46369 58666 3035977 3035977 0.00
glance 55.14 24.01% 19089.27 11922 31278 19094.77 16760 21790 1052651 1052651 0.00
miss 43.05 18.75% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (19887) 0.0% (16.1%) 59.5 7.49sec 150496 97948 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.54 59.54 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 97948.12 97948.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 10786 8.7% 59.5 7.49sec 81619 0 61034 128254 81619 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.54 59.54 0.00 0.00 0.0000 0.0000 4859395.44 4859395.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.31 69.38% 61034.11 35523 92372 61048.91 54860 66580 2521050 2521050 0.00
crit 18.23 30.62% 128253.59 73178 190286 128376.77 104461 151467 2338345 2338345 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 9101 7.4% 59.5 7.49sec 68877 0 51493 108232 68877 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.54 59.54 0.00 0.00 0.0000 0.0000 4100801.03 4100801.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.30 69.36% 51493.45 29973 77939 51503.29 45637 57517 2126489 2126489 0.00
crit 18.24 30.64% 108231.89 61744 160553 108353.31 88011 137811 1974312 1974312 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.4 166.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.42 3.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 7764 6.3% 58.8 5.98sec 59511 50087 45669 95416 59511 27.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.78 58.78 0.00 0.00 1.1882 0.0000 3497807.68 3497807.68 0.00 50086.74 50086.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.42 72.18% 45669.05 31455 81386 45689.23 38876 54368 1937345 1937345 0.00
crit 16.35 27.82% 95416.04 64796 167655 95409.42 73590 121042 1560462 1560462 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 13.2 0.0 35.5sec 35.6sec 17.46% 17.46%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.5%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 8.0 0.0 60.3sec 60.3sec 20.98% 23.28%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:21.0%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.37%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 15.3 3.8 28.6sec 22.7sec 29.80% 69.67%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:8.5%
  • bloodsurge_2:4.6%
  • bloodsurge_3:16.7%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 13.0 10.5 34.2sec 18.4sec 47.13% 45.92%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:47.1%
dancing_steel_oh 9.6 4.0 43.9sec 30.2sec 30.47% 30.19%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:30.5%
darkmist_vortex 7.5 0.0 63.7sec 63.7sec 32.66% 32.66%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.7%
deadly_calm 7.8 0.0 61.2sec 61.2sec 8.70% 26.92%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:3.1%
  • deadly_calm_2:3.0%
  • deadly_calm_3:2.6%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 28.8 45.2 15.9sec 6.2sec 76.65% 76.81%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:76.7%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 52.2 25.4 8.6sec 5.7sec 35.93% 42.49%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:16.5%
  • flurry_2:5.4%
  • flurry_3:14.0%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 389.1sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
raging_blow 60.3 13.7 7.5sec 6.2sec 35.30% 35.30%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:26.8%
  • raging_blow_2:8.5%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
recklessness 3.4 0.0 160.9sec 166.5sec 13.63% 14.35%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.8 0.0 47.9sec 47.9sec 32.28% 32.28%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_1h_T14H
execute Rage 24.6 738.5 30.0 30.0 11894.8
heroic_strike Rage 71.3 1947.2 27.3 27.3 2386.5
impending_victory Rage 8.7 87.2 10.0 10.0 3060.6
raging_blow Rage 59.5 595.4 10.0 10.0 15049.6
wild_strike Rage 58.8 944.3 16.1 16.1 3704.0
Resource Gains Type Count Total Average Overflow
battle_shout Rage 5.72 114.45 20.00 0.00 0.00%
bloodthirst Rage 95.28 952.80 10.00 0.01 0.00%
enrage Rage 73.97 737.07 9.96 2.61 0.35%
melee_main_hand Rage 186.58 1697.84 9.10 0.01 0.00%
melee_off_hand Rage 186.59 838.50 4.49 1.16 0.14%
Resource RPS-Gain RPS-Loss
Rage 9.63 9.57
Combat End Resource Mean Min Max
Health 455691.00 455691.00 455691.00
Rage 28.12 0.10 83.90
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 158.3 3.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 123721.07
Minimum 108096.93
Maximum 140605.04
Spread ( max - min ) 32508.11
Range [ ( max - min ) / 2 * 100% ] 13.14%
Standard Deviation 4124.6686
5th Percentile 117120.14
95th Percentile 130664.16
( 95th Percentile - 5th Percentile ) 13544.02
Mean Distribution
Standard Deviation 41.2467
95.00% Confidence Intervall ( 123640.23 - 123801.91 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4269
0.1 Scale Factor Error with Delta=300 145231
0.05 Scale Factor Error with Delta=300 580927
0.01 Scale Factor Error with Delta=300 14523182
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 123721.07

Damage

Sample Data
Count 10000
Mean 55703719.61

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 440.41
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.42 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.98 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 13.19 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 10.91 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.79 deadly_calm,use_off_gcd=1,if=rage>=40
D 71.31 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 95.28 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 14.11 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 31.69 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 21.31 colossus_smash
I 24.62 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 59.54 raging_blow,if=buff.raging_blow.react
L 26.71 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 6.95 dragon_roar,if=talent.dragon_roar.enabled
O 11.22 heroic_throw
P 5.22 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 4.72 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 8.72 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 13.24 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.50 battle_shout,if=rage<70

Sample Sequence

579AEHBCDKEDKDNEOKEKSEDKDHDEDKRDEPAKELLFEDKTGEDHBDODEDRSGEKGETG9EACDKDHDELDLGELNGELLFEOSEHBDRDEDKPGEATKFEKLFEDKHDEDLDLGEKLFELL9FECDKDODGEHBDKEDANKESGETGETHDEDKUDEKLFELOAGE7KTGEHBDKDEDKDSGEK9LFECDLDKGEDHDGEADNDKEKOEKTESGEHBDRDGEDKLFELAPGEKTEKHDEDLDLFEK9OECDSDKDGELLFEHBDKEDANKETGEKLFELOGEDHDKDFEDKLFEPAKELLFESHBD9GEDLDLFECDLKFDEDKLGEKOEHDKDEDNDASEKGEKTELLFEHBDRDEDKOEKPGESDI796GEIIECHIIEIKEIKGEAIIEIHBIEIKEINEIIEIKEHAIGEIKGE9IOGEIIEKPECHBIIEIAIEKGE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20050 17730 16678
Agility 226 215 80
Stamina 22092 20084 19896
Intellect 121 115 80
Spirit 146 146 80
Health 455691 427579 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.25% 15.25% 2633
Spell Crit 23.26% 18.25% 10346
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 44352 35680 0
Melee Hit 7.74% 7.74% 2633
Melee Crit 28.27% 23.26% 10346
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.77% 10.15% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 28.66% 21.66% 4484

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_1h_T14H"
origin="http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=dancing_steel,reforge=hit_crit
off_hand=kilrak_jaws_of_terror,id=87173,enchant=dancing_steel,reforge=hit_crit

# Gear Summary
# gear_strength=16678
# gear_agility=80
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2633
# gear_crit_rating=10346
# gear_haste_rating=784
# gear_mastery_rating=4484
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel

Warrior_Fury_2h_T14H : 120404 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
120403.5 120403.5 78.75 / 0.07% 6655 / 5.5% 12366.0 9.7 9.8 Rage 4.59% 58.9 100.0%
Origin http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://2.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:191801|141548|111395|48350|45105|44672|25964|14755|13802|9226&chds=0,383603&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++191801++execute,C79C6E,0,0,15|t++141548++dragon_roar,C79C6E,1,0,15|t++111395++raging_blow,C79C6E,2,0,15|t++48350++wild_strike,C79C6E,3,0,15|t++45105++bloodthirst,C79C6E,4,0,15|t++44672++colossus_smash,C79C6E,5,0,15|t++25964++impending_victory,C79C6E,6,0,15|t++14755++melee_main_hand,C79C6E,7,0,15|t++13802++heroic_throw,C79C6E,8,0,15|t++9226++melee_off_hand,C79C6E,9,0,15&chtt=Warrior_Fury_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,12,12,12,8,8,8,7,6,5,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|melee_main_hand|bloodthirst|raging_blow_mh|heroic_strike|melee_off_hand|raging_blow_oh|deep_wounds|wild_strike|bloodbath|dragon_roar|colossus_smash|heroic_leap|impending_victory|heroic_throw&chtt=Warrior_Fury_2h_T14H Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:755423211zyywxustpmmkjihggdccbbaabbbbbbcbbbbbaaaaZZZaaaaaaaabccdddeffffffeeeeeddcccbbbbaaaaaZZaaaZZZZYYYZZYYYYYYYZZZZZaaaabbccddeeeeefeeeeeddcddddddddeeeeffffgggggggggfffeeeeeeeeeeedddccccccccccccccccbbbbbbbbbbbbbbbaaaaaaZZZZYYYYYXXYYYZZZaaabbbccccddddddddddddcccccbbbaaaaZZZZZZZZZZZZZZZZZZZZaabccdeefgghiijjkkkkkkkjjjjjiiiiiihhhhhhhhhhhhhhhihihhhhhhhhhhhhhggghhhhiiijjjjjjjjjjkkkkkkkkkkkkkkkkkkkjjjjiiihhhhggggggggggghhhiiijjklllmmmmmnnmmmmmmmmmnnnooppqqrssttuuvvvvvvvvvuuuuuttttsssrrrqqqpppoonnnmmmlllkkkjjjiiijjjjjjjjjjjjjjjjjjjjjiiiiiihhhhhggghgggggff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=120404|max=227016&chxp=1,1,53,100&chtt=Warrior_Fury_2h_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,2,6,7,13,20,20,45,59,77,126,131,169,236,268,309,395,473,504,507,574,557,625,664,598,548,529,470,411,337,279,249,204,138,121,93,81,43,36,20,15,9,10,7,5,3,3,0,1&chds=0,664&chbh=5&chxt=x&chxl=0:|min=105854|avg=120404|max=136497&chxp=0,1,47,100&chtt=Warrior_Fury_2h_T14H DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.5,21.2,15.1,8.6,7.3,3.8,2.9,2.4,1.9,4.6&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 146.2s|raging_blow 95.5s|wild_strike 68.0s|execute 38.7s|colossus_smash 32.7s|heroic_throw 17.1s|impending_victory 13.1s|dragon_roar 10.6s|battle_shout 8.6s|waiting 20.7s&chtt=Warrior_Fury_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T14H 120404
battle_shout 0 0.0% 5.6 73.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.62 5.62 0.00 0.00 1.5364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 12.8 36.73sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.84 12.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 5667 4.7% 8.0 60.32sec 318960 0 0 0 0 0.0% 0.0% 0.0% 0.0% 131.8 19322 0 19322 0.0% 0.0% 29.2%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.98 122.98 131.76 131.76 0.0000 1.0000 2545877.41 2545877.41 0.00 19321.79 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.00 93.51% 0.00 0 0 0.00 0 0 0 0 0.00
none 7.98 6.49% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.8 100.00% 19321.79 539 90629 19362.38 12778 27665 2545877 2545877 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:13108.07
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 14644 12.2% 95.2 4.76sec 69304 45105 41037 86936 69304 61.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.18 95.18 0.00 0.00 1.5365 0.0000 6596419.26 6596419.26 0.00 45104.96 45104.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.56 38.41% 41036.99 27156 68282 41115.06 36341 47667 1500283 1500283 0.00
crit 58.62 61.59% 86935.99 55941 140661 86886.30 79018 93198 5096136 5096136 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 0 0.0% 95.2 4.76sec 0 0 0 0 0 25.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 95.18 95.18 0.00 0.00 0.0000 0.0000 0.00 149108.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.69 74.27% 0.00 0 0 0.00 0 0 0 88077 100.00
crit 24.49 25.73% 0.00 0 0 0.00 0 0 0 61031 100.00
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 3245 2.7% 21.3 21.59sec 68639 44672 50492 106352 68639 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.29 21.29 0.00 0.00 1.5365 0.0000 1461633.73 1461633.73 0.00 44672.32 44672.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.38 67.51% 50491.79 36752 63109 50484.36 40827 56415 725850 725850 0.00
crit 6.92 32.49% 106351.75 75710 130004 106431.98 0 123689 735784 735784 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 7.8 61.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.80 7.80 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 8165 6.8% 95.2 4.76sec 38636 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.7 18358 37830 24565 31.9% 0.0% 99.7%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.18 95.18 149.70 149.70 0.0000 3.0000 3677366.80 3677366.80 0.00 8188.36 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.0 68.12% 18358.34 12251 26509 18363.29 17000 19866 1872227 1872227 0.00
crit 47.7 31.88% 37830.19 24503 53018 37859.23 33617 42306 1805140 1805140 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3344 2.8% 6.9 67.33sec 217485 141548 0 217494 217485 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.5365 0.0000 1504232.01 1504232.01 0.00 141548.13 141548.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 6.92 100.00% 217494.00 144767 315036 217642.31 154437 268124 1504232 1504232 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 16493 13.7% 25.2 3.34sec 294705 191801 208885 455086 294705 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.18 25.18 0.00 0.00 1.5365 0.0000 7420986.29 7420986.29 0.00 191801.36 191801.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.40 65.14% 208885.32 116747 367576 209054.93 158739 265107 3426200 3426200 0.00
crit 8.78 34.86% 455085.56 240500 757206 456471.43 299717 649494 3994787 3994787 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2523 2.1% 10.9 43.15sec 104161 0 75923 161842 104161 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 10.90 0.00 0.00 0.0000 0.0000 1135561.90 1135561.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.32 67.13% 75923.00 50105 109105 75861.12 57071 98894 555635 555635 0.00
crit 3.58 32.87% 161841.60 103217 224756 159759.89 0 224756 579927 579927 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 9737 8.1% 73.3 4.97sec 59839 0 44404 93264 59839 31.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.28 73.28 0.00 0.00 0.0000 0.0000 4385239.03 4385239.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.13 68.40% 44404.17 23317 58864 44387.44 39199 48740 2225936 2225936 0.00
crit 23.15 31.59% 93264.34 48032 121260 93284.79 72362 107449 2159303 2159303 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 523 0.4% 11.1 38.55sec 21206 13802 15766 33118 21207 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.12 0.00 0.00 1.5364 0.0000 235741.88 235741.88 0.00 13802.22 13802.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.63 68.63% 15765.84 10787 25695 15777.74 10969 22024 120284 120284 0.00
crit 3.49 31.36% 33117.62 22221 53862 32617.83 0 52932 115458 115458 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 758 0.6% 8.6 41.65sec 39892 25964 29776 62619 39892 30.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.56 8.56 0.00 0.00 1.5364 0.0000 341375.67 341375.67 0.00 25964.08 25964.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.92 69.20% 29775.67 21613 51473 29753.22 0 47126 176326 176326 0.00
crit 2.64 30.80% 62618.60 44523 106035 59651.21 0 106035 165050 165050 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 8.6 41.65sec 0 0 0 0 0 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 8.56 8.56 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.35 74.24% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 25.76% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 15005 12.5% 168.1 2.67sec 40207 14755 38471 79299 40207 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.06 168.06 0.00 0.00 2.7250 0.0000 6757117.82 6757117.82 0.00 14754.56 14754.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.95 29.13% 38470.96 23731 60618 38479.03 33775 44908 1883284 1883284 0.00
crit 46.75 27.82% 79299.22 48886 124872 79314.34 68156 90717 3707159 3707159 0.00
glance 40.40 24.04% 28875.22 17798 45463 28879.04 23941 33322 1166674 1166674 0.00
miss 31.95 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 9386 7.8% 168.1 2.67sec 25149 9226 24056 49563 25149 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.05 168.05 0.00 0.00 2.7258 0.0000 4226358.12 4226358.12 0.00 9226.08 9226.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.19 29.27% 24056.26 14832 37886 24062.09 20914 27055 1183258 1183258 0.00
crit 46.74 27.81% 49563.19 30554 78045 49574.25 42617 55917 2316579 2316579 0.00
glance 40.27 23.97% 18039.07 11124 28415 18042.58 15811 21118 726522 726522 0.00
miss 31.85 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (23612) 0.0% (19.6%) 62.2 7.16sec 171157 111395 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.17 62.17 0.00 0.00 1.5365 0.0000 0.00 0.00 0.00 111394.69 111394.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 14527 12.1% 62.2 7.16sec 105315 0 77496 162166 105315 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.16 62.16 0.00 0.00 0.0000 0.0000 6546894.73 6546894.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.74 67.14% 77495.55 44816 113454 77514.82 69659 84910 3234664 3234664 0.00
crit 20.42 32.86% 162166.30 92321 233714 162296.37 136404 189460 3312230 3312230 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 9084 7.5% 62.2 7.16sec 65846 0 48429 101378 65846 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.16 62.16 0.00 0.00 0.0000 0.0000 4093303.22 4093303.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.72 67.11% 48428.57 28010 70908 48438.58 43852 52830 2020256 2020256 0.00
crit 20.45 32.89% 101377.96 57700 146071 101468.36 85698 119439 2073047 2073047 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.4 166.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.42 3.42 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 7303 6.1% 57.4 6.11sec 57296 48350 43060 89871 57296 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.42 57.42 0.00 0.00 1.1850 0.0000 3290109.33 3290109.33 0.00 48349.83 48349.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.96 69.58% 43059.76 29242 73783 43069.96 36357 50066 1720479 1720479 0.00
crit 17.47 30.42% 89870.87 60239 151994 89852.27 67382 114230 1569631 1569631 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserker_rage 12.8 0.0 36.5sec 36.6sec 16.99% 16.99%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.0%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 8.0 0.0 60.3sec 60.3sec 20.98% 23.18%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:21.0%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 9.02% 11.23%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:9.0%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 15.1 3.9 28.9sec 22.7sec 30.36% 70.29%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:8.7%
  • bloodsurge_2:4.7%
  • bloodsurge_3:17.0%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 14.0 16.0 32.2sec 14.6sec 55.64% 54.16%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:55.6%
dancing_steel_oh 10.5 5.3 40.5sec 26.1sec 34.74% 34.46%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:34.7%
darkmist_vortex 7.5 0.0 64.2sec 64.2sec 32.42% 32.42%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.4%
deadly_calm 7.8 0.0 61.1sec 61.1sec 8.73% 26.21%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:3.1%
  • deadly_calm_2:3.0%
  • deadly_calm_3:2.6%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 27.7 50.7 16.5sec 5.9sec 80.15% 80.15%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:80.2%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 42.3 26.9 10.6sec 6.4sec 42.34% 46.57%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:20.0%
  • flurry_2:5.3%
  • flurry_3:17.1%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 389.3sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:10.1%
raging_blow 63.0 15.4 7.1sec 5.9sec 37.44% 37.44%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:27.6%
  • raging_blow_2:9.8%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
recklessness 3.4 0.0 160.7sec 166.3sec 13.65% 14.21%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:13.6%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 9.8 0.0 48.2sec 48.2sec 32.06% 32.06%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00
  • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
battle_stance

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_2h_T14H
execute Rage 25.2 755.4 30.0 30.0 9823.5
heroic_strike Rage 73.3 2006.4 27.4 27.4 2185.6
impending_victory Rage 8.6 85.6 10.0 10.0 3989.2
raging_blow Rage 62.2 621.7 10.0 10.0 17115.7
wild_strike Rage 57.4 915.4 15.9 15.9 3594.2
Resource Gains Type Count Total Average Overflow
battle_shout Rage 5.62 112.49 20.00 0.00 0.00%
bloodthirst Rage 95.18 951.79 10.00 0.00 0.00%
enrage Rage 78.38 780.42 9.96 3.39 0.43%
melee_main_hand Rage 136.11 1714.43 12.60 0.52 0.03%
melee_off_hand Rage 136.20 853.30 6.26 4.77 0.56%
Resource RPS-Gain RPS-Loss
Rage 9.79 9.73
Combat End Resource Mean Min Max
Health 492161.00 492161.00 492161.00
Rage 27.71 0.10 96.70
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 172.4 2.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 120403.50
Minimum 105854.47
Maximum 136497.29
Spread ( max - min ) 30642.81
Range [ ( max - min ) / 2 * 100% ] 12.73%
Standard Deviation 4018.0647
5th Percentile 113760.51
95th Percentile 127070.91
( 95th Percentile - 5th Percentile ) 13310.40
Mean Distribution
Standard Deviation 40.1806
95.00% Confidence Intervall ( 120324.75 - 120482.25 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 42
0.1% Error 4278
0.1 Scale Factor Error with Delta=300 137821
0.05 Scale Factor Error with Delta=300 551286
0.01 Scale Factor Error with Delta=300 13782167
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 120403.50

Damage

Sample Data
Count 10000
Mean 54218217.20

DTPS

Sample Data
Count 10000
Mean 0.00

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 442.61
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 1.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.42 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 7.98 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 12.84 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 10.90 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 7.80 deadly_calm,use_off_gcd=1,if=rage>=40
D 73.28 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 95.18 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 14.22 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 30.91 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 21.29 colossus_smash
I 25.18 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 62.17 raging_blow,if=buff.raging_blow.react
L 26.03 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 6.92 dragon_roar,if=talent.dragon_roar.enabled
O 11.12 heroic_throw
P 5.19 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 4.36 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 8.56 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 12.81 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.44 battle_shout,if=rage<70

Sample Sequence

579AEHBCDKGEDKDNEKLFEKLGEDOHDGEDKDREPASEDKTGEKLFEDHBDKDEDKDOEKTEKL9FCDEADKDHFEDNSEKLFEKLGEOHBDEDKDREPAKEDKTEKSGEHDKDGEDGEKOGE9KCDGEDATDKEHBDKEDLNFEKLGEKSGEKHD7EDKDODGEKPEDKTEKTEAHBDKDGEDKDSE9KCDGEDOGEDKLFEHDLGEDNAGEKTGESTELLFEHBDKDGEKOEPTGEATKEKHDED9KDSECDKDGEDKGEKOEHBDLDAFDEDKLFEKLGENSEHDGDERREOPEAKTGETG9EDHBDKDCGEDRSDEDKGELLFEOAHDEDKDREGENTEKSGEHBDRDEDKPEKOEDALK76GED9IICGEHIIIEIIEIGEKIEAHBIIEIKEIIEINGEIHIEIKEAIK9GEICIEIKEHBIIEIKEIKGEIA

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21788 19385 18254
Agility 226 215 80
Stamina 24697 22452 22264
Intellect 121 115 80
Spirit 146 146 80
Health 492161 460731 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2549
Spell Crit 25.79% 20.79% 11866
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 48176 38990 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 30.80% 25.80% 11866
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 11.23% 10.59% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.24% 23.24% 5158

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_2h_T14H"
origin="http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_hit
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_hit
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
off_hand=shinka_execution_of_dominion,id=87176,enchant=dancing_steel

# Gear Summary
# gear_strength=18254
# gear_agility=80
# gear_stamina=22264
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2549
# gear_crit_rating=11866
# gear_haste_rating=784
# gear_mastery_rating=5158
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel
# off_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Healing Target : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active
8485.2 135117.2 Health 0.00% 0.0 100.0%

Charts

http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|&chxp=1,1,-1,100&chtt=Healing%20Target DPS Timeline&chts=dddddd,18

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
divine_aegis 35.7 55.7 12.6sec 4.9sec 63.29% 85.68%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_divine_aegis
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • divine_aegis_1:63.3%

Spelldata details

  • id:47753
  • name:Divine Aegis
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
grace 1.0 271.3 0.0sec 1.6sec 99.60% 99.54%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_grace
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grace_1:0.2%
  • grace_2:0.2%
  • grace_3:99.3%
health_decade_10__20 0.0 0.0 0.0sec 0.0sec 0.84% 0.84%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:0.8%
health_decade_20__30 0.1 0.0 0.0sec 2.0sec 4.83% 4.83%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:4.8%
health_decade_30__40 0.1 0.0 0.0sec 2.2sec 5.70% 5.70%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:5.7%
health_decade_40__50 0.1 0.0 0.0sec 2.0sec 2.95% 2.95%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:2.9%
health_decade_50__60 0.1 0.0 0.0sec 2.0sec 1.12% 1.12%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_50__60
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_50__60_1:1.1%
health_decade_60__70 0.0 0.0 0.0sec 2.0sec 0.27% 0.27%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_60__70
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_60__70_1:0.3%
health_decade_70__80 0.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_70__80
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_70__80_1:0.0%
power_word_shield 31.9 0.0 14.3sec 14.5sec 35.61% 100.00%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_power_word_shield
  • max_stacks:1
  • duration:15.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • power_word_shield_1:35.6%

Spelldata details

  • id:17
  • name:Power Word: Shield
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
  • max_stacks:
  • duration:15.00
  • cooldown:6.00
  • default_chance:0.00%
weakened_soul 31.9 0.0 14.3sec 14.5sec 80.30% 75.48%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_soul
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • weakened_soul_1:80.3%

Spelldata details

  • id:6788
  • name:Weakened Soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • description:The target's soul is weakened by the force of Power Word: Shield, and cannot be shielded again for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
health_decade_90__100

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Healing Target
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 135117.21 8485.22
Combat End Resource Mean Min Max
Health 67068546.81 53710822.73 81750336.01
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 0.00

Damage

Sample Data
Count 10000
Mean 0.00

DTPS

Sample Data
Count 10000
Mean 8455.17

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 135360.92

#Executed Foreground Actions

Sample Data
Count 10000
Mean 0.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 100000000 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% -1.#J% 0
Spell Haste 1.#J% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% -1.#J% 0
Melee Haste 1.#J% 0.00% 0
Swing Speed 1.#J% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 0 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

unknown="Healing Target"
origin="unknown"
level=90
race=humanoid
spec=unknown
role=tank
position=back


# Gear Summary

Simulation & Raid Information

Iterations: 10000
Threads: 8
Confidence: 95.00
Fight Length: 351 - 555 ( 450.6 )

Performance:

Total Events Processed: 1125626719
Max Event Queue: 734
Sim Seconds: 4506019
CPU Seconds: 593.8520
Speed Up: 7588

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
RNG global_deterministic
RNG global_deterministic: Actual ( Confidence Interval ): Roll=nan Range=nan nan

Simulation Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%
Standard Deviation 56.3376
5th Percentile 365.53
95th Percentile 539.38
( 95th Percentile - 5th Percentile ) 173.84
Mean Distribution
Standard Deviation 0.5634
95.00% Confidence Intervall ( 449.50 - 451.71 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 600
0.1% Error 60049
0.1 Scale Factor Error with Delta=300 27
0.05 Scale Factor Error with Delta=300 108
0.01 Scale Factor Error with Delta=300 2709
Distribution Chart
Timeline Distribution Chart Gear Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Ability Id Total Hit Crit Count Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Interval Duration
Death_Knight_Frost_1h_T14H blood_fury 20572 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.49sec 450.60sec
Death_Knight_Frost_1h_T14H blood_plague 55078 1262506 0 0 74.1 0.0% 0.0% 0.0% 0.0% 126.5 9405 18801 6.1% 0.0% 11.31sec 450.60sec
Death_Knight_Frost_1h_T14H death_and_decay 43265 447637 0 0 9.1 6.2% 0.0% 0.0% 0.0% 98.4 4273 8797 6.1% 0.0% 43.57sec 450.60sec
Death_Knight_Frost_1h_T14H empower_rune_weapon 47568 0 0 0 1.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 319.67sec 450.60sec
Death_Knight_Frost_1h_T14H frost_fever 55095 2164908 0 0 138.0 0.0% 0.0% 0.0% 0.0% 136.1 14989 29988 6.1% 0.0% 3.25sec 450.60sec
Death_Knight_Frost_1h_T14H frost_strike 49143 14410652 58608 120898 159.6 50.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.79sec 450.60sec
Death_Knight_Frost_1h_T14H frost_strike_offhand 66196 7206961 29308 60459 159.6 50.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.79sec 450.60sec
Death_Knight_Frost_1h_T14H horn_of_winter 57330 0 0 0 10.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 39.94sec 450.60sec
Death_Knight_Frost_1h_T14H howling_blast 49184 10333154 73618 151708 131.8 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.39sec 450.60sec
Death_Knight_Frost_1h_T14H melee_main_hand 0 3631997 15213 31332 272.6 11.2% 18.3% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.65sec 450.60sec
Death_Knight_Frost_1h_T14H melee_off_hand 0 1815449 7606 15668 272.6 11.2% 18.3% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.65sec 450.60sec
Death_Knight_Frost_1h_T14H obliterate 49020 1932006 46688 95547 31.4 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.91sec 450.60sec
Death_Knight_Frost_1h_T14H obliterate_offhand 66198 965046 23344 47782 31.4 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.91sec 450.60sec
Death_Knight_Frost_1h_T14H outbreak 77575 0 0 0 6.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 78.29sec 450.60sec
Death_Knight_Frost_1h_T14H pillar_of_frost 51271 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.45sec 450.60sec
Death_Knight_Frost_1h_T14H plague_leech 123693 0 0 0 17.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.04sec 450.60sec
Death_Knight_Frost_1h_T14H plague_strike 45462 565312 14895 30685 33.9 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.25sec 450.60sec
Death_Knight_Frost_1h_T14H plague_strike_offhand 66216 282531 7447 15344 33.9 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.25sec 450.60sec
Death_Knight_Frost_1h_T14H raise_dead 46584 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.54sec 450.60sec
Death_Knight_Frost_1h_T14H razorice 50401 311546 663 0 469.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 0.96sec 450.60sec
Death_Knight_Frost_1h_T14H soul_reaper 130735 3182105 15274 31457 22.0 11.1% 0.0% 0.0% 0.0% 21.3 117703 242628 11.1% 0.0% 7.36sec 450.60sec
Death_Knight_Frost_1h_T14H_ghoul claw 91776 676785 7567 15140 80.5 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.87sec 239.34sec
Death_Knight_Frost_1h_T14H_ghoul melee 0 1224206 6081 12159 191.5 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.29sec 239.34sec
Death_Knight_Frost_1h_T14H_army_of_the_dead claw 91776 723866 5428 10854 120.0 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.58sec 35.00sec
Death_Knight_Frost_1h_T14H_army_of_the_dead melee 0 1263843 4355 8707 276.2 11.1% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.99sec 35.00sec
Death_Knight_Frost_2h_T14H blood_fury 20572 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.54sec 450.60sec
Death_Knight_Frost_2h_T14H blood_plague 55078 1487104 0 0 15.5 0.0% 0.0% 0.0% 0.0% 139.9 9712 19414 9.5% 0.0% 30.02sec 450.60sec
Death_Knight_Frost_2h_T14H empower_rune_weapon 47568 0 0 0 1.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 308.73sec 450.60sec
Death_Knight_Frost_2h_T14H frost_fever 55095 2078427 0 0 56.7 0.0% 0.0% 0.0% 0.0% 142.8 13296 26597 9.4% 0.0% 7.92sec 450.60sec
Death_Knight_Frost_2h_T14H frost_strike 49143 13376457 60541 124725 165.2 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.71sec 450.60sec
Death_Knight_Frost_2h_T14H horn_of_winter 57330 0 0 0 15.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 27.26sec 450.60sec
Death_Knight_Frost_2h_T14H howling_blast 49184 3449764 64279 132456 48.8 9.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.09sec 450.60sec
Death_Knight_Frost_2h_T14H melee_main_hand 0 6061396 26997 55617 205.4 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.19sec 450.60sec
Death_Knight_Frost_2h_T14H obliterate 49020 16920666 114418 235123 108.6 34.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.14sec 450.60sec
Death_Knight_Frost_2h_T14H outbreak 77575 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.85sec 450.60sec
Death_Knight_Frost_2h_T14H pillar_of_frost 51271 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.94sec 450.60sec
Death_Knight_Frost_2h_T14H plague_leech 123693 0 0 0 6.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.01sec 450.60sec
Death_Knight_Frost_2h_T14H plague_strike 45462 216858 24903 51268 7.6 14.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 59.09sec 450.60sec
Death_Knight_Frost_2h_T14H raise_dead 46584 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.54sec 450.60sec
Death_Knight_Frost_2h_T14H soul_reaper 130735 3981066 27135 55849 22.5 14.5% 0.0% 0.0% 0.0% 21.8 131124 270022 14.4% 0.6% 7.23sec 450.60sec
Death_Knight_Frost_2h_T14H_ghoul claw 91776 738587 7649 15311 84.4 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.59sec 239.27sec
Death_Knight_Frost_2h_T14H_ghoul melee 0 1333013 6152 12302 199.8 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.20sec 239.27sec
Death_Knight_Frost_2h_T14H_army_of_the_dead claw 91776 795444 5437 10861 127.8 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.49sec 35.00sec
Death_Knight_Frost_2h_T14H_army_of_the_dead melee 0 1370669 4395 8787 287.6 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.95sec 35.00sec
Death_Knight_Unholy_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.58sec 450.60sec
Death_Knight_Unholy_T14H blood_plague 55078 3808688 0 0 7.9 0.0% 0.0% 0.0% 0.0% 142.7 23656 47297 12.9% 0.0% 60.58sec 450.60sec
Death_Knight_Unholy_T14H blood_tap 45529 0 0 0 47.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.26sec 450.60sec
Death_Knight_Unholy_T14H dark_transformation 63560 0 0 0 9.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 49.93sec 450.60sec
Death_Knight_Unholy_T14H death_coil 47541 7375600 54012 111295 120.1 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.72sec 450.60sec
Death_Knight_Unholy_T14H empower_rune_weapon 47568 0 0 0 1.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 308.23sec 450.60sec
Death_Knight_Unholy_T14H festering_strike 85948 2103082 49249 101463 35.9 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.61sec 450.60sec
Death_Knight_Unholy_T14H frost_fever 55095 2579404 0 0 7.9 0.0% 0.0% 0.0% 0.0% 142.7 16018 32040 12.9% 0.0% 60.58sec 450.60sec
Death_Knight_Unholy_T14H horn_of_winter 57330 0 0 0 16.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.46sec 450.60sec
Death_Knight_Unholy_T14H melee_main_hand 0 5883498 25230 51983 206.4 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.18sec 450.60sec
Death_Knight_Unholy_T14H outbreak 77575 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.58sec 450.60sec
Death_Knight_Unholy_T14H plague_leech 123693 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.58sec 450.60sec
Death_Knight_Unholy_T14H scourge_strike 55090 11982531 33633 72488 161.4 9.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.78sec 450.60sec
Death_Knight_Unholy_T14H soul_reaper 130736 5358842 25248 52010 22.6 17.9% 0.0% 0.0% 0.0% 21.9 181089 373222 17.7% 0.6% 7.18sec 450.60sec
Death_Knight_Unholy_T14H summon_gargoyle 49206 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.58sec 450.60sec
Death_Knight_Unholy_T14H unholy_frenzy 49016 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.61sec 450.60sec
Death_Knight_Unholy_T14H_gargoyle gargoyle_strike 51963 1837653 45323 90674 34.4 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.11sec 85.82sec
Death_Knight_Unholy_T14H_ghoul claw 91776 866112 10103 20211 72.7 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.28sec 450.60sec
Death_Knight_Unholy_T14H_ghoul melee 0 4422704 10635 21265 371.7 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.21sec 450.60sec
Death_Knight_Unholy_T14H_ghoul sweeping_claws 91778 2163475 18629 37255 98.5 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.33sec 450.60sec
Death_Knight_Unholy_T14H_army_of_the_dead claw 91776 1132004 5462 10926 175.8 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.71sec 35.00sec
Death_Knight_Unholy_T14H_army_of_the_dead melee 0 1712561 4425 8853 345.9 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.78sec 35.00sec
Druid_Balance_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.01sec 450.60sec
Druid_Balance_T14H moonfire 8921 6062480 15533 32355 27.7 22.6% 0.0% 0.0% 0.0% 320.1 13891 28867 22.5% 0.0% 16.43sec 450.60sec
Druid_Balance_T14H starfall 48505 5721693 0 0 16.5 0.0% 0.0% 0.0% 0.0% 163.2 28152 58660 22.6% 0.0% 29.19sec 450.60sec
Druid_Balance_T14H starfire 2912 13540043 113628 236873 95.6 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.61sec 450.60sec
Druid_Balance_T14H starsurge 78674 8108604 139376 290593 46.9 22.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.50sec 450.60sec
Druid_Balance_T14H sunfire 93402 5919443 15637 32614 27.6 22.6% 0.0% 0.0% 0.0% 315.1 13745 28523 22.6% 0.0% 16.45sec 450.60sec
Druid_Balance_T14H wild_mushroom_detonate 88751 143848 28550 58200 1.0 25.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Druid_Balance_T14H wrath 5176 6686494 54954 113505 98.6 22.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.51sec 450.60sec
Druid_Feral_T14H berserk 106952 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 186.54sec 450.60sec
Druid_Feral_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.44sec 450.60sec
Druid_Feral_T14H cat_melee 0 12239845 16585 34584 531.7 41.2% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.85sec 450.60sec
Druid_Feral_T14H feral_spirit 110807 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 123.43sec 450.60sec
Druid_Feral_T14H ferocious_bite 22568 3844334 102612 219293 21.1 68.2% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.56sec 450.60sec
Druid_Feral_T14H healing_touch 5185 1034791 0 0 44.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.32sec 450.60sec
Druid_Feral_T14H natures_swiftness 132158 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.90sec 450.60sec
Druid_Feral_T14H rake 1822 18344677 61803 129824 52.0 41.1% 0.1% 0.0% 0.0% 149.4 62828 132567 41.3% 0.0% 8.61sec 450.60sec
Druid_Feral_T14H rip 1079 12003735 0 0 11.8 0.0% 0.1% 0.0% 0.0% 210.7 39147 83027 40.6% 0.0% 30.04sec 450.60sec
Druid_Feral_T14H savage_roar 52610 0 0 0 17.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.45sec 450.60sec
Druid_Feral_T14H shred 5221 7250384 45195 94015 110.7 41.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.07sec 450.60sec
Druid_Feral_T14H tigers_fury 5217 0 0 0 14.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.11sec 450.60sec
Druid_Feral_T14H_symbiosis_wolf melee 0 383188 1577 3188 179.5 40.4% 0.1% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 4.38sec 114.42sec
Druid_Feral_T14H_symbiosis_wolf spirit_bite 58859 338471 6217 12609 38.2 41.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.88sec 114.42sec
Hunter_BM_T14H arcane_shot 3044 5730026 33620 69588 129.4 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.43sec 450.60sec
Hunter_BM_T14H bestial_wrath 19574 0 0 0 8.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 56.72sec 450.60sec
Hunter_BM_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.72sec 450.60sec
Hunter_BM_T14H cobra_shot 77767 3026208 20702 42700 111.2 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.85sec 450.60sec
Hunter_BM_T14H dire_beast 120679 0 0 0 15.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.33sec 450.60sec
Hunter_BM_T14H focus_fire 82692 0 0 0 9.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 44.40sec 450.60sec
Hunter_BM_T14H glaive_toss 117050 2934298 38090 78995 29.3 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.52sec 450.60sec
Hunter_BM_T14H kill_command 34026 0 0 0 63.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.03sec 450.60sec
Hunter_BM_T14H kill_shot 53351 1754845 87310 180359 15.3 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.50sec 450.60sec
Hunter_BM_T14H lynx_rush 120697 0 0 0 6.4 0.0% 0.0% 0.0% 0.0% 56.9 0 0 13.1% 0.0% 75.26sec 450.60sec
Hunter_BM_T14H ranged 0 5881857 21005 43437 212.0 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.11sec 450.60sec
Hunter_BM_T14H rapid_fire 3045 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.62sec 450.60sec
Hunter_BM_T14H readiness 23989 0 0 0 1.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 388.69sec 450.60sec
Hunter_BM_T14H serpent_sting 1978 1363401 0 0 3.4 0.0% 0.0% 0.0% 0.0% 147.7 7008 14490 29.7% 0.0% 108.66sec 450.60sec
Hunter_BM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 450.60sec
Hunter_BM_T14H_cat claw 16827 5260521 25512 51432 130.3 57.5% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.47sec 450.60sec
Hunter_BM_T14H_cat kill_command 83381 7551806 83870 170446 63.8 40.0% 0.3% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 7.03sec 450.60sec
Hunter_BM_T14H_cat lynx_rush 120699 2510050 31750 66563 56.9 39.0% 3.7% 0.0% 1.4% 0.0 0 0 0.0% 0.0% 7.28sec 450.60sec
Hunter_BM_T14H_cat melee 0 6635990 15137 31042 321.9 40.1% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.40sec 450.60sec
Hunter_BM_T14H_cat rabid 53401 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 84.63sec 450.60sec
Hunter_BM_T14H_devilsaur claw 16827 191834 10309 20670 13.0 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.58sec 40.00sec
Hunter_BM_T14H_devilsaur melee 0 228082 5448 11439 29.2 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.28sec 40.00sec
Hunter_BM_T14H_devilsaur monstrous_bite 54680 0 0 0 8.0 42.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 45.58sec 40.00sec
Hunter_BM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.79sec 40.00sec
Hunter_BM_T14H_raptor claw 16827 191855 10311 20667 13.0 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.59sec 40.00sec
Hunter_BM_T14H_raptor melee 0 228357 5451 11442 29.3 44.3% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.27sec 40.00sec
Hunter_BM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.79sec 40.00sec
Hunter_BM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.79sec 40.00sec
Hunter_BM_T14H_hyena claw 16827 191719 10310 20666 13.0 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.60sec 40.00sec
Hunter_BM_T14H_hyena melee 0 227908 5446 11445 29.2 44.2% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.27sec 40.00sec
Hunter_BM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.79sec 40.00sec
Hunter_BM_T14H_wolf claw 16827 191716 10327 20625 13.0 43.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.60sec 40.00sec
Hunter_BM_T14H_wolf melee 0 228082 5448 11435 29.2 44.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.29sec 40.00sec
Hunter_BM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.79sec 40.00sec
Hunter_BM_T14H_dire_beast dire_beast_melee 0 3536064 19951 40541 141.4 30.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.10sec 209.40sec
Hunter_MM_T14H aimed_shot 19434 2417231 68917 150365 21.8 51.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.31sec 450.60sec
Hunter_MM_T14H aimed_shot_mm 82928 2005855 69523 144146 21.1 34.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 20.43sec 450.60sec
Hunter_MM_T14H arcane_shot 3044 4231020 31849 65790 98.3 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.89sec 450.60sec
Hunter_MM_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.68sec 450.60sec
Hunter_MM_T14H chimera_shot 53209 4356103 73995 152903 43.8 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.75sec 450.60sec
Hunter_MM_T14H dire_beast 120679 0 0 0 15.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.15sec 450.60sec
Hunter_MM_T14H glaive_toss 117050 2999241 36972 76765 30.0 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.21sec 450.60sec
Hunter_MM_T14H kill_shot 53351 1624875 84282 174416 14.4 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.86sec 450.60sec
Hunter_MM_T14H lynx_rush 120697 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 61.4 0 0 16.0% 0.0% 70.26sec 450.60sec
Hunter_MM_T14H piercing_shots 63468 1779824 0 0 81.5 0.0% 0.0% 0.0% 0.0% 344.1 5173 0 0.0% 0.0% 5.38sec 450.60sec
Hunter_MM_T14H ranged 0 5859191 20343 42090 213.1 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.10sec 450.60sec
Hunter_MM_T14H rapid_fire 3045 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.76sec 450.60sec
Hunter_MM_T14H readiness 23989 0 0 0 1.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 401.71sec 450.60sec
Hunter_MM_T14H serpent_sting 1978 1292478 0 0 1.2 0.0% 0.0% 0.0% 0.0% 140.6 6818 14126 32.5% 0.0% 210.01sec 450.60sec
Hunter_MM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.13sec 450.60sec
Hunter_MM_T14H steady_shot 56641 2022786 10559 22044 138.7 35.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.16sec 450.60sec
Hunter_MM_T14H wild_quiver_shot 76663 3977774 15794 31740 189.5 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.35sec 450.60sec
Hunter_MM_T14H_cat claw 16827 2589934 13956 28520 128.4 42.9% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.52sec 450.60sec
Hunter_MM_T14H_cat lynx_rush 120699 2088498 23958 49822 61.4 42.3% 3.8% 0.0% 1.3% 0.0 0 0 0.0% 0.0% 6.88sec 450.60sec
Hunter_MM_T14H_cat melee 0 4392699 10085 20640 313.1 43.1% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.44sec 450.60sec
Hunter_MM_T14H_cat rabid 53401 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.68sec 450.60sec
Hunter_MM_T14H_devilsaur claw 16827 148770 7017 14874 14.0 46.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.71sec 40.00sec
Hunter_MM_T14H_devilsaur melee 0 162318 3696 7762 30.0 47.1% 0.0% 24.2% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 45.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.84sec 40.00sec
Hunter_MM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 40.00sec
Hunter_MM_T14H_raptor claw 16827 148939 7012 14882 14.0 46.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.70sec 40.00sec
Hunter_MM_T14H_raptor melee 0 162652 3696 7765 30.0 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 40.00sec
Hunter_MM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 40.00sec
Hunter_MM_T14H_hyena claw 16827 149006 7015 14873 14.0 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.70sec 40.00sec
Hunter_MM_T14H_hyena melee 0 162736 3694 7763 30.0 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 40.00sec
Hunter_MM_T14H_wolf claw 16827 148868 7018 14870 14.0 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.70sec 40.00sec
Hunter_MM_T14H_wolf melee 0 162532 3695 7763 30.0 47.3% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 40.00sec
Hunter_MM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.16sec 40.00sec
Hunter_MM_T14H_dire_beast dire_beast_melee 0 2915126 13842 28382 161.6 34.4% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 217.70sec
Hunter_SV_T14H arcane_shot 3044 4281949 37075 76755 85.5 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.10sec 450.60sec
Hunter_SV_T14H black_arrow 3674 3575771 0 0 18.0 0.0% 0.0% 0.0% 0.0% 178.0 14794 30811 33.0% 0.0% 24.98sec 450.60sec
Hunter_SV_T14H blood_fury 20572 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.72sec 450.60sec
Hunter_SV_T14H cobra_shot 77767 2704323 23765 49108 84.9 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.06sec 450.60sec
Hunter_SV_T14H dire_beast 120679 0 0 0 15.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.67sec 450.60sec
Hunter_SV_T14H explosive_shot 53301 9698913 18542 38628 130.3 33.0% 0.0% 0.0% 0.0% 222.8 21559 43583 33.0% 0.0% 3.42sec 450.60sec
Hunter_SV_T14H glaive_toss 117050 2979515 36938 76841 29.9 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.24sec 450.60sec
Hunter_SV_T14H kill_shot 53351 1567817 84268 174341 13.9 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.07sec 450.60sec
Hunter_SV_T14H lynx_rush 120697 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 63.1 0 0 16.2% 0.0% 67.67sec 450.60sec
Hunter_SV_T14H ranged 0 5562498 20395 42273 201.2 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.23sec 450.60sec
Hunter_SV_T14H rapid_fire 3045 0 0 0 4.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 102.30sec 450.60sec
Hunter_SV_T14H readiness 23989 0 0 0 1.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 381.94sec 450.60sec
Hunter_SV_T14H serpent_sting 1978 3190534 0 0 2.1 0.0% 0.0% 0.0% 0.0% 147.7 15971 33164 32.8% 0.0% 112.98sec 450.60sec
Hunter_SV_T14H serpent_sting_burst 0 105632 35144 72654 2.1 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 112.98sec 450.60sec
Hunter_SV_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.24sec 450.60sec
Hunter_SV_T14H_cat claw 16827 2155045 13684 28021 108.7 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 4.17sec 450.60sec
Hunter_SV_T14H_cat lynx_rush 120699 2161809 24068 50089 63.1 42.6% 3.8% 0.0% 1.3% 0.0 0 0 0.0% 0.0% 6.65sec 450.60sec
Hunter_SV_T14H_cat melee 0 4387092 10080 20627 313.1 43.0% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.44sec 450.60sec
Hunter_SV_T14H_cat rabid 53401 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.53sec 450.60sec
Hunter_SV_T14H_devilsaur claw 16827 134204 6798 14412 13.0 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.73sec 40.00sec
Hunter_SV_T14H_devilsaur melee 0 159093 3625 7581 30.0 47.5% 0.0% 24.2% 0.0% 0.0 0 0 0.0% 0.0% 11.05sec 40.00sec
Hunter_SV_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 45.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.78sec 40.00sec
Hunter_SV_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.28sec 40.00sec
Hunter_SV_T14H_raptor claw 16827 134290 6808 14387 13.0 46.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.73sec 40.00sec
Hunter_SV_T14H_raptor melee 0 158986 3623 7581 30.0 47.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.05sec 40.00sec
Hunter_SV_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.28sec 40.00sec
Hunter_SV_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.28sec 40.00sec
Hunter_SV_T14H_hyena claw 16827 134129 6815 14372 13.0 46.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.73sec 40.00sec
Hunter_SV_T14H_hyena melee 0 159092 3625 7578 30.0 47.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.05sec 40.00sec
Hunter_SV_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.28sec 40.00sec
Hunter_SV_T14H_wolf claw 16827 134327 6804 14397 13.0 46.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.73sec 40.00sec
Hunter_SV_T14H_wolf melee 0 158974 3623 7583 30.0 47.4% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.05sec 40.00sec
Hunter_SV_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.28sec 40.00sec
Hunter_SV_T14H_dire_beast dire_beast_melee 0 2846812 13825 28234 158.1 34.6% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.80sec 209.03sec
Mage_Arcane_T14H alter_time_activate 108978 0 0 0 2.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 195.42sec 450.60sec
Mage_Arcane_T14H arcane_barrage 44425 6988684 188506 394254 31.7 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.19sec 450.60sec
Mage_Arcane_T14H arcane_blast 30451 21877219 124650 260834 150.0 15.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.99sec 450.60sec
Mage_Arcane_T14H arcane_missiles 5143 19221687 0 0 69.4 0.0% 0.0% 0.0% 0.0% 346.4 47607 99744 15.6% 0.1% 6.38sec 450.60sec
Mage_Arcane_T14H arcane_power 12042 0 0 0 5.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 94.37sec 450.60sec
Mage_Arcane_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 188.47sec 450.60sec
Mage_Arcane_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.15sec 450.60sec
Mage_Arcane_T14H nether_tempest 114923 7916721 0 0 35.1 0.0% 0.1% 0.0% 0.0% 535.2 12650 26373 15.6% 0.0% 13.00sec 450.60sec
Mage_Arcane_T14H presence_of_mind 12043 0 0 0 5.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.10sec 450.60sec
Mage_Arcane_T14H rune_of_power 116011 0 0 0 7.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.81sec 450.60sec
Mage_Arcane_T14H_mirror_image arcane_blast 88084 968888 5637 11470 147.1 16.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.68sec 86.63sec
Mage_Fire_T14H alter_time_activate 108978 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 187.34sec 450.60sec
Mage_Fire_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 187.87sec 450.60sec
Mage_Fire_T14H combustion 11129 8075734 46484 96472 12.1 29.1% 0.0% 0.0% 0.0% 163.8 33978 70827 29.3% 0.0% 37.62sec 450.60sec
Mage_Fire_T14H evocation 12051 0 0 0 10.1 0.0% 0.0% 0.0% 0.0% 40.0 0 0 28.7% 0.0% 46.76sec 450.60sec
Mage_Fire_T14H fireball 133 17439740 76675 159154 155.2 43.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.88sec 450.60sec
Mage_Fire_T14H ignite 12654 7416047 0 0 229.6 0.0% 0.0% 0.0% 0.0% 214.8 34530 0 0.0% 0.0% 1.94sec 450.60sec
Mage_Fire_T14H inferno_blast 108853 1632693 0 63811 25.6 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.56sec 450.60sec
Mage_Fire_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.48sec 450.60sec
Mage_Fire_T14H nether_tempest 114923 5358820 0 0 32.4 0.0% 0.0% 0.0% 0.0% 499.3 8181 16948 29.1% 0.0% 14.01sec 450.60sec
Mage_Fire_T14H presence_of_mind 12043 0 0 0 5.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 94.16sec 450.60sec
Mage_Fire_T14H pyroblast 11366 17506295 150729 313115 49.6 43.8% 0.0% 0.0% 0.0% 180.4 24637 51173 43.7% 0.0% 8.91sec 450.60sec
Mage_Fire_T14H_mirror_image fireball 88082 1160621 6008 12112 148.6 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.66sec 86.46sec
Mage_Frost_T14H alter_time_activate 108978 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 184.70sec 450.60sec
Mage_Frost_T14H blood_fury 33702 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 129.80sec 450.60sec
Mage_Frost_T14H evocation 12051 0 0 0 10.1 0.0% 0.0% 0.0% 0.0% 40.2 0 0 18.3% 0.0% 46.57sec 450.60sec
Mage_Frost_T14H frost_bomb 112948 6798929 0 0 48.7 0.0% 0.0% 0.0% 0.0% 48.3 117046 243199 18.7% 0.0% 9.25sec 450.60sec
Mage_Frost_T14H frostbolt 116 10827894 61925 127112 146.4 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.03sec 450.60sec
Mage_Frost_T14H frostfire_bolt 44614 7163679 76062 154547 49.6 87.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.90sec 450.60sec
Mage_Frost_T14H frozen_orb 84714 2291411 0 0 7.6 0.0% 0.0% 0.0% 0.0% 75.6 25152 52305 18.9% 0.0% 62.39sec 450.60sec
Mage_Frost_T14H ice_lance 30455 8706756 77514 157531 59.1 87.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.42sec 450.60sec
Mage_Frost_T14H icy_veins 12472 0 0 0 5.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.83sec 450.60sec
Mage_Frost_T14H mini_frostbolt 131079 3214891 33940 70653 0.0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Mage_Frost_T14H mini_frostfire_bolt 131081 3079464 43777 94394 0.0 88.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Mage_Frost_T14H mini_ice_lance 131080 3465851 40028 86661 0.0 88.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Mage_Frost_T14H mirror_image 55342 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 183.10sec 450.60sec
Mage_Frost_T14H presence_of_mind 12043 0 0 0 5.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 90.79sec 450.60sec
Mage_Frost_T14H_water_elemental freeze 33395 44324 2172 4356 17.2 18.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.78sec 450.60sec
Mage_Frost_T14H_water_elemental mini_waterbolt 131581 2328729 14501 29387 0.0 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Mage_Frost_T14H_water_elemental waterbolt 31707 7531209 25977 51771 245.5 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.83sec 450.60sec
Mage_Frost_T14H_mirror_image fire_blast 59637 161207 3157 6384 42.6 19.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.36sec 84.86sec
Mage_Frost_T14H_mirror_image frostbolt 59638 912154 3928 7941 194.3 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.89sec 84.86sec
Monk_Windwalker_1h_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.70sec 450.60sec
Monk_Windwalker_1h_T14H blackout_kick 100784 10448118 65195 135138 112.5 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.94sec 450.60sec
Monk_Windwalker_1h_T14H blackout_kick_dot 128531 1558465 0 0 112.4 0.0% 0.0% 0.0% 0.0% 340.1 4583 0 0.0% 0.0% 3.94sec 450.60sec
Monk_Windwalker_1h_T14H energizing_brew 115288 0 0 0 7.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 62.22sec 450.60sec
Monk_Windwalker_1h_T14H fists_of_fury 113656 5307881 0 0 15.4 0.0% 0.0% 0.0% 0.0% 61.5 60804 125711 39.3% 0.0% 26.11sec 450.60sec
Monk_Windwalker_1h_T14H invoke_xuen 123904 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.74sec 450.60sec
Monk_Windwalker_1h_T14H jab 100780 2851581 13729 28461 145.7 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.09sec 450.60sec
Monk_Windwalker_1h_T14H melee_main_hand 0 8947551 33703 70676 223.5 39.7% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.01sec 450.60sec
Monk_Windwalker_1h_T14H melee_off_hand 0 5239785 19579 41130 224.9 39.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.00sec 450.60sec
Monk_Windwalker_1h_T14H rising_sun_kick 107428 8137226 117029 242370 48.8 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.28sec 450.60sec
Monk_Windwalker_1h_T14H tiger_palm 100787 1774970 27463 56911 45.2 40.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.97sec 450.60sec
Monk_Windwalker_1h_T14H tiger_strikes_melee 0 4181855 26929 56017 108.6 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.11sec 450.60sec
Monk_Windwalker_1h_T14H tigereye_brew_use 116740 0 0 0 7.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 58.80sec 450.60sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger crackling_tiger_lightning 123996 2200046 0 0 22.8 0.0% 0.0% 0.0% 0.0% 113.4 13608 27778 40.9% 0.0% 18.84sec 128.09sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger melee 0 905101 3286 6703 200.3 41.6% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.00sec 128.09sec
Paladin_Retribution_T14H ancient_fury 86704 224390 92123 190446 2.0 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.91sec 450.60sec
Paladin_Retribution_T14H avenging_wrath 31884 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.67sec 450.60sec
Paladin_Retribution_T14H censure 31803 4707600 0 0 326.4 0.0% 0.0% 0.0% 0.0% 200.2 19060 39456 21.8% 0.0% 1.38sec 450.60sec
Paladin_Retribution_T14H crusader_strike 35395 3193310 31519 64967 82.3 21.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.48sec 450.60sec
Paladin_Retribution_T14H execution_sentence 114157 2598373 0 0 7.8 0.0% 0.0% 0.0% 0.0% 77.0 27740 57034 20.5% 0.0% 61.08sec 450.60sec
Paladin_Retribution_T14H exorcism 879 3851001 62088 128732 51.1 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.85sec 450.60sec
Paladin_Retribution_T14H guardian_of_ancient_kings 86698 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.91sec 450.60sec
Paladin_Retribution_T14H hammer_of_wrath 24275 7354505 83208 171182 71.7 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.26sec 450.60sec
Paladin_Retribution_T14H hand_of_light 0 10268788 46099 0 222.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.02sec 450.60sec
Paladin_Retribution_T14H inquisition 84963 0 0 0 15.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.40sec 450.60sec
Paladin_Retribution_T14H judgment 20271 2969471 47972 99342 50.3 21.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.88sec 450.60sec
Paladin_Retribution_T14H melee 0 5466760 26614 54890 175.3 21.8% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.56sec 450.60sec
Paladin_Retribution_T14H seal_of_truth_proc 31801 2448767 6086 12572 326.4 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.38sec 450.60sec
Paladin_Retribution_T14H templars_verdict 85256 7012691 82598 170086 68.8 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.43sec 450.60sec
Paladin_Retribution_T14H_guardian_of_ancient_kings melee 0 2167068 47523 0 48.5 0.0% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 6.95sec 60.00sec
Priest_Disc_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.05sec 450.60sec
Priest_Disc_T14H divine_aegis 0 0 33850 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Priest_Disc_T14H greater_heal 2060 14595220 137775 275354 78.5 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.66sec 450.60sec
Priest_Disc_T14H greater_heal_divine_aegis 47753 3507739 0 0 27.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 16.33sec 450.60sec
Priest_Disc_T14H inner_focus 89485 0 0 0 15.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.73sec 450.60sec
Priest_Disc_T14H mindbender 123040 0 0 0 7.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.58sec 450.60sec
Priest_Disc_T14H penance_heal 47540 9117249 0 0 64.8 0.0% 0.0% 0.0% 0.0% 194.0 39755 79545 18.4% 0.0% 6.99sec 450.60sec
Priest_Disc_T14H penance_heal_tick_divine_aegis 47753 1314400 0 0 35.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.38sec 450.60sec
Priest_Disc_T14H power_word_shield 17 4247159 33316 0 31.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.48sec 450.60sec
Priest_Disc_T14H power_word_shield_glyph 55672 1005401 26656 53326 31.9 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.48sec 450.60sec
Priest_Disc_T14H power_word_shield_glyph_divine_aegis 47753 144840 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.34sec 450.60sec
Priest_Disc_T14H renew 139 3141866 0 0 30.0 0.0% 0.0% 0.0% 0.0% 122.4 21664 43342 18.4% 0.0% 15.01sec 450.60sec
Priest_Disc_T14H renew_divine_aegis 47753 454435 0 0 22.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.94sec 450.60sec
Priest_Disc_T14H_mindbender melee 0 2419801 29944 59926 85.5 15.5% 15.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.56sec 105.54sec
Priest_Disc_T14H_mindbender shadowcrawl 63619 0 0 0 21.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.02sec 105.54sec
Priest_Holy_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.06sec 450.60sec
Priest_Holy_T14H chakra 81208 0 0 0 14.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.24sec 450.60sec
Priest_Holy_T14H echo_of_light 77489 5119435 0 0 246.9 0.0% 0.0% 0.0% 0.0% 443.6 11541 0 0.0% 0.0% 1.82sec 450.60sec
Priest_Holy_T14H flash_heal 2061 3391628 79365 158768 28.7 48.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.25sec 450.60sec
Priest_Holy_T14H greater_heal 2060 4475645 105618 211230 29.1 45.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.58sec 450.60sec
Priest_Holy_T14H heal 2050 10677289 49520 99060 149.9 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.99sec 450.60sec
Priest_Holy_T14H holy_word_serenity 88684 3302784 62764 125557 39.4 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.55sec 450.60sec
Priest_Holy_T14H renew 139 5022770 0 0 2.0 0.0% 0.0% 0.0% 0.0% 182.6 19146 38303 43.7% 0.0% 1.#Rsec 450.60sec
Priest_Holy_T14H shadowfiend 34433 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.11sec 450.60sec
Priest_Holy_T14H_shadowfiend melee 0 1160542 44406 88857 27.7 15.3% 15.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 12.35sec 32.77sec
Priest_Holy_T14H_shadowfiend shadowcrawl 63619 0 0 0 5.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.52sec 32.77sec
Priest_Shadow_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.93sec 450.60sec
Priest_Shadow_T14H devouring_plague 2944 2804257 125076 259225 18.8 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.08sec 450.60sec
Priest_Shadow_T14H devouring_plague_mastery 124467 1218251 20829 43219 49.0 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.15sec 450.60sec
Priest_Shadow_T14H devouring_plague_tick 2944 3884494 0 0 18.8 0.0% 0.0% 0.0% 0.0% 156.9 20709 42900 18.3% 0.0% 25.08sec 450.60sec
Priest_Shadow_T14H halo_damage 120644 1623555 123910 257527 11.0 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.53sec 450.60sec
Priest_Shadow_T14H mind_blast 8092 5508512 98845 204861 46.6 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.73sec 450.60sec
Priest_Shadow_T14H mind_flay 15407 9743550 0 0 138.8 0.0% 0.0% 0.0% 0.0% 312.7 26043 54007 18.3% 0.0% 3.20sec 450.60sec
Priest_Shadow_T14H mind_flay_mastery 124468 3039187 25992 53864 97.8 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.50sec 450.60sec
Priest_Shadow_T14H mind_spike 73510 4627168 99618 206461 38.9 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.17sec 450.60sec
Priest_Shadow_T14H shadow_word_death 32379 2023130 109914 227937 15.3 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.51sec 450.60sec
Priest_Shadow_T14H shadow_word_pain 589 4495559 0 0 21.6 0.0% 0.0% 0.0% 0.0% 224.7 15361 31792 28.2% 0.0% 21.22sec 450.60sec
Priest_Shadow_T14H shadow_word_pain_mastery 124464 1404342 15372 31789 70.3 28.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.34sec 450.60sec
Priest_Shadow_T14H shadowfiend 34433 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.72sec 450.60sec
Priest_Shadow_T14H shadowy_apparition 87532 1691521 19158 38580 75.8 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.87sec 450.60sec
Priest_Shadow_T14H vampiric_touch 34914 4083697 0 0 23.7 0.0% 0.0% 0.0% 0.0% 198.7 17191 35631 18.3% 0.0% 19.21sec 450.60sec
Priest_Shadow_T14H vampiric_touch_mastery 124465 1278155 17234 35742 62.1 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.11sec 450.60sec
Priest_Shadow_T14H_shadowfiend melee 0 2380691 52608 106481 39.6 19.8% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 9.35sec 34.79sec
Priest_Shadow_T14H_shadowfiend shadowcrawl 63619 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 74.02sec 34.79sec
Rogue_Assassination_T14H ambush 8676 425358 60242 126738 5.2 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.31sec 450.60sec
Rogue_Assassination_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.54sec 450.60sec
Rogue_Assassination_T14H deadly_poison_dot 2818 6162512 0 0 561.5 0.0% 0.0% 0.0% 0.0% 149.6 29944 63557 33.5% 0.0% 1.03sec 450.60sec
Rogue_Assassination_T14H deadly_poison_instant 113780 12013995 15521 33064 560.5 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.03sec 450.60sec
Rogue_Assassination_T14H dispatch 111240 6177305 51366 107576 88.1 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.03sec 450.60sec
Rogue_Assassination_T14H envenom 32645 4916436 72251 154477 49.1 33.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.07sec 450.60sec
Rogue_Assassination_T14H melee_main_hand 0 4971604 12382 26357 357.3 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.26sec 450.60sec
Rogue_Assassination_T14H melee_off_hand 0 2491932 6212 13233 357.1 32.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.26sec 450.60sec
Rogue_Assassination_T14H mutilate 1329 0 0 0 69.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.22sec 450.60sec
Rogue_Assassination_T14H mutilate_mh 5374 2438341 25448 54043 69.5 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.22sec 450.60sec
Rogue_Assassination_T14H mutilate_oh 27576 1239166 12932 27465 69.5 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.22sec 450.60sec
Rogue_Assassination_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.87sec 450.60sec
Rogue_Assassination_T14H rupture 1943 1470989 0 0 23.8 0.0% 0.0% 0.0% 0.0% 222.4 4794 10154 33.9% 0.0% 19.21sec 450.60sec
Rogue_Assassination_T14H shadow_blade 121473 2075811 21068 44134 69.7 37.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.37sec 450.60sec
Rogue_Assassination_T14H shadow_blade_offhand 121474 1033067 10550 22062 69.4 37.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.39sec 450.60sec
Rogue_Assassination_T14H shadow_blades 121471 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.75sec 450.60sec
Rogue_Assassination_T14H slice_and_dice 5171 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Rogue_Assassination_T14H tricks_of_the_trade 57934 0 0 0 14.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.12sec 450.60sec
Rogue_Assassination_T14H vanish 1856 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.31sec 450.60sec
Rogue_Assassination_T14H vendetta 79140 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.50sec 450.60sec
Rogue_Assassination_T14H venomous_wound 79136 6263367 27303 57930 166.8 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.68sec 450.60sec
Rogue_Combat_T14H adrenaline_rush 13750 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 90.40sec 450.60sec
Rogue_Combat_T14H ambush 8676 466134 62569 130230 5.3 38.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.57sec 450.60sec
Rogue_Combat_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.46sec 450.60sec
Rogue_Combat_T14H deadly_poison_dot 2818 4049098 0 0 360.5 0.0% 0.0% 0.0% 0.0% 149.4 20010 41970 32.3% 0.0% 1.34sec 450.60sec
Rogue_Combat_T14H deadly_poison_instant 113780 5207812 10642 22454 359.5 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.34sec 450.60sec
Rogue_Combat_T14H eviscerate 2098 4425110 89517 186381 36.8 31.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.96sec 450.60sec
Rogue_Combat_T14H killing_spree 51690 0 0 0 7.5 0.0% 0.0% 0.0% 0.0% 52.3 0 0 33.4% 0.0% 63.40sec 450.60sec
Rogue_Combat_T14H killing_spree_mh 0 1981693 0 0 52.3 0.0% 0.0% 0.0% 0.0% 0.0 27502 57891 34.3% 0.0% 8.07sec 450.60sec
Rogue_Combat_T14H killing_spree_oh 0 1201415 0 0 52.3 0.0% 0.0% 0.0% 0.0% 0.0 16668 35070 34.3% 0.0% 8.07sec 450.60sec
Rogue_Combat_T14H main_gauche 86392 6204742 23430 48992 195.4 32.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.31sec 450.60sec
Rogue_Combat_T14H melee_main_hand 0 5496791 19378 40867 254.4 32.6% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.77sec 450.60sec
Rogue_Combat_T14H melee_off_hand 0 4805752 11715 24711 367.9 32.6% 18.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.22sec 450.60sec
Rogue_Combat_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.39sec 450.60sec
Rogue_Combat_T14H revealing_strike 84617 836622 24334 50517 25.5 32.4% 0.0% 0.0% 0.0% 148.8 0 0 32.5% 0.0% 17.95sec 450.60sec
Rogue_Combat_T14H rupture 1943 1509779 0 0 11.0 0.0% 0.0% 0.0% 0.0% 130.7 8604 17872 31.8% 0.0% 39.84sec 450.60sec
Rogue_Combat_T14H shadow_blade 121473 2873037 29829 61687 72.2 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.53sec 450.60sec
Rogue_Combat_T14H shadow_blade_offhand 121474 2518433 18080 37386 104.3 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.82sec 450.60sec
Rogue_Combat_T14H shadow_blades 121471 0 0 0 5.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 92.87sec 450.60sec
Rogue_Combat_T14H sinister_strike 1752 7973102 31090 64716 190.1 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.36sec 450.60sec
Rogue_Combat_T14H slice_and_dice 5171 0 0 0 15.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.15sec 450.60sec
Rogue_Combat_T14H tricks_of_the_trade 57934 0 0 0 15.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.76sec 450.60sec
Rogue_Combat_T14H vanish 1856 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.57sec 450.60sec
Rogue_Subtlety_T14H ambush 8676 4664032 82404 174359 37.7 44.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.71sec 450.60sec
Rogue_Subtlety_T14H backstab 53 8300435 46863 98783 126.5 36.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.54sec 450.60sec
Rogue_Subtlety_T14H berserking 26297 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.20sec 450.60sec
Rogue_Subtlety_T14H deadly_poison_dot 2818 4341540 0 0 321.5 0.0% 0.0% 0.0% 0.0% 149.5 20416 43095 38.0% 0.0% 1.54sec 450.60sec
Rogue_Subtlety_T14H deadly_poison_instant 113780 4829854 10537 22325 320.5 38.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.54sec 450.60sec
Rogue_Subtlety_T14H eviscerate 2098 11021433 118961 258515 63.2 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.09sec 450.60sec
Rogue_Subtlety_T14H hemorrhage 16511 1551797 30074 63176 19.9 37.9% 0.0% 0.0% 0.0% 146.7 3388 7169 37.6% 0.0% 23.22sec 450.60sec
Rogue_Subtlety_T14H melee_main_hand 0 7523184 14698 31642 433.6 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.98sec 450.60sec
Rogue_Subtlety_T14H melee_off_hand 0 3783170 7373 15876 434.1 37.0% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.98sec 450.60sec
Rogue_Subtlety_T14H premeditation 14183 0 0 0 10.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 47.43sec 450.60sec
Rogue_Subtlety_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.49sec 450.60sec
Rogue_Subtlety_T14H rupture 1943 3867561 0 0 20.1 0.0% 0.0% 0.0% 0.0% 220.6 12381 25974 37.9% 0.0% 22.84sec 450.60sec
Rogue_Subtlety_T14H shadow_blade 121473 2988796 21649 45844 92.3 44.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.21sec 450.60sec
Rogue_Subtlety_T14H shadow_blade_offhand 121474 1487135 10874 23020 91.3 44.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.24sec 450.60sec
Rogue_Subtlety_T14H shadow_blades 121471 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.51sec 450.60sec
Rogue_Subtlety_T14H shadow_dance 51713 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.39sec 450.60sec
Rogue_Subtlety_T14H slice_and_dice 5171 0 0 0 13.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.03sec 450.60sec
Rogue_Subtlety_T14H tricks_of_the_trade 57934 0 0 0 14.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.39sec 450.60sec
Rogue_Subtlety_T14H vanish 1856 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.24sec 450.60sec
Shaman_Elemental_T14H ascendance 114049 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.47sec 450.60sec
Shaman_Elemental_T14H blood_fury 33697 0 0 0 4.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.12sec 450.60sec
Shaman_Elemental_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.83sec 450.60sec
Shaman_Elemental_T14H earth_shock 8042 1154499 26755 69621 33.5 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.55sec 450.60sec
Shaman_Elemental_T14H earth_shock_eoe 0 66970 25969 67478 2.0 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 108.30sec 450.60sec
Shaman_Elemental_T14H elemental_blast 117014 3697789 96391 250845 29.6 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.29sec 450.60sec
Shaman_Elemental_T14H elemental_blast_eoe 0 219659 96666 252367 1.8 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 113.36sec 450.60sec
Shaman_Elemental_T14H elemental_blast_overload 120588 1341254 72570 188800 14.3 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.33sec 450.60sec
Shaman_Elemental_T14H elemental_blast_overload_eoe 0 80311 72400 188607 0.9 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 140.22sec 450.60sec
Shaman_Elemental_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Shaman_Elemental_T14H flame_shock 8050 2402673 14781 38451 15.3 17.5% 0.0% 0.0% 0.0% 191.1 8639 22447 17.6% 0.0% 30.44sec 450.60sec
Shaman_Elemental_T14H flame_shock_eoe 0 16595 14355 37396 0.9 16.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 153.88sec 450.60sec
Shaman_Elemental_T14H fulmination 26364 4166349 96313 250616 33.5 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.55sec 450.60sec
Shaman_Elemental_T14H lava_burst 51505 12828187 0 145695 88.2 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.08sec 450.60sec
Shaman_Elemental_T14H lava_burst_eoe 0 756578 51244 143859 5.3 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 70.56sec 450.60sec
Shaman_Elemental_T14H lava_burst_overload 77451 4639093 38502 108324 43.0 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.35sec 450.60sec
Shaman_Elemental_T14H lava_burst_overload_eoe 0 284329 41083 111147 2.6 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 107.51sec 450.60sec
Shaman_Elemental_T14H lightning_bolt 403 8824439 47873 124564 144.0 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.96sec 450.60sec
Shaman_Elemental_T14H lightning_bolt_eoe 0 512822 46542 121108 8.6 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.92sec 450.60sec
Shaman_Elemental_T14H lightning_bolt_overload 45284 2833847 33265 86519 66.8 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.33sec 450.60sec
Shaman_Elemental_T14H lightning_bolt_overload_eoe 0 167424 33296 86579 4.0 17.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 76.35sec 450.60sec
Shaman_Elemental_T14H searing_totem 3599 0 0 0 5.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.62sec 450.60sec
Shaman_Elemental_T14H_greater_fire_elemental fire_blast 57984 172979 6797 17167 20.0 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.76sec 119.91sec
Shaman_Elemental_T14H_greater_fire_elemental fire_melee 0 2310562 17074 43206 111.0 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.24sec 119.91sec
Shaman_Elemental_T14H_greater_earth_elemental earth_melee 0 496551 5767 11584 77.1 17.5% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 4.67sec 118.08sec
Shaman_Elemental_T14H_searing_totem searing_bolt 3606 1145145 4715 12260 190.6 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.02sec 309.70sec
Shaman_Enhancement_T14H ascendance 114049 0 0 0 2.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 182.64sec 450.60sec
Shaman_Enhancement_T14H blood_fury 33697 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.71sec 450.60sec
Shaman_Enhancement_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.18sec 450.60sec
Shaman_Enhancement_T14H earth_shock 8042 2247377 32201 66746 43.8 55.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.15sec 450.60sec
Shaman_Enhancement_T14H earth_shock_eoe 0 673623 32180 66737 13.1 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.79sec 450.60sec
Shaman_Enhancement_T14H feral_spirit 51533 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 122.72sec 450.60sec
Shaman_Enhancement_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.72sec 450.60sec
Shaman_Enhancement_T14H flame_shock 8050 3185542 23833 49698 14.0 15.6% 0.0% 0.0% 0.0% 166.7 14372 30008 15.3% 0.0% 33.12sec 450.60sec
Shaman_Enhancement_T14H flame_shock_eoe 0 116078 23803 49674 4.2 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 89.44sec 450.60sec
Shaman_Enhancement_T14H flametongue_oh 8024 2536741 7213 15097 300.6 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.50sec 450.60sec
Shaman_Enhancement_T14H improved_lava_lash 0 0 0 0 39.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.38sec 450.60sec
Shaman_Enhancement_T14H lava_lash 60103 6121134 108607 225969 40.7 35.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.00sec 450.60sec
Shaman_Enhancement_T14H lightning_bolt 403 5265885 42595 88457 77.4 55.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.76sec 450.60sec
Shaman_Enhancement_T14H lightning_bolt_eoe 0 1554883 42751 88725 22.8 55.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.93sec 450.60sec
Shaman_Enhancement_T14H lightning_shield 324 5596463 20368 42129 173.7 55.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.77sec 450.60sec
Shaman_Enhancement_T14H melee_main_hand 0 3453821 13852 28920 220.4 34.8% 18.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.04sec 450.60sec
Shaman_Enhancement_T14H melee_off_hand 0 1717451 6922 14448 219.6 34.8% 18.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.05sec 450.60sec
Shaman_Enhancement_T14H searing_totem 3599 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 71.90sec 450.60sec
Shaman_Enhancement_T14H stormblast 115356 0 0 0 5.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.04sec 450.60sec
Shaman_Enhancement_T14H stormblast_mh 115357 1087662 130426 273605 5.8 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.04sec 450.60sec
Shaman_Enhancement_T14H stormblast_oh 115360 543884 65244 136706 5.8 40.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 75.04sec 450.60sec
Shaman_Enhancement_T14H stormstrike 17364 0 0 0 47.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.47sec 450.60sec
Shaman_Enhancement_T14H stormstrike_mh 32175 3276571 50090 103936 47.6 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.47sec 450.60sec
Shaman_Enhancement_T14H stormstrike_oh 32176 1638284 25045 51969 47.6 34.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.47sec 450.60sec
Shaman_Enhancement_T14H unleash_elements 73680 0 0 0 29.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.73sec 450.60sec
Shaman_Enhancement_T14H unleash_flame 73683 791864 23383 48619 29.1 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.73sec 450.60sec
Shaman_Enhancement_T14H unleash_flame_eoe 0 236905 23370 48449 8.7 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 47.76sec 450.60sec
Shaman_Enhancement_T14H unleash_wind 73681 505685 12603 26206 29.1 35.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.73sec 450.60sec
Shaman_Enhancement_T14H windfury_mh 33757 2558728 15221 31668 121.5 35.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.94sec 450.60sec
Shaman_Enhancement_T14H windlash_main_hand 114089 1408872 34561 72335 28.0 41.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.40sec 450.60sec
Shaman_Enhancement_T14H windlash_off_hand 114093 716159 17292 36193 28.5 41.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.18sec 450.60sec
Shaman_Enhancement_T14H_spirit_wolf melee 0 822474 2400 4907 257.2 37.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.17sec 118.14sec
Shaman_Enhancement_T14H_spirit_wolf spirit_bite 58859 780054 14232 29061 39.5 37.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.92sec 118.14sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_blast 57984 224673 8165 16879 20.0 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.76sec 119.70sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_melee 0 3633881 20563 42693 133.1 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.72sec 119.70sec
Shaman_Enhancement_T14H_greater_earth_elemental earth_melee 0 630243 5026 10283 95.7 35.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.78sec 119.03sec
Shaman_Enhancement_T14H_searing_totem searing_bolt 3606 1305103 5551 11551 201.4 15.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.22sec 327.37sec
Warlock_Affliction_T14H agony 980 7761695 0 0 13.4 0.0% 0.0% 0.0% 0.0% 348.4 18690 38862 17.8% 0.0% 28.58sec 450.60sec
Warlock_Affliction_T14H agony_ds 0 1398324 29684 61582 39.5 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.60sec
Warlock_Affliction_T14H agony_mg 0 5837967 13845 28800 353.9 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.03sec 450.60sec
Warlock_Affliction_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.20sec 450.60sec
Warlock_Affliction_T14H corruption 172 6524804 0 0 17.6 0.0% 0.0% 0.0% 0.0% 348.3 15731 32703 17.7% 0.0% 22.11sec 450.60sec
Warlock_Affliction_T14H corruption_ds 0 1184082 25120 52157 39.5 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.60sec
Warlock_Affliction_T14H corruption_mg 0 4926598 11695 24315 353.9 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.03sec 450.60sec
Warlock_Affliction_T14H dark_soul 113860 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 81.20sec 450.60sec
Warlock_Affliction_T14H drain_soul 1120 2693864 0 0 17.6 0.0% 0.0% 0.0% 0.0% 39.5 57194 118613 18.0% 0.0% 4.80sec 450.60sec
Warlock_Affliction_T14H haunt 48181 5897573 117597 244405 42.4 17.6% 0.0% 0.0% 0.0% 165.6 0 0 0.0% 0.0% 10.71sec 450.60sec
Warlock_Affliction_T14H life_tap 1454 0 0 0 11.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 38.83sec 450.60sec
Warlock_Affliction_T14H malefic_grasp 103103 5675662 0 0 102.8 0.0% 0.0% 0.0% 0.0% 353.9 13492 28006 17.5% 0.0% 3.54sec 450.60sec
Warlock_Affliction_T14H soul_swap 86121 259545 23746 49151 9.2 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 54.15sec 450.60sec
Warlock_Affliction_T14H soulburn 74434 0 0 0 9.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 52.13sec 450.60sec
Warlock_Affliction_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Warlock_Affliction_T14H unstable_affliction 30108 6976409 0 0 24.4 0.0% 0.0% 0.0% 0.0% 341.5 17162 35644 17.7% 0.0% 17.84sec 450.60sec
Warlock_Affliction_T14H unstable_affliction_ds 0 1288677 27362 56812 39.5 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.08sec 450.60sec
Warlock_Affliction_T14H unstable_affliction_mg 0 5377161 12765 26529 353.9 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.03sec 450.60sec
Warlock_Affliction_T14H_felhunter shadow_bite 54049 26285 22118 44236 1.0 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 0.00sec
Warlock_Affliction_T14H_doomguard doom_bolt 85692 951404 36888 75079 21.7 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.73sec 60.00sec
Warlock_Demonology_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.91sec 450.60sec
Warlock_Demonology_T14H cancel_metamorphosis 0 0 0 0 14.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 27.19sec 450.60sec
Warlock_Demonology_T14H corruption 172 3958213 0 0 1.0 0.0% 0.0% 0.0% 0.0% 288.3 11507 23947 17.9% 0.0% 275.41sec 450.60sec
Warlock_Demonology_T14H dark_soul 113861 0 0 0 6.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.84sec 450.60sec
Warlock_Demonology_T14H doom 603 4682283 0 0 9.2 0.0% 0.1% 0.0% 0.0% 39.1 99804 208473 18.3% 0.0% 47.21sec 450.60sec
Warlock_Demonology_T14H hand_of_guldan 105174 850445 12154 25351 29.6 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.30sec 450.60sec
Warlock_Demonology_T14H life_tap 1454 0 0 0 13.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.18sec 450.60sec
Warlock_Demonology_T14H melee 103988 1927858 7029 14626 231.4 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.93sec 450.60sec
Warlock_Demonology_T14H metamorphosis 103958 0 0 0 20.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 23.16sec 450.60sec
Warlock_Demonology_T14H service_felguard 111898 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.91sec 450.60sec
Warlock_Demonology_T14H shadow_bolt 686 4207726 19083 39641 185.5 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.54sec 450.60sec
Warlock_Demonology_T14H shadowflame 47960 2119163 0 0 29.3 17.9% 0.0% 0.0% 0.0% 218.9 8093 16933 17.9% 0.0% 15.32sec 450.60sec
Warlock_Demonology_T14H soul_fire 6353 7078708 0 95980 74.4 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.83sec 450.60sec
Warlock_Demonology_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Warlock_Demonology_T14H touch_of_chaos 103964 8982265 57364 119053 131.6 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.38sec 450.60sec
Warlock_Demonology_T14H_doomguard doom_bolt 85692 1195661 48371 99472 20.8 18.1% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.83sec 60.00sec
Warlock_Demonology_T14H_felguard felstorm 89753 2502396 17865 36023 10.3 17.8% 0.1% 0.0% 0.0% 71.6 27026 54585 17.8% 0.1% 45.77sec 450.60sec
Warlock_Demonology_T14H_felguard legion_strike 30213 2244000 23017 46492 82.5 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.54sec 450.60sec
Warlock_Demonology_T14H_felguard melee 0 5225052 17561 35439 265.5 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.67sec 450.60sec
Warlock_Demonology_T14H_wild_imp firebolt 104318 5693754 15158 30548 355.0 17.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.25sec 325.06sec
Warlock_Demonology_T14H_service_felguard felstorm 89751 1196198 19971 40278 4.3 18.3% 0.1% 0.0% 0.0% 29.9 30904 62212 18.5% 0.1% 120.92sec 91.94sec
Warlock_Demonology_T14H_service_felguard legion_strike 30213 686142 26435 53601 21.8 18.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.41sec 91.94sec
Warlock_Demonology_T14H_service_felguard melee 0 1115704 20180 41001 48.9 18.4% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 8.44sec 91.94sec
Warlock_Destruction_T14H blood_fury 33702 0 0 0 4.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.99sec 450.60sec
Warlock_Destruction_T14H chaos_bolt 116858 9822920 0 341005 28.8 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.87sec 450.60sec
Warlock_Destruction_T14H conflagrate 17962 3410628 67055 141615 38.7 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.71sec 450.60sec
Warlock_Destruction_T14H dark_soul 113858 0 0 0 6.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.83sec 450.60sec
Warlock_Destruction_T14H immolate 348 4921941 16535 34874 27.3 27.5% 0.0% 0.0% 0.0% 200.6 16501 34827 27.8% 0.0% 16.43sec 450.60sec
Warlock_Destruction_T14H incinerate 29722 19327961 65147 136461 230.4 26.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.93sec 450.60sec
Warlock_Destruction_T14H shadowburn 17877 2005187 215590 446803 7.1 28.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.72sec 450.60sec
Warlock_Destruction_T14H summon_terrorguard 112927 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 450.60sec
Warlock_Destruction_T14H_observer melee 0 6242375 16063 32824 316.2 27.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.42sec 450.60sec
Warlock_Destruction_T14H_observer tongue_lash 115778 2964397 23582 48170 97.6 27.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.68sec 450.60sec
Warlock_Destruction_T14H_terrorguard doom_bolt 85692 1221469 42274 93003 21.3 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 60.00sec
Warrior_Arms_T14H battle_shout 6673 0 0 0 3.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 101.70sec 450.60sec
Warrior_Arms_T14H berserker_rage 18499 0 0 0 14.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.35sec 450.60sec
Warrior_Arms_T14H bloodbath 12292 2751579 0 0 7.9 0.0% 0.0% 0.0% 0.0% 132.4 20790 0 0.0% 0.0% 60.65sec 450.60sec
Warrior_Arms_T14H colossus_smash 86346 2548185 51781 108015 36.9 30.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.26sec 450.60sec
Warrior_Arms_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.78sec 450.60sec
Warrior_Arms_T14H deep_wounds 115767 2668872 0 0 73.5 0.0% 0.0% 0.0% 0.0% 149.7 13587 27835 29.8% 0.0% 6.17sec 450.60sec
Warrior_Arms_T14H dragon_roar 118000 1467876 0 207020 7.1 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 65.77sec 450.60sec
Warrior_Arms_T14H execute 5308 5976556 204712 443714 21.2 32.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.99sec 450.60sec
Warrior_Arms_T14H heroic_leap 6544 1050039 56202 118951 13.9 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 33.56sec 450.60sec
Warrior_Arms_T14H heroic_strike 78 3643358 77144 156463 36.0 30.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.99sec 450.60sec
Warrior_Arms_T14H heroic_throw 57755 154730 14368 30109 8.1 29.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 53.26sec 450.60sec
Warrior_Arms_T14H impending_victory 103840 11394 32206 66397 0.3 28.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 105.09sec 450.60sec
Warrior_Arms_T14H melee_main_hand 0 6551184 35609 73369 151.9 25.6% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.96sec 450.60sec
Warrior_Arms_T14H mortal_strike 12294 8025377 82347 172210 73.6 29.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.16sec 450.60sec
Warrior_Arms_T14H opportunity_strike 76858 4753237 19162 39153 189.4 29.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.37sec 450.60sec
Warrior_Arms_T14H overpower 7384 7350670 41416 86762 90.8 87.3% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.92sec 450.60sec
Warrior_Arms_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 168.23sec 450.60sec
Warrior_Arms_T14H slam 1464 4814984 71137 148253 51.8 28.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.80sec 450.60sec
Warrior_Fury_1h_T14H battle_shout 6673 0 0 0 5.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.10sec 450.60sec
Warrior_Fury_1h_T14H berserker_rage 18499 0 0 0 13.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.67sec 450.60sec
Warrior_Fury_1h_T14H bloodbath 12292 2466210 0 0 8.0 0.0% 0.0% 0.0% 0.0% 131.7 18730 0 0.0% 0.0% 60.31sec 450.60sec
Warrior_Fury_1h_T14H bloodthirst 23881 5159391 32867 70096 95.3 57.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.75sec 450.60sec
Warrior_Fury_1h_T14H bloodthirst_heal 23881 146370 0 0 95.3 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.75sec 450.60sec
Warrior_Fury_1h_T14H colossus_smash 86346 1122956 39623 83795 21.3 29.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.57sec 450.60sec
Warrior_Fury_1h_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.26sec 450.60sec
Warrior_Fury_1h_T14H deep_wounds 115767 4402188 0 0 95.3 0.0% 0.0% 0.0% 0.0% 149.7 22383 46314 29.3% 0.0% 4.75sec 450.60sec
Warrior_Fury_1h_T14H dragon_roar 118000 1833939 0 264051 6.9 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.30sec 450.60sec
Warrior_Fury_1h_T14H execute 5308 8784386 257434 564241 24.6 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.43sec 450.60sec
Warrior_Fury_1h_T14H heroic_leap 6544 1359698 92474 197972 10.9 30.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.11sec 450.60sec
Warrior_Fury_1h_T14H heroic_strike 78 4647116 49252 103905 71.3 29.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.10sec 450.60sec
Warrior_Fury_1h_T14H heroic_throw 57755 181312 12287 25877 11.2 28.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 38.52sec 450.60sec
Warrior_Fury_1h_T14H impending_victory 103840 266958 23327 49193 8.7 28.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 40.69sec 450.60sec
Warrior_Fury_1h_T14H impending_victory__heal 118340 0 0 0 8.7 23.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 40.69sec 450.60sec
Warrior_Fury_1h_T14H melee_main_hand 0 7062526 30159 62097 229.6 25.2% 18.8% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.96sec 450.60sec
Warrior_Fury_1h_T14H melee_off_hand 0 5959034 25449 52390 229.6 25.2% 18.7% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.96sec 450.60sec
Warrior_Fury_1h_T14H raging_blow 85288 0 0 0 59.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 450.60sec
Warrior_Fury_1h_T14H raging_blow_mh 96103 4859395 61034 128254 59.5 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 450.60sec
Warrior_Fury_1h_T14H raging_blow_oh 85384 4100801 51493 108232 59.5 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 450.60sec
Warrior_Fury_1h_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 166.13sec 450.60sec
Warrior_Fury_1h_T14H wild_strike 100130 3497808 45669 95416 58.8 27.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.98sec 450.60sec
Warrior_Fury_2h_T14H battle_shout 6673 0 0 0 5.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 73.05sec 450.60sec
Warrior_Fury_2h_T14H berserker_rage 18499 0 0 0 12.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 36.73sec 450.60sec
Warrior_Fury_2h_T14H bloodbath 12292 2545877 0 0 8.0 0.0% 0.0% 0.0% 0.0% 131.8 19322 0 0.0% 0.0% 60.32sec 450.60sec
Warrior_Fury_2h_T14H bloodthirst 23881 6596419 41037 86936 95.2 61.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.76sec 450.60sec
Warrior_Fury_2h_T14H bloodthirst_heal 23881 149108 0 0 95.2 25.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.76sec 450.60sec
Warrior_Fury_2h_T14H colossus_smash 86346 1461634 50492 106352 21.3 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.59sec 450.60sec
Warrior_Fury_2h_T14H deadly_calm 85730 0 0 0 7.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.15sec 450.60sec
Warrior_Fury_2h_T14H deep_wounds 115767 3677367 0 0 95.2 0.0% 0.0% 0.0% 0.0% 149.7 18358 37830 31.9% 0.0% 4.76sec 450.60sec
Warrior_Fury_2h_T14H dragon_roar 118000 1504232 0 217494 6.9 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.33sec 450.60sec
Warrior_Fury_2h_T14H execute 5308 7420986 208885 455086 25.2 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.34sec 450.60sec
Warrior_Fury_2h_T14H heroic_leap 6544 1135562 75923 161842 10.9 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.15sec 450.60sec
Warrior_Fury_2h_T14H heroic_strike 78 4385239 44404 93264 73.3 31.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.97sec 450.60sec
Warrior_Fury_2h_T14H heroic_throw 57755 235742 15766 33118 11.1 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 38.55sec 450.60sec
Warrior_Fury_2h_T14H impending_victory 103840 341376 29776 62619 8.6 30.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.65sec 450.60sec
Warrior_Fury_2h_T14H impending_victory__heal 118340 0 0 0 8.6 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.65sec 450.60sec
Warrior_Fury_2h_T14H melee_main_hand 0 6757118 38471 79299 168.1 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.67sec 450.60sec
Warrior_Fury_2h_T14H melee_off_hand 0 4226358 24056 49563 168.1 27.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.67sec 450.60sec
Warrior_Fury_2h_T14H raging_blow 85288 0 0 0 62.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.16sec 450.60sec
Warrior_Fury_2h_T14H raging_blow_mh 96103 6546895 77496 162166 62.2 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.16sec 450.60sec
Warrior_Fury_2h_T14H raging_blow_oh 85384 4093303 48429 101378 62.2 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.16sec 450.60sec
Warrior_Fury_2h_T14H recklessness 1719 0 0 0 3.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 166.14sec 450.60sec
Warrior_Fury_2h_T14H wild_strike 100130 3290109 43060 89871 57.4 30.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.11sec 450.60sec

Fluffy_Pillow : 8455 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
8455.2 8455.2 21.26 / 0.25% 1787 / 21.1% -1.0 0.0 0.0 None 149.81% 0.1 100.0%

Charts

http://5.chart.apis.google.com/chart?chs=550x60&cht=bhg&chf=bg,s,333333&chd=t:8504&chds=0,17008&chco=C79C6E&chm=t++8504++melee_main_hand,C79C6E,0,0,15&chtt=Fluffy_Pillow Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:100&chds=0,100&chdls=ffffff&chco=C79C6E&chl=melee_main_hand&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:AAAAAACCFEIIIIIIIIIIIIIIIIIHIFHEEEEEEEEEEEFFFFFFGEHFIILLOOOOOOONNNOOPOPMMJLHLIMMPPSSTTTSTRSSVUYWbXdZdadaeekjpotsvtuqrnnhiefcdZaUWQTOSPTSXWbaffjiljmlqosptpupvqwrytzv1x2z4z3z3y1wytuopiicdXYTVRTPTPURWUZYedjinmrpuswuyuzu0v0v1v1v0vzvzvzvyvytwrtnpklfhcdZaWYUWTWSWUZWcagekinmrqvtyw0x1x2x2x2x2w1w0vzuxsvqtprnpkmhjdfabXZVXUXUXUYWaYdbhfkjpntrxv0x2y3z50505z4y2x0vxsvqsnpkmhjdfabWYTVSURURUSWUZXcbhglkqpvtyw1y4062728271503y1wztwruprloilfidfacYaWYVXUXUXVZXbYdbgekiomsqwuzx2z40627272615z2wztvpsnpkmgidfacYaWYVXUXVYWZXbYdbfdjhmlqousyv1y3052737372604y1vystnojlggcdZbXYUVRT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=555|1:|0|avg=8455|max=15767&chxp=1,1,54,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,2,7,4,3,11,9,11,34,26,35,46,76,93,113,137,174,207,251,284,344,379,448,481,577,570,572,589,589,528,525,519,406,392,352,296,227,179,155,107,71,57,36,27,20,12,7,5,3,1&chds=0,589&chbh=5&chxt=x&chxl=0:|min=4216|avg=8455|max=12068&chxp=0,1,54,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:149.8&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 675.0s&chtt=Fluffy_Pillow Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 8455
melee_main_hand 8455 100.0% 224.8 2.00sec 17008 8504 17008 0 17008 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 224.80 224.80 0.00 0.00 2.0000 0.0000 3823456.61 3823456.61 0.00 8504.02 8504.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 224.80 100.00% 17008.03 0 59609 16948.28 8436 24188 3823457 3823457 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:87529.00
  • base_dd_max:87529.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
censure 1.0 325.4 1.2sec 1.4sec 99.72% 99.86%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • censure_1:0.3%
  • censure_2:0.6%
  • censure_3:0.4%
  • censure_4:0.2%
  • censure_5:98.2%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 32.7 4.2 13.9sec 12.3sec 47.54% 48.39%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:47.5%
colossus_smash 21.3 0.0 21.6sec 21.6sec 28.19% 31.68%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:28.2%
colossus_smash 21.3 0.0 21.6sec 21.6sec 28.18% 32.13%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:28.2%
find_weakness 12.9 24.8 35.7sec 11.7sec 39.21% 37.67%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • find_weakness_1:39.2%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:Armor $w1% less effective against the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for $91021d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
frost_vulnerability 1.0 468.8 2.5sec 1.0sec 99.52% 99.83%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_vulnerability
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frost_vulnerability_1:0.4%
  • frost_vulnerability_2:0.2%
  • frost_vulnerability_3:0.2%
  • frost_vulnerability_4:0.1%
  • frost_vulnerability_5:98.7%

Spelldata details

  • id:51714
  • name:Frost Vulnerability
  • tooltip:Frost damage taken from the death knight's abilities increased by $s1%.
  • description:Imbues your rune weapon with the power of Frost. Your melee swings cause your target to take an additional $51714s1% damage from your Frost attacks for $51714d. This effect stacks up to 5 times.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
frostbolt 1.8 144.1 220.8sec 3.0sec 97.56% 96.75%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frostbolt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frostbolt_1:0.7%
  • frostbolt_2:0.6%
  • frostbolt_3:96.3%

Spelldata details

  • id:116
  • name:Frostbolt
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
haunt 21.0 21.1 18.9sec 10.7sec 73.76% 74.95%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • haunt_1:73.8%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
health_decade_0__10 1.0 0.0 0.0sec 0.0sec 9.43% 9.43%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_0__10
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_0__10_1:9.4%
health_decade_10__20 1.0 0.0 0.0sec 0.0sec 9.31% 9.31%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:9.3%
health_decade_20__30 1.0 0.0 0.0sec 0.0sec 10.64% 10.64%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:10.6%
health_decade_30__40 1.0 0.0 0.0sec 0.0sec 11.07% 11.07%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:11.1%
health_decade_40__50 1.0 0.0 0.0sec 0.0sec 10.96% 10.96%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:11.0%
health_decade_50__60 1.0 0.0 0.0sec 0.0sec 10.85% 10.85%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_50__60
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_50__60_1:10.9%
health_decade_60__70 1.0 0.0 0.0sec 0.0sec 11.21% 11.21%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_60__70
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_60__70_1:11.2%
health_decade_70__80 1.0 0.0 0.0sec 0.0sec 11.23% 11.23%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_70__80
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_70__80_1:11.2%
health_decade_80__90 1.0 0.0 0.0sec 0.0sec 9.63% 9.63%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_80__90
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_80__90_1:9.6%
health_decade_90__100 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:5.7%
pyromaniac 7.5 24.8 61.0sec 14.0sec 95.47% 96.07%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyromaniac
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • pyromaniac_1:95.5%

Spelldata details

  • id:132209
  • name:Pyromaniac
  • tooltip:(null)
  • description:Your Nether Tempest, Living Bomb, and Frost Bomb spells now also apply the Pyromaniac effect. $@spellname132210 $@spelldesc132210
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
rising_sun_kick 1.0 47.8 261.1sec 9.3sec 99.53% 99.53%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_rising_sun_kick
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rising_sun_kick_1:99.5%

Spelldata details

  • id:130320
  • name:Rising Sun Kick
  • tooltip:Damage taken from abilities dealt by the Monk increased $w1%.
  • description:$@spelldesc107428
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
stormstrike 1.0 49.5 275.5sec 8.9sec 99.15% 99.49%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_stormstrike
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stormstrike_1:99.2%

Spelldata details

  • id:17364
  • name:Stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
  • max_stacks:
  • duration:15.00
  • cooldown:8.00
  • default_chance:1.00%
unleashed_fury_ft 29.1 8.7 15.7sec 12.0sec 64.10% 66.30%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_ft
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_ft_1:64.1%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage taken from the Shaman's Lightning Bolt by $s1%.
  • description:Increases the enemy target's damage taken from your Lightning Bolt by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
vendetta 4.3 0.0 120.5sec 120.5sec 27.33% 28.89%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • vendetta_1:27.3%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2890935.62
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
combo_points 230.0 2.8sec
combo_points_wasted 18.0 26.4sec
Rogue_Subtlety_T14H: combo_points 486.1 1.2sec
Rogue_Subtlety_T14H: anticipation_charges 54.7 10.3sec
Rogue_Subtlety_T14H: anticipation_charges_wasted 0.2 57.2sec
Rogue_Assassination_T14H: combo_points 332.6 2.8sec
Rogue_Assassination_T14H: anticipation_charges 29.0 19.8sec
Rogue_Assassination_T14H: anticipation_charges_wasted 0.4 7.3sec
Rogue_Combat_T14H: combo_points 316.7 2.0sec
Rogue_Combat_T14H: anticipation_charges 146.8 4.1sec
Rogue_Combat_T14H: anticipation_charges_wasted 7.0 67.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 10000
Mean 450.60
Minimum 350.60
Maximum 555.25
Spread ( max - min ) 204.66
Range [ ( max - min ) / 2 * 100% ] 22.71%

DPS

Sample Data
Count 10000
Mean 8455.17
Minimum 4216.00
Maximum 12067.70
Spread ( max - min ) 7851.71
Range [ ( max - min ) / 2 * 100% ] 46.43%
Standard Deviation 1084.6640
5th Percentile 6610.50
95th Percentile 10184.15
( 95th Percentile - 5th Percentile ) 3573.65
Mean Distribution
Standard Deviation 10.8466
95.00% Confidence Intervall ( 8433.91 - 8476.43 )
Normalized 95.00% Confidence Intervall ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 632
0.1% Error 63218
0.1 Scale Factor Error with Delta=300 10043
0.05 Scale Factor Error with Delta=300 40172
0.01 Scale Factor Error with Delta=300 1004324
Distribution Chart

DPS(e)

Sample Data
Count 10000
Mean 8455.17

Damage

Sample Data
Count 10000
Mean 3823456.61

DTPS

Sample Data
Count 10000
Mean 2896897.96

HPS

Sample Data
Count 10000
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 10000
Mean 0.00

Heal

Sample Data
Count 10000
Mean 0.00

HTPS

Sample Data
Count 10000
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 10000
Mean 1.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats
Default action list
# count action,conditions
1 1.00 auto_attack,damage=87529,attack_speed=2.0,target=Healing Target

Sample Sequence

1

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1563941834 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -1.#J% -1.#J% 0
Spell Haste 0.00% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit -1.#J% -1.#J% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
origin="unknown"
level=93
race=humanoid
spec=unknown
role=tank
position=back

actions.precombat=snapshot_stats

actions=auto_attack,damage=87529,attack_speed=2.0,target=Healing Target


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%%

Percentage of executes that resulted in critical strikes.

Dodge%%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%%

Percentage of executes that resulted in glancing blows.

G%%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.