close

SimulationCraft 504-7

for World of Warcraft 5.0.4 Live (build level 16016)

Beta Release

Table of Contents

Raid Summary

 

DPS Chart DPS Chart
Raid Event List
0 flying,first=0,duration=500,cooldown=500
1 position_switch,first=0,duration=500,cooldown=500
2 stun,duration=1.0,first=45.0,period=45.0
3 stun,duration=1.0,first=57.0,period=57.0
4 damage,first=6.0,period=6.0,last=59.5,amount=44000,type=shadow
5 damage,first=60.0,period=5.0,last=119.5,amount=44855,type=shadow
6 damage,first=120.0,period=4.0,last=179.5,amount=44855,type=shadow
7 damage,first=180.0,period=3.0,last=239.5,amount=44855,type=shadow
8 damage,first=240.0,period=2.0,last=299.5,amount=44855,type=shadow
9 damage,first=300.0,period=1.0,amount=44855,type=shadow
HPS Chart

Death_Knight_Frost_1h_T14H : 114160 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114159.7 114159.7 56.45 / 0.05% 4702 / 4.1% 15039.7 7.0 7.1 Runic Power 1.46% 61.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:138085|86166|75574|58365|16048|8179|4090&chds=0,276171&chco=9482C9,0070DE,0070DE,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++138085++soul_reaper,9482C9,0,0,15|t++86166++frost_strike,0070DE,1,0,15|t++75574++howling_blast,0070DE,2,0,15|t++58365++obliterate,C79C6E,3,0,15|t++16048++plague_strike,C79C6E,4,0,15|t++8179++melee_main_hand,C79C6E,5,0,15|t++4090++melee_off_hand,C79C6E,6,0,15&chtt=Death_Knight_Frost_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,22,15,7,7,5,4,4,3,3,2,2,2,1,1,1,1&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,C79C6E,9482C9,0070DE,C79C6E,C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,0070DE,C79C6E&chl=frost_strike|howling_blast|frost_strike_offhand|melee_main_hand|soul_reaper|frost_fever|obliterate|melee_off_hand|army_of_the_dead: melee|blood_plague|ghoul: melee|obliterate_offhand|army_of_the_dead: claw|ghoul: claw|plague_strike|razorice|plague_strike_offhand&chtt=Death_Knight_Frost_1h_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uvxyz012232355686420zxwvtsqonljjihgedddddedcbaaZZYYZZZZZbbbcccccddeefeeddcbbaaaZYXXXXXWWWWXXXXXXXXXXXYYYYXXXXXWWXXXYYZZaaaaZaaabbbcddddddddccddddcddcccbbaaaZZZZZYXXXXXXXYWWWVWWWWWWWXYYZZZZaaabccdddccbaaaaZZZZZYYYXXXWVWVVVVVVUUUUUUTUUUVVXYYabbccdefffffggggggfffdddcccccbbbccbbaZZYYYZZZaZaaaaaaaaaabcccbbbbbaaaaaabbbccccdddeeeeeffeeddcbbbaaaaaaZZZZZZZZYYXYYXXXXXWWVVVU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=114160|max=242155&chxp=1,1,47,100&chtt=Death_Knight_Frost_1h_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:6,1,8,9,8,20,20,39,53,66,79,105,122,201,228,271,301,349,427,441,488,513,518,542,513,542,519,519,471,442,402,349,266,240,208,179,133,115,73,58,41,30,33,16,14,6,4,3,3,2&chds=0,542&chbh=5&chxt=x&chxl=0:|min=104414|avg=114160|max=124409&chxp=0,1,49,100&chtt=Death_Knight_Frost_1h_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.2,30.0,7.7,7.2,5.2,4.2,1.9,1.8,1.4,1.1,1.5&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,C79C6E,C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,C79C6E,ffffff&chl=frost_strike 132.4s|howling_blast 109.9s|obliterate 28.1s|plague_strike 26.3s|soul_reaper 19.0s|plague_leech 15.3s|death_and_decay 7.1s|horn_of_winter 6.4s|outbreak 5.2s|raise_dead 4.1s|waiting 5.3s&chtt=Death_Knight_Frost_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_1h_T14H 114160
blood_fury 0 0.0% 3.0 120.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 2851 2.5% 55.7 12.10sec 18747 0 0 0 0 0.0% 0.0% 0.0% 0.0% 103.6 9488 18947 10069 6.1% 0.0% 84.9%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.65 55.65 103.62 103.62 0.0000 3.0000 1043292.18 1043292.18 0.00 3356.29 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.3 93.86% 9488.27 7121 14661 9488.38 8441 10262 922789 922789 0.00
crit 6.4 6.14% 18947.17 14243 29321 18943.66 0 27906 120503 120503 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
death_and_decay 0 0.0% 6.8 45.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: death_and_decay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.80 0.00 0.00 0.00 1.0378 0.0000 0.00 0.00 0.00 0.00 0.00
DPS Timeline Chart

Action details: death_and_decay

Static Values
  • id:43265
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:43265
  • name:Death and Decay
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every sec.$?$w4!=0[ Movement speed reduced by $w4%.][]
  • description:Corrupts the ground targeted by the Death Knight, causing $52212m1 Shadow damage every sec to targets that remain in the area $?s58629[and reducing their movement speed by $58629s1% ][]for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.064000
  • base_td:51.10
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
empower_rune_weapon 0 0.0% 1.0 304.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4822 4.2% 110.9 3.30sec 15911 0 0 0 0 0.0% 0.0% 0.0% 0.0% 110.9 15000 30028 15919 6.1% 0.0% 90.9%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.92 110.92 110.87 110.87 0.0000 3.0000 1764843.04 1764843.04 0.00 5306.20 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.1 93.89% 15000.27 11423 23567 15000.32 14184 16117 1561407 1561407 0.00
crit 6.8 6.11% 30027.88 22845 47134 30011.44 0 43475 203436 203436 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 31163 27.3% 127.5 2.82sec 89446 86166 58531 121208 89446 49.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.51 127.51 0.00 0.00 1.0381 0.0000 11405490.81 11405490.81 0.00 86166.32 86166.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.62 50.68% 58530.97 50970 76315 58529.61 55579 61179 3782204 3782204 0.00
crit 62.89 49.32% 121207.81 104999 157209 121209.27 116434 127002 7623287 7623287 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>=88
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
frost_strike_offhand 15583 13.7% 127.5 2.82sec 44729 0 29272 60612 44729 49.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.51 127.51 0.00 0.00 0.0000 0.0000 5703476.51 5703476.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.62 50.68% 29271.98 25487 38159 29271.25 28090 30756 1891683 1891683 0.00
crit 62.89 49.32% 60611.60 52502 78608 60611.59 58158 63361 3811794 3811794 0.00
DPS Timeline Chart

Action details: frost_strike_offhand

Static Values
  • id:66196
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66196
  • name:Frost Strike Off-Hand
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $s2% off-hand weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 7.2 44.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.20 7.20 0.00 0.00 0.8938 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 22700 19.9% 105.9 3.44sec 78443 75574 73654 151589 78443 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.92 105.92 0.00 0.00 1.0380 0.0000 8308363.79 8308363.79 0.00 75573.86 75573.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.41 93.85% 73654.31 55964 115894 73655.19 68711 77558 7321744 7321744 0.00
crit 6.51 6.15% 151589.30 115286 238742 151285.20 0 234639 986619 986619 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 7603 6.7% 208.0 1.75sec 13377 8179 15273 31450 13377 11.1% 18.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 208.01 208.01 0.00 0.00 1.6355 0.0000 2782569.31 2782569.31 0.00 8179.31 8179.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.93 46.60% 15272.92 13152 19977 15272.72 14651 15882 1480424 1480424 0.00
crit 23.19 11.15% 31449.99 27093 41152 31451.17 29028 35005 729325 729325 0.00
glance 50.00 24.04% 11455.34 9864 14983 11455.63 10816 12185 572821 572821 0.00
miss 37.88 18.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3802 3.3% 208.0 1.75sec 6689 4090 7637 15735 6689 11.2% 18.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 208.01 208.01 0.00 0.00 1.6355 0.0000 1391376.71 1391376.71 0.00 4089.93 4089.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.86 46.56% 7636.58 6576 9988 7636.48 7308 7909 739655 739655 0.00
crit 23.22 11.17% 15735.46 13547 20576 15734.70 14511 17264 365450 365450 0.00
glance 49.99 24.03% 5726.69 4932 7491 5726.62 5342 6052 286272 286272 0.00
miss 37.94 18.24% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 4480 3.9% 27.1 12.62sec 60564 58365 46641 96014 60564 28.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.08 27.08 0.00 0.00 1.0377 0.0000 1639832.21 1639832.21 0.00 58365.33 58365.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.44 71.80% 46640.69 40067 59990 46671.63 42470 51892 906713 906713 0.00
crit 7.64 28.20% 96013.95 82538 123579 95967.05 0 122215 733120 733120 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.killing_machine.react&runic_power<10
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
obliterate_offhand 2242 2.0% 27.1 12.62sec 30304 0 23320 48019 30304 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.08 27.08 0.00 0.00 0.0000 0.0000 820497.61 820497.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.42 71.72% 23319.63 20035 29996 23335.34 21101 25738 452866 452866 0.00
crit 7.66 28.28% 48018.94 41271 61792 48008.35 0 61792 367631 367631 0.00
DPS Timeline Chart

Action details: obliterate_offhand

Static Values
  • id:66198
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66198
  • name:Obliterate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% off-hand weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.30
outbreak 0 0.0% 5.0 78.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 1.0374 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 6.3 61.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.30 6.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 14.7 25.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.72 14.72 0.00 0.00 1.0377 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 1153 1.0% 25.3 14.45sec 16661 16048 14894 30657 16661 11.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.32 25.32 0.00 0.00 1.0382 0.0000 421924.11 421924.11 0.00 16048.23 16048.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.49 88.79% 14893.58 12998 19298 14895.61 14006 16062 334893 334893 0.00
crit 2.84 11.21% 30657.49 26775 39753 28944.80 0 39753 87032 87032 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
plague_strike_offhand 576 0.5% 25.3 14.45sec 8326 0 7446 15349 8326 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.32 25.32 0.00 0.00 0.0000 0.0000 210864.33 210864.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.50 88.85% 7445.53 6499 9649 7446.54 6940 8069 167538 167538 0.00
crit 2.82 11.15% 15349.47 13388 19877 14494.49 0 19877 43326 43326 0.00
DPS Timeline Chart

Action details: plague_strike_offhand

Static Values
  • id:66216
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:66216
  • name:Plague Strike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% off-hand weapon damage plus a bonus and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:233.06
  • base_dd_max:233.06
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.0 120.43sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
razorice 669 0.6% 368.3 0.99sec 665 0 665 0 665 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: razorice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 368.30 368.30 0.00 0.00 0.0000 0.0000 244737.96 244737.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 368.30 100.00% 664.50 573 870 664.50 646 678 244738 244738 0.00
DPS Timeline Chart

Action details: razorice

Static Values
  • id:50401
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50401
  • name:Razor Frost
  • school:frost
  • tooltip:(null)
  • description:Your rune weapon causes $s1% extra weapon damage as Frost damage.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.02
soul_reaper 7153 6.3% 18.3 7.51sec 143339 138085 15243 31396 17028 11.1% 0.0% 0.0% 0.0% 17.5 117800 242401 131776 11.2% 0.0% 23.9%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.26 18.26 17.51 17.51 1.0380 5.0000 2617823.20 2617823.20 0.00 24583.73 138085.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.24 88.95% 15243.31 13152 19977 15244.32 14252 16140 247626 247626 0.00
crit 2.02 11.05% 31395.86 27093 41152 27484.61 0 41152 63367 63367 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.5 88.78% 117799.58 101663 155774 117804.92 109314 124812 1830855 1830855 0.00
crit 2.0 11.22% 242401.37 209426 320895 212209.64 0 320895 475976 475976 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 7774 / 3927
claw 2892 1.3% 64.0 6.22sec 8356 0 7520 15016 8356 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.01 64.01 0.00 0.00 0.0000 0.0000 534831.53 534831.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.88 88.85% 7520.02 5828 11182 7519.97 6959 7935 427704 427704 0.00
crit 7.13 11.15% 15016.37 11655 22365 15013.28 0 22009 107128 107128 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 4881 2.2% 141.3 2.59sec 6388 5245 6073 12145 6388 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.29 141.29 0.00 0.00 1.2179 0.0000 902601.55 902601.55 0.00 5245.46 5245.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.60 64.83% 6072.95 4662 8946 6072.91 5591 6438 556303 556303 0.00
crit 15.82 11.19% 12145.45 9324 17892 12143.07 10034 14738 192093 192093 0.00
glance 33.87 23.97% 4552.99 3497 6709 4552.79 4042 5199 154205 154205 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 56855 / 5437
claw 20697 1.7% 120.0 2.58sec 6037 0 5431 10866 6037 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.00 120.00 0.00 0.00 0.0000 0.0000 724379.16 724379.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.62 88.85% 5430.66 3642 6989 5430.67 4851 5822 579009 579009 0.00
crit 13.38 11.15% 10865.58 7285 13978 10868.27 8593 13867 145370 145370 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 36159 3.0% 276.2 0.99sec 4582 4581 4358 8716 4582 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 276.18 276.18 0.00 0.00 1.0002 0.0000 1265551.29 1265551.29 0.00 4581.48 4581.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.07 64.84% 4357.67 2914 5591 4358.17 3898 4675 780326 780326 0.00
crit 30.81 11.16% 8715.98 5828 11182 8716.47 7035 10697 268541 268541 0.00
glance 66.30 24.01% 3268.41 2185 4193 3268.33 2781 3682 216683 216683 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 3.0 0.0 120.3sec 120.3sec 12.30% 12.30%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:12.3%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 27.45%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 6.0 0.0 63.5sec 63.5sec 32.78% 32.78%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.8%
frost_presence 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
killing_machine 60.3 13.3 6.0sec 4.9sec 22.29% 38.82%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:22.3%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 310.8sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
pillar_of_frost 6.3 0.0 61.2sec 61.3sec 32.92% 38.83%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:32.9%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
relic_of_xuen 8.0 0.0 47.7sec 47.7sec 32.75% 32.75%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.7%
rime 12.1 0.1 26.1sec 26.1sec 4.21% 4.21%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:4.2%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 9.0 21.4 41.0sec 11.6sec 71.15% 69.28%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:71.2%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.3 0.0 61.2sec 61.4sec 16.53% 16.53%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.5%
ghoul-stunned 7.0 0.0 40.0sec 0.0sec 3.37% 3.37%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H_ghoul
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.7%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_1h_T14H
frost_strike Runic Power 127.5 2550.3 20.0 20.0 4472.3
pet - ghoul
claw Energy 64.0 2560.4 40.0 40.0 208.9
pet - army_of_the_dead
claw Energy 120.0 4799.9 40.0 40.0 150.9
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 7.20 72.01 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 6.30 62.18 9.87 0.84 1.33%
rp_soul_reaper Runic Power 18.26 182.03 9.97 0.60 0.33%
rp_howling_blast Runic Power 93.82 935.98 9.98 2.21 0.24%
rp_plague_strike Runic Power 25.32 247.63 9.78 5.61 2.22%
rp_empower_rune_weapon Runic Power 1.00 25.10 25.00 0.00 0.02%
rp_obliterate Runic Power 27.08 529.06 19.54 12.46 2.30%
rp_death_and_decay Runic Power 6.80 68.05 10.00 0.00 0.00%
frost_presence Runic Power 186.79 433.79 2.32 0.96 0.22%
rune_regen_all None 4593.08 128.92 0.03 6.39 4.72%
rune_regen_unholy None 1548.48 42.53 0.03 2.59 5.75%
rune_regen_blood None 1544.16 42.35 0.03 2.68 5.95%
rune_regen_frost None 1500.44 44.04 0.03 1.11 2.47%
runic_empowerment Rune 57.41 55.86 0.97 1.55 2.69%
runic_empowerment_blood Blood Rune 22.52 22.52 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 24.70 24.70 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 8.65 8.65 1.00 0.00 0.00%
empower_rune_weapon Rune 1.00 3.94 3.93 2.08 34.53%
plague_leech Rune 13.99 13.99 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 737.78 2285.48 3.10 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 527.99 3.80 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Runic Power 7.07 6.97
Combat End Resource Mean Min Max
Health -6350724.00 -6350724.00 -6350724.00
Runic Power 34.34 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Runic Power Cap 1.2%
bloodworms-Runic Power Cap 1.2%
gargoyle-Runic Power Cap 1.2%
army_of_the_dead-Runic Power Cap 1.2%
army_of_the_dead-Runic Power Cap 1.2%
army_of_the_dead-Runic Power Cap 1.2%
army_of_the_dead-Runic Power Cap 1.2%

Procs

Count Interval
hat_donor 163.9 3.5sec
runic_empowerment 55.9 6.4sec
runic_empowerment_wasted 1.5 63.5sec
oblit_killing_machine 5.2 53.6sec
frost_strike_killing_machine 54.8 6.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 114159.71
Minimum 104413.57
Maximum 124408.64
Spread ( max - min ) 19995.07
Range [ ( max - min ) / 2 * 100% ] 8.76%
Standard Deviation 2879.4554
5th Percentile 109497.03
95th Percentile 118900.56
( 95th Percentile - 5th Percentile ) 9403.53
Mean Distribution
Standard Deviation 28.8003
95.00% Confidence Intervall ( 114103.27 - 114216.16 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2443
0.1 Scale Factor Error with Delta=300 70778
0.05 Scale Factor Error with Delta=300 283115
0.01 Scale Factor Error with Delta=300 7077899
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 114159.71

Damage

Sample Data
Count 9996
Mean 38355091.78

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 373.42
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 3.00 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
9 15.00 auto_attack
A 6.29 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 6.30 pillar_of_frost
C 4.00 raise_dead
D 5.00 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 18.26 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 10.48 howling_blast,if=!dot.frost_fever.ticking
H 10.38 plague_strike,if=!dot.blood_plague.ticking
I 14.72 plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
J 10.32 howling_blast,if=buff.rime.react
K 14.12 frost_strike,if=runic_power>=88
L 0.02 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 39.82 frost_strike,if=buff.killing_machine.react
N 1.41 obliterate,if=buff.killing_machine.react&runic_power<10
O 25.66 obliterate,if=(unholy=2|frost=2|death=2)
P 85.11 howling_blast
Q 73.57 frost_strike
R 6.80 death_and_decay
S 14.95 plague_strike
T 0.00 blood_tap,if=talent.blood_tap.enabled
U 6.20 horn_of_winter
V 0.98 empower_rune_weapon

Sample Sequence

9ABCDIGHOKOKP7KPPKPKOKPOJKPKPPKPKOIGHKPKOKOKMPPQ9OJKPPKMPMQO9IGABHMPQQQOJQPQPMPRMPQPSMOJIDMOPQ9PQPQNPQPMPMPQPPMRPIGHMQ9PQPSQCABQPPQUPMSM7VOOOJK9IGKHMPMPMPPMOJMPPQPQOJQQPIDOJOJKPK9MPPPQPMP9QQABPOJMIGHQPQPPQPQQMOPPQQRQUMOPMPIGHMMOJMOPP9MP9QQSPPQQRSQECIDABMOJMEMP7SMNQUMSEQPPQPQEIGH9MPEQPQRPQQESMP9PMSQEPIGHMEQOMPPQEMQSRMAB8UQEM9SIDEMPPQSQSEMPUQSQEPMRSM9EIGHMQSEMUQPSQE9CPPQQ

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21648 19252 18124
Agility 218 208 80
Stamina 22367 20334 20143
Intellect 121 115 80
Spirit 151 151 80
Health 459541 431079 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.79% 15.79% 2800
Spell Crit 9.13% 4.12% 2468
Spell Haste 15.72% 10.21% 4338
Mana Per 5 0 0 0
Attack Power 47901 38754 0
Melee Hit 8.24% 8.24% 2800
Melee Crit 14.14% 9.13% 2468
Melee Haste 10.21% 10.21% 4338
Swing Speed 45.47% 32.25% 4338
Expertise 7.55% / 7.55% 7.55% / 7.55% 2567
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.19% 5.56% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 46.44% 36.44% 6133

Gear

Average Item Level: 507.81
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_mastery
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=crit_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160mastery_80str_160mastery_120crit,enchant=80all,reforge=crit_mastery
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160mastery_80str_160hit_160str_120haste
Legs greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit
Feet impaling_treads,id=86979,gems=160str,enchant=175haste,reforge=hit_exp
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str,reforge=haste_mastery
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_mastery
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
Main Hand kilrak_jaws_of_terror,id=87173,gems=500str,enchant=rune_of_razorice,reforge=hit_haste
Off Hand kilrak_jaws_of_terror,id=87173,enchant=rune_of_the_fallen_crusader,reforge=hit_haste
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_1h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=60&buff.pillar_of_frost.up
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&!((buff.killing_machine.react&runic_power<10)|(unholy=2|frost=2|death=2))
actions+=/howling_blast,if=buff.rime.react
actions+=/frost_strike,if=runic_power>=88
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react&runic_power<10
actions+=/obliterate,if=(unholy=2|frost=2|death=2)
actions+=/howling_blast
actions+=/frost_strike
actions+=/death_and_decay
actions+=/plague_strike
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_mastery
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160mastery_80str_160mastery_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160mastery_80str_160hit_160str_120haste
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit
feet=impaling_treads,id=86979,gems=160str,enchant=175haste,reforge=hit_exp
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str,reforge=haste_mastery
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=rune_of_razorice,reforge=hit_haste
off_hand=kilrak_jaws_of_terror,id=87173,enchant=rune_of_the_fallen_crusader,reforge=hit_haste

# Gear Summary
# gear_strength=18124
# gear_agility=80
# gear_stamina=20143
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2567
# gear_hit_rating=2800
# gear_crit_rating=2468
# gear_haste_rating=4338
# gear_mastery_rating=6133
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_razorice
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=rune_of_the_fallen_crusader

Death_Knight_Frost_2h_T14H : 113201 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
113201.3 113201.3 60.87 / 0.05% 5118 / 4.5% 14268.1 7.2 7.4 Runic Power 9.65% 56.5 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

Charts

http://1.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:168787|148416|77365|68154|27729|13639&chds=0,337575&chco=9482C9,C79C6E,0070DE,0070DE,C79C6E,C79C6E&chm=t++168787++soul_reaper,9482C9,0,0,15|t++148416++obliterate,C79C6E,1,0,15|t++77365++frost_strike,0070DE,2,0,15|t++68154++howling_blast,0070DE,3,0,15|t++27729++plague_strike,C79C6E,4,0,15|t++13639++melee_main_hand,C79C6E,5,0,15&chtt=Death_Knight_Frost_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:36,28,12,9,7,4,4,3,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,0070DE,C79C6E,9482C9,0070DE,0070DE,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E&chl=obliterate|frost_strike|melee_main_hand|soul_reaper|howling_blast|frost_fever|army_of_the_dead: melee|blood_plague|ghoul: melee|army_of_the_dead: claw|ghoul: claw|plague_strike&chtt=Death_Knight_Frost_2h_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:012334555656877765431zyxwutrpommlkjhgffeeedddccaaaZYYYYZabbbbbbcbcccddddeeedccccaaZYYYXXXXWWWWWWWWWWWXXYXXWWWWVVVVVWWWWXXYYYYYZZZaabcccccbbbbbaaZZaaaaaZZZZZZYYYYXXXXXXXXXWWUUUVVVWVWWXXXXXYYYYZZabbaaaZZZZYYYXXXXXXXXWVVVUUUUUUUUUUVVUUUTUUWXXZaabbccdddeeffghhhgggeeeddcccbbbbbaaZZZZZZaaaaaabaaaaaZZZaabbbbcccbbbcccddeeffffeeeeddddddcccbaaaaaZZZZZZaaaaaaZZYZZZYYYYYYXXXW&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=113201|max=240382&chxp=1,1,47,100&chtt=Death_Knight_Frost_2h_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,2,4,5,10,21,25,25,59,60,100,138,177,198,267,327,358,419,462,492,529,589,571,550,569,523,502,515,452,397,328,300,239,182,144,121,109,69,45,39,25,15,11,6,7,4,2,0,1&chds=0,589&chbh=5&chxt=x&chxl=0:|min=102061|avg=113201|max=124930&chxp=0,1,49,100&chtt=Death_Knight_Frost_2h_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:37.5,24.8,11.1,5.3,3.3,1.9,1.7,1.5,1.1,9.7&chds=0,100&chdls=ffffff&chco=0070DE,C79C6E,0070DE,9482C9,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,ffffff&chl=frost_strike 137.1s|obliterate 90.8s|howling_blast 40.6s|soul_reaper 19.2s|horn_of_winter 12.0s|outbreak 7.1s|plague_strike 6.4s|plague_leech 5.6s|raise_dead 4.1s|waiting 35.3s&chtt=Death_Knight_Frost_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Frost_2h_T14H 113201
blood_fury 0 0.0% 3.0 120.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=10
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 3270 2.9% 13.0 30.10sec 92182 0 0 0 0 0.0% 0.0% 0.0% 0.0% 113.5 9633 19260 10541 9.4% 0.0% 93.1%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.98 12.98 113.53 113.53 0.0000 3.0000 1196742.24 1196742.24 0.00 3513.83 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.8 90.57% 9633.24 7106 14638 9635.30 8073 10496 990458 990458 0.00
crit 10.7 9.43% 19260.03 14212 29277 19260.20 0 25235 206284 206284 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.4 303.10sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.38 1.38 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
frost_fever 4602 4.1% 46.0 8.07sec 36616 0 0 0 0 0.0% 0.0% 0.0% 0.0% 115.9 13277 26572 14526 9.4% 0.0% 95.0%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.00 46.00 115.95 115.95 0.0000 3.0000 1684320.61 1684320.61 0.00 4842.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.1 90.60% 13276.56 9661 19946 13277.20 11949 14492 1394704 1394704 0.00
crit 10.9 9.40% 26572.39 19322 39891 26572.94 0 35549 289617 289617 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
frost_strike 28985 25.6% 132.1 2.73sec 80305 77365 60488 124940 80305 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frost_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.10 132.10 0.00 0.00 1.0380 0.0000 10608669.06 10608669.06 0.00 77364.95 77364.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.49 69.25% 60487.93 53152 75286 60487.97 58526 62160 5533859 5533859 0.00
crit 40.62 30.75% 124940.10 109492 155088 124939.64 118730 131852 5074810 5074810 0.00
DPS Timeline Chart

Action details: frost_strike

Static Values
  • id:49143
  • school:frost
  • resource:runic_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.killing_machine.react
Spelldata
  • id:49143
  • name:Frost Strike
  • school:frost
  • tooltip:(null)
  • description:Instantly strike the enemy, causing $m2% weapon damage as Frost damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.05
horn_of_winter 0 0.0% 12.6 27.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.58 12.58 0.00 0.00 0.9556 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
howling_blast 7566 6.7% 39.1 9.18sec 70744 68154 64300 132586 70744 9.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: howling_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.15 39.15 0.00 0.00 1.0380 0.0000 2769318.40 2769318.40 0.00 68154.42 68154.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.45 90.56% 64299.74 47333 98085 64300.83 57772 72184 2279547 2279547 0.00
crit 3.69 9.44% 132586.50 97507 202056 129633.93 0 202056 489772 489772 0.00
DPS Timeline Chart

Action details: howling_blast

Static Values
  • id:49184
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.frost_fever.ticking
Spelldata
  • id:49184
  • name:Howling Blast
  • school:frost
  • tooltip:(null)
  • description:Blast the target with a frigid wind, dealing ${(($m2+$M2)/2)+($AP*0.681)} Frost damage to that foe, and ${(0.5*((($m2+$M2)/2)+($AP*0.681)))} Frost damage to all other enemies within $A2 yards, infecting all targets with Frost Fever.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.681000
  • base_dd_min:467.36
  • base_dd_max:467.36
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 12431 11.0% 153.5 2.38sec 29635 13639 27113 55847 29635 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 153.53 153.53 0.00 0.00 2.1728 0.0000 4549919.17 4549919.17 0.00 13639.17 13639.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.59 61.61% 27113.13 23655 34040 27113.26 26154 27915 2564591 2564591 0.00
crit 22.16 14.43% 55847.44 48729 70122 55848.43 50989 63620 1237343 1237343 0.00
glance 36.79 23.96% 20333.69 17741 25530 20333.61 19140 21517 747985 747985 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
obliterate 36801 32.5% 87.4 4.16sec 154061 148416 114329 235698 154061 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: obliterate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.43 87.43 0.00 0.00 1.0380 0.0000 13469019.55 13469019.55 0.00 148415.68 148415.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.81 67.26% 114328.66 100376 142176 114330.68 110094 118270 6723248 6723248 0.00
crit 28.62 32.74% 235698.44 206775 292883 235703.80 222147 250966 6745771 6745771 0.00
DPS Timeline Chart

Action details: obliterate

Static Values
  • id:49020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power<=76
Spelldata
  • id:49020
  • name:Obliterate
  • school:physical
  • tooltip:(null)
  • description:A brutal instant attack that deals $m2% weapon damage. Total damage is increased by ${$m3/2}.1% for each of your diseases on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:1
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.22
outbreak 0 0.0% 6.9 60.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.85 6.85 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pillar_of_frost 0 0.0% 6.6 60.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: pillar_of_frost

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.61 6.61 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: pillar_of_frost

Static Values
  • id:51271
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51271
  • name:Pillar of Frost
  • school:physical
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
plague_leech 0 0.0% 5.4 61.66sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.36 5.36 0.00 0.00 1.0368 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_strike 481 0.4% 6.1 59.53sec 28741 27729 24933 51329 28741 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.13 6.13 0.00 0.00 1.0365 0.0000 176133.14 176133.14 0.00 27728.77 27728.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.24 85.57% 24932.85 23221 31515 24925.57 23548 27734 130755 130755 0.00
crit 0.88 14.43% 51329.33 47836 64921 31506.31 0 64921 45378 45378 0.00
DPS Timeline Chart

Action details: plague_strike

Static Values
  • id:45462
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!dot.blood_plague.ticking
Spelldata
  • id:45462
  • name:Plague Strike
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that deals $s2% weapon damage plus $s1 and infects the target with Blood Plague, a disease dealing Shadow damage over time.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:466.12
  • base_dd_max:466.12
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raise_dead 0 0.0% 4.0 120.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raise_dead

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raise_dead

Static Values
  • id:46584
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:46584
  • name:Raise Dead
  • school:physical
  • tooltip:A Risen Ally is in your service.
  • description:Raises a $?s58640[geist][ghoul] to fight by your side. You can have a maximum of one $?s58640[geist][ghoul] at a time.$?s52143[][ Lasts $46585d.]
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
soul_reaper 8862 7.8% 18.5 7.38sec 175187 168787 27068 55766 31230 14.5% 0.0% 0.0% 0.0% 17.8 131097 269689 149927 14.2% 0.6% 24.3%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.52 18.52 17.78 17.78 1.0379 5.0000 3243586.92 3243586.92 0.00 30004.04 168787.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.83 85.50% 27067.71 23655 34040 27068.05 25406 28699 428467 428467 0.00
crit 2.69 14.50% 55766.10 48729 70122 52715.71 0 70122 149764 149764 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.1 85.15% 131096.91 111708 171176 131097.83 121612 141172 1984579 1984579 0.00
crit 2.5 14.20% 269688.71 230119 352622 251699.72 0 352622 680778 680778 0.00
dodge 0.1 0.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130735
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130735
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - ghoul 8492 / 4283
claw 3155 1.4% 67.1 5.92sec 8677 0 7587 15174 8677 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.13 67.13 0.00 0.00 0.0000 0.0000 582486.00 582486.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.48 85.63% 7586.70 5817 11167 7586.72 7155 7946 436077 436077 0.00
crit 9.65 14.37% 15174.46 11634 22333 15172.09 12218 20720 146409 146409 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 5337 2.4% 148.3 2.47sec 6644 5697 6127 12251 6644 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.28 148.28 0.00 0.00 1.1662 0.0000 985208.91 985208.91 0.00 5697.25 5697.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.29 61.56% 6126.82 4653 8933 6126.88 5723 6493 559320 559320 0.00
crit 21.43 14.45% 12250.94 9307 17867 12251.80 10344 14436 262564 262564 0.00
glance 35.56 23.98% 4592.78 3490 6700 4592.88 3932 5236 163324 163324 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - army_of_the_dead 61893 / 5919
claw 22729 1.9% 127.8 2.49sec 6223 0 5436 10874 6223 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.83 127.83 0.00 0.00 0.0000 0.0000 795503.47 795503.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.33 85.53% 5436.36 3636 6979 5436.30 4865 5745 594373 594373 0.00
crit 18.50 14.47% 10873.96 7271 13958 10873.52 8744 13209 201130 201130 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 39165 3.3% 287.7 0.95sec 4765 4954 4395 8787 4765 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 287.66 287.66 0.00 0.00 0.9620 0.0000 1370765.97 1370765.97 0.00 4953.62 4953.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.08 61.56% 4394.64 2908 5583 4394.56 3891 4700 778185 778185 0.00
crit 41.54 14.44% 8786.93 5817 11167 8785.85 7290 10219 365010 365010 0.00
glance 69.04 24.00% 3296.16 2181 4187 3295.99 2825 3654 227571 227571 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 3.0 0.0 120.5sec 120.5sec 12.30% 12.30%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:12.3%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 28.64%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
darkmist_vortex 6.0 0.0 66.0sec 66.0sec 32.18% 32.18%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.2%
frost_presence 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_frost_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • frost_presence_1:100.0%

Spelldata details

  • id:48266
  • name:Frost Presence
  • tooltip:Runic Power generation increased by $w1%. Duration of crowd-control effects reduced by $s5%.$?$w3!=0[ Frost Strike cost reduced by 15.][]
  • description:Strengthens you with the presence of Frost, increasing Runic Power generation by $s1%, $?s50385[reducing the cost of your Frost Strike by ${$m3/-10}, ][]and reducing the duration of effects that remove control of your character by $s5%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
killing_machine 44.2 1.7 8.1sec 7.8sec 13.47% 19.98%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_killing_machine
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • killing_machine_1:13.5%

Spelldata details

  • id:51124
  • name:Killing Machine
  • tooltip:$s1% bonus to the critical strike chance of your next Obliterate or Frost Strike.
  • description:Your autoattacks have a chance to grant a $s1% critical strike bonus to your next Obliterate or Frost Strike.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 310.6sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
pillar_of_frost 6.6 0.0 61.0sec 61.0sec 33.03% 42.00%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_pillar_of_frost
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • pillar_of_frost_1:33.0%

Spelldata details

  • id:51271
  • name:Pillar of Frost
  • tooltip:Strength increased by $w1%.$?$w3!=0[ Immune to effects that cause loss of control. Rooted.][ Immune to movement from external sources.]
  • description:Calls upon the power of Frost to increase the Death Knight's Strength by $s1%. Icy crystals hang heavy upon the Death Knight's body, providing immunity against external movement $?s58635[and all effects that cause loss of control, but also preventing movement while active][such as knockbacks]. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:60.00
  • default_chance:0.00%
relic_of_xuen 7.9 0.0 49.4sec 49.4sec 31.77% 31.77%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.8%
rime 38.9 0.4 9.2sec 9.2sec 14.63% 14.63%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rime
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rime_1:14.6%

Spelldata details

  • id:59052
  • name:Freezing Fog
  • tooltip:Your next Icy Touch or Howling Blast will consume no runes and generate no Runic Power.
  • description:Your next Icy Touch or Howling Blast will consume no runes.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
rune_of_the_fallen_crusader 7.0 40.7 52.5sec 7.5sec 85.60% 81.79%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:85.6%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.6 0.0 61.0sec 61.0sec 16.63% 16.63%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.6%
ghoul-stunned 7.0 0.0 40.0sec 0.0sec 3.45% 3.45%

Buff details

  • buff initial source:Death_Knight_Frost_2h_T14H_ghoul
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.7%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Frost_2h_T14H
frost_strike Runic Power 132.1 2642.1 20.0 20.0 4015.2
pet - ghoul
claw Energy 67.1 2685.1 40.0 40.0 216.9
pet - army_of_the_dead
claw Energy 127.8 5113.2 40.0 40.0 155.6
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 12.58 125.79 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_pillar_of_frost Runic Power 6.61 65.33 9.89 0.75 1.13%
rp_soul_reaper Runic Power 18.52 184.30 9.95 0.85 0.46%
rp_howling_blast Runic Power 0.39 3.89 9.98 0.01 0.17%
rp_plague_strike Runic Power 6.13 60.58 9.88 0.71 1.16%
rp_obliterate Runic Power 87.43 1739.17 19.89 9.36 0.54%
rp_empower_rune_weapon Runic Power 1.38 34.39 24.96 0.05 0.15%
frost_presence Runic Power 134.02 450.55 3.36 0.48 0.11%
rune_regen_all None 4557.59 136.33 0.03 5.16 3.64%
rune_regen_unholy None 1518.08 45.58 0.03 1.61 3.41%
rune_regen_blood None 1534.01 44.80 0.03 2.30 4.89%
rune_regen_frost None 1505.51 45.95 0.03 1.24 2.63%
runic_empowerment Rune 59.40 58.98 0.99 0.42 0.71%
runic_empowerment_blood Blood Rune 17.84 17.84 1.00 0.00 0.00%
runic_empowerment_frost Frost Rune 21.51 21.51 1.00 0.00 0.00%
runic_empowerment_unholy Unholy Rune 19.63 19.63 1.00 0.00 0.00%
empower_rune_weapon Rune 1.38 4.47 3.25 3.79 45.87%
plague_leech Rune 5.00 5.00 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 736.60 2385.53 3.24 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 550.53 3.96 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Runic Power 7.36 7.22
Combat End Resource Mean Min Max
Health -6346146.00 -6346146.00 -6346146.00
Runic Power 51.28 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 96.9 3.7sec
runic_empowerment 59.0 6.1sec
runic_empowerment_wasted 0.4 70.5sec
oblit_killing_machine 18.7 18.7sec
frost_strike_killing_machine 25.2 14.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 113201.29
Minimum 102060.83
Maximum 124929.61
Spread ( max - min ) 22868.77
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 3104.9054
5th Percentile 108127.57
95th Percentile 118364.14
( 95th Percentile - 5th Percentile ) 10236.56
Mean Distribution
Standard Deviation 31.0553
95.00% Confidence Intervall ( 113140.43 - 113262.16 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2889
0.1 Scale Factor Error with Delta=300 82296
0.05 Scale Factor Error with Delta=300 329185
0.01 Scale Factor Error with Delta=300 8229632
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 113201.29

Damage

Sample Data
Count 9996
Mean 37697709.10

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 344.69
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=frost
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 3.00 blood_fury,if=time>=10
8 1.00 mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
9 15.00 auto_attack
A 6.60 use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
B 6.61 pillar_of_frost
C 4.00 raise_dead
D 6.85 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 18.52 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 1.59 howling_blast,if=!dot.frost_fever.ticking
H 6.13 plague_strike,if=!dot.blood_plague.ticking
I 5.36 plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
J 37.55 howling_blast,if=buff.rime.react
K 86.57 obliterate,if=runic_power<=76
L 0.12 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 117.09 frost_strike,if=!buff.killing_machine.react
N 0.86 obliterate,if=buff.killing_machine.react
O 0.00 blood_tap,if=talent.blood_tap.enabled
P 15.02 frost_strike
Q 11.58 horn_of_winter
R 1.25 empower_rune_weapon

Sample Sequence

9ABCDKJMKMMPM7KJKMMKMMKJKJMKJPKJKJMHMKPMMKMKMKMM9KMKJMKMKMMK9KMIABDPMKKJMMQKJPKJMPKPKJMMRKKMKMJ9MHMMQKMJPKJMKMKMMKMK9MQMKMCIABDKMMKMK7M9KJMKMQMKJMKJMHPKJMKMQMKJMKJ9MKMKMPKJ9MIABDKJKMMKMPKPKMKMMQKMKJPKMMKMKMHMKMJKMQM9KM9KJMKJMEKMMCKIABDJMEKJMK7JMMEMMKKJMEMKMMKME9MKMHJEKMMKMEMK9MQMEKMKMMEMKMIABDE8PQKMME9KMKJMMEKJMKMEMKMKHMEMMQMK9EPKMEPKMEGMM9CKIABDE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21600 19206 18080
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 12.44% 7.44% 4458
Spell Haste 21.27% 15.49% 6585
Mana Per 5 0 0 0
Attack Power 47795 38662 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 17.45% 12.45% 4458
Melee Haste 15.49% 15.49% 6585
Swing Speed 52.45% 38.59% 6585
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 6.18% 5.55% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 36.54% 26.54% 3163

Gear

Average Item Level: 507.73
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_haste
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=mastery_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160haste_80str_160haste_120crit,enchant=80all
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160haste_80str_160hit_160str_120haste,reforge=mastery_crit
Legs greaves_of_the_lost_catacomb,id=86916,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
Feet impaling_treads,id=86979,gems=80str_160haste_60hit,enchant=175haste,reforge=hit_crit
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader,reforge=mastery_haste
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Frost_2h_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#dZ!1...1.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=frost
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=10
actions+=/mogu_power_potion,if=target.time_to_die<=30|(target.time_to_die<=60&buff.pillar_of_frost.up)
actions+=/auto_attack
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=(frost>=1|death>=1)
actions+=/pillar_of_frost
actions+=/raise_dead
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/howling_blast,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&((cooldown.outbreak.remains<1)|(buff.rime.react&dot.blood_plague.remains<3&(unholy>=1|death>=1)))
actions+=/howling_blast,if=buff.rime.react
actions+=/obliterate,if=runic_power<=76
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/frost_strike,if=!buff.killing_machine.react
actions+=/obliterate,if=buff.killing_machine.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/frost_strike
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160haste_80str_160haste_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160haste_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=80str_160haste_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader,reforge=mastery_haste

# Gear Summary
# gear_strength=18080
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=4458
# gear_haste_rating=6585
# gear_mastery_rating=3163
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Death_Knight_Unholy_T14H : 112238 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
112237.6 112237.6 42.57 / 0.04% 3556 / 3.2% 13667.1 6.2 6.4 Runic Power 11.12% 61.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

Charts

http://5.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:226227|71577|59265|56519|13213&chds=0,452453&chco=9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++226227++soul_reaper,9482C9,0,0,15|t++71577++scourge_strike,C79C6E,1,0,15|t++59265++death_coil,9482C9,2,0,15|t++56519++festering_strike,C79C6E,3,0,15|t++13213++melee_main_hand,C79C6E,4,0,15&chtt=Death_Knight_Unholy_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,19,14,14,11,10,7,6,6,6,4,4,2&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,0070DE,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E&chl=scourge_strike|death_coil|melee_main_hand|soul_reaper|ghoul: melee|blood_plague|frost_fever|army_of_the_dead: melee|ghoul: sweeping_claws|festering_strike|gargoyle: gargoyle_strike|army_of_the_dead: claw|ghoul: claw&chtt=Death_Knight_Unholy_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vwy002223224457786654321zywusqponmkihffdcbaYYWWVVUUTTSTTTUUTUUTUUUUUVVWWXXXWWWWWVVVVVVVVUUUUUUTTTTTTSTTTSSSSSRRQRRQRRRSSSTTTTTTTTTUUVVVVUUUUUUTTTTUUUUUUUUTTTTTTTSSSSSSSRRQQPPPPPPQQRRSTTUUVVWXYZabccccdddcdccccbbbaaaZYXXWVVVUTTTTTTTTTSSTTUUVXXYYYYZZZZZZZaaabbaaZYYYYYYYXXXYYYYYXXXXXXYYYXYYYYYXXXWWWXXXXYYYYYYYYYYYYZZaaaaaaZZZZZZaaaaabaaaaaaaaaaaaabaaaaZZYZYYXXYXXWWVVU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=112238|max=266221&chxp=1,1,42,100&chtt=Death_Knight_Unholy_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,4,2,3,11,5,18,31,42,55,82,119,129,216,221,330,354,374,472,517,560,603,612,695,622,544,578,496,453,361,317,276,232,173,138,82,82,55,54,26,18,10,5,6,4,3,1,1,2&chds=0,695&chbh=5&chxt=x&chxl=0:|min=103968|avg=112238|max=120948&chxp=0,1,49,100&chtt=Death_Knight_Unholy_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.6,26.7,8.3,5.3,3.6,2.0,2.0,1.7,0.6,11.1&chds=0,100&chdls=ffffff&chco=C79C6E,9482C9,C79C6E,9482C9,C79C6E,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=scourge_strike 133.9s|death_coil 97.6s|festering_strike 30.3s|soul_reaper 19.4s|horn_of_winter 13.0s|dark_transformation 7.5s|outbreak 7.2s|plague_leech 6.2s|summon_gargoyle 2.3s|waiting 40.7s&chtt=Death_Knight_Unholy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Death_Knight_Unholy_T14H 112238
blood_fury 0 0.0% 4.0 120.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>=2
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_plague 8456 7.5% 6.9 60.62sec 447487 0 0 0 0 0.0% 0.0% 0.0% 0.0% 115.7 23683 47379 26739 12.9% 0.0% 94.9%

Stats details: blood_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 115.74 115.74 0.0000 3.0000 3094848.15 3094848.15 0.00 8913.07 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.8 87.10% 23683.26 19324 33635 23683.54 22016 25052 2387640 2387640 0.00
crit 14.9 12.90% 47378.80 38647 67270 47379.79 41102 55822 707208 707208 0.00
DPS Timeline Chart

Action details: blood_plague

Static Values
  • id:55078
  • school:shadow
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55078
  • name:Blood Plague
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage per $t1 sec.
  • description:A disease that deals Shadow damage every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:171.99
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
blood_tap 0 0.0% 37.1 9.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.07 37.07 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 37.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_tap

Static Values
  • id:45529
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.blood_tap.enabled
Spelldata
  • id:45529
  • name:Blood Tap
  • school:physical
  • tooltip:(null)
  • description:Each damaging Death Coil, Frost Strike, or Rune Strike generates 2 Blood Charges, up to a maximum of $114851u charges. Blood Tap consumes $114851s1 Blood Charges to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
dark_transformation 0 0.0% 7.2 50.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_transformation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.19 7.19 0.00 0.00 1.0375 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_transformation

Static Values
  • id:63560
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63560
  • name:Dark Transformation
  • school:shadow
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
death_coil 15807 14.1% 94.0 3.79sec 61517 59265 54104 111545 61517 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: death_coil

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.04 94.04 0.00 0.00 1.0380 0.0000 5785296.99 5785296.99 0.00 59264.65 59264.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.91 87.09% 54103.78 44204 76353 54104.16 51125 56437 4431503 4431503 0.00
crit 12.14 12.91% 111544.96 91061 157286 111536.14 97589 131568 1353794 1353794 0.00
DPS Timeline Chart

Action details: death_coil

Static Values
  • id:47541
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:32.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:runic_power>90
Spelldata
  • id:47541
  • name:Death Coil
  • school:shadow
  • tooltip:(null)
  • description:Fire a blast of unholy energy, causing $<damage> Shadow damage to an enemy target or healing $<healing> damage on a friendly Undead target$?s58677[. Refunds $58677s1 Runic Power when used to heal.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.496000
  • base_dd_min:1132.89
  • base_dd_max:1132.89
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
empower_rune_weapon 0 0.0% 1.6 307.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: empower_rune_weapon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.64 1.64 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: empower_rune_weapon

Static Values
  • id:47568
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:4.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<=60&buff.mogu_power_potion.up
Spelldata
  • id:47568
  • name:Empower Rune Weapon
  • school:physical
  • tooltip:(null)
  • description:Empower your rune weapon, immediately activating all your runes and generating 25 Runic Power.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:25.00
festering_strike 4673 4.2% 29.2 12.53sec 58655 56519 49310 101567 58655 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: festering_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.16 29.16 0.00 0.00 1.0378 0.0000 1710205.47 1710205.47 0.00 56518.90 56518.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.94 82.12% 49309.52 44846 58807 49308.47 47392 51127 1180627 1180627 0.00
crit 5.21 17.88% 101566.99 92383 121143 101253.39 0 121143 529579 529579 0.00
DPS Timeline Chart

Action details: festering_strike

Static Values
  • id:85948
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:blood=2&frost=2&runic_power<90
Spelldata
  • id:85948
  • name:Festering Strike
  • school:physical
  • tooltip:(null)
  • description:An instant attack that deals $m2% weapon damage plus $s1 and increases the duration of your Blood Plague, Frost Fever, and Chains of Ice effects on the target by up to $s3 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:539.65
  • base_dd_max:539.65
Rune Information
  • Blood Cost:1
  • Frost Cost:1
  • Unholy Cost:0
  • Runic Power Gain:20.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
frost_fever 5727 5.1% 6.9 60.62sec 303088 0 0 0 0 0.0% 0.0% 0.0% 0.0% 115.7 16038 32072 18111 12.9% 0.0% 94.9%

Stats details: frost_fever

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 115.74 115.74 0.0000 3.0000 2096176.50 2096176.50 0.00 6036.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.8 87.08% 16038.46 13077 22797 16038.53 14968 17104 1616409 1616409 0.00
crit 15.0 12.92% 32072.39 26153 45594 32075.35 27607 36694 479767 479767 0.00
DPS Timeline Chart

Action details: frost_fever

Static Values
  • id:55095
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:55095
  • name:Frost Fever
  • school:frost
  • tooltip:Suffering $w1 Frost damage every $t1 sec.
  • description:A disease that deals Frost damage every $t1 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.138000
  • base_td:143.32
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
horn_of_winter 0 0.0% 13.5 25.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: horn_of_winter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.53 13.53 0.00 0.00 0.9616 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: horn_of_winter

Static Values
  • id:57330
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:57330
  • name:Horn of Winter
  • school:physical
  • tooltip:Increases your attack power by $s1%.
  • description:The Death Knight blows the Horn of Winter, which generates 10 Runic Power and increases attack power of all party and raid members within $a1 yards by $s1%. Lasts $d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:10.00
melee_main_hand 12057 10.7% 154.5 2.36sec 28569 13213 25294 52091 28569 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.47 154.47 0.00 0.00 2.1622 0.0000 4412985.60 4412985.60 0.00 13213.20 13213.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.78 58.12% 25293.99 22880 30495 25293.74 24372 25898 2270895 2270895 0.00
crit 27.63 17.89% 52091.24 47132 62819 52090.13 49472 55184 1439107 1439107 0.00
glance 37.06 23.99% 18968.39 17160 22871 18967.63 18152 19782 702984 702984 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
outbreak 0 0.0% 6.9 60.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: outbreak

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: outbreak

Static Values
  • id:77575
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.frost_fever.remains<3|dot.blood_plague.remains<3
Spelldata
  • id:77575
  • name:Outbreak
  • school:shadow
  • tooltip:(null)
  • description:Instantly applies Blood Plague and Frost Fever to the target enemy.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
plague_leech 0 0.0% 6.0 60.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: plague_leech

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.98 5.98 0.00 0.00 1.0368 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: plague_leech

Static Values
  • id:123693
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
Spelldata
  • id:123693
  • name:Plague Leech
  • school:physical
  • tooltip:(null)
  • description:Draw forth the infection from an enemy, consuming your Blood Plague and Frost Fever diseases on the target to activate a random fully-depleted rune as a Death Rune.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
scourge_strike 26193 23.3% 129.0 2.81sec 74292 71577 33662 72541 37146 9.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: scourge_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 129.04 258.08 0.00 0.00 1.0379 0.0000 9586528.77 9586528.77 0.00 71577.05 71577.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 234.95 91.04% 33661.81 24822 67027 33671.21 31909 35923 7908762 7908762 0.00
crit 23.13 8.96% 72540.64 66154 86717 72540.44 68935 76793 1677767 1677767 0.00
DPS Timeline Chart

Action details: scourge_strike

Static Values
  • id:55090
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:unholy=2&runic_power<90
Spelldata
  • id:55090
  • name:Scourge Strike
  • school:physical
  • tooltip:(null)
  • description:An unholy strike that deals $s2% of weapon damage as Physical damage plus $s1. In addition, for each of your diseases on your target, you deal an additional $s3% of the Physical damage done as Shadow damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:588.25
  • base_dd_max:588.25
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
soul_reaper 12018 10.7% 18.7 7.31sec 234748 226227 25245 52004 30055 18.0% 0.0% 0.0% 0.0% 17.9 181279 373363 214298 17.8% 0.7% 24.4%

Stats details: soul_reaper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.74 18.74 17.90 17.90 1.0377 5.0000 4398526.55 4398526.55 0.00 40379.39 226226.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.37 82.02% 25244.50 22880 30495 25244.61 24109 26350 387984 387984 0.00
crit 3.37 17.98% 52003.75 47132 62819 50789.46 0 60516 175156 175156 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.6 81.54% 181279.22 161106 215877 181287.44 170738 192315 2645487 2645487 0.00
crit 3.2 17.81% 373363.27 331878 444706 362935.47 0 444706 1189899 1189899 0.00
dodge 0.1 0.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_reaper

Static Values
  • id:130736
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
Spelldata
  • id:130736
  • name:Soul Reaper
  • school:physical
  • tooltip:Deals heavy Shadow damage if the target is below 35% health upon expiration. If the target dies while this effect is present, the Death Knight gains $114868s1% haste for $114868d.
  • description:Strikes an enemy for $s1% weapon damage and afflicts the target with Soul Reaper. After $d, if the target is below 35% health, this effect will deal $114867s1 additional Shadow damage. If the enemy dies before this effect triggers, the Death Knight gains $114868s1% haste for $114868d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:1
  • Runic Power Gain:10.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: soul_reaper_dot

Static Values
  • id:114867
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114867
  • name:Soul Reaper
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc114866
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:46113.05
  • base_dd_max:53590.84
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
summon_gargoyle 0 0.0% 2.2 181.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_gargoyle

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.25 2.25 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_gargoyle

Static Values
  • id:49206
  • school:shadow
  • resource:runic_power
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:49206
  • name:Summon Gargoyle
  • school:shadow
  • tooltip:Under attack from a Gargoyle.
  • description:A Gargoyle flies into the area and bombards the target with Nature damage modified by the Death Knight's attack power. Persists for $61777d.
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
unholy_frenzy 0 0.0% 2.5 180.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unholy_frenzy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.51 2.51 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.51 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unholy_frenzy

Static Values
  • id:49016
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Death_Knight_Unholy_T14H
  • harmful:false
  • if_expr:time>=4
Spelldata
  • id:49016
  • name:Unholy Frenzy
  • school:physical
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
Rune Information
  • Blood Cost:0
  • Frost Cost:0
  • Unholy Cost:0
  • Runic Power Gain:0.00
pet - gargoyle 22433 / 3688
gargoyle_strike 22433 3.3% 25.0 8.57sec 53932 25715 45800 91481 53932 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: gargoyle_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.03 25.03 0.00 0.00 2.0973 0.0000 1349751.81 1349751.81 0.00 25714.95 25714.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.57 82.20% 45799.74 34953 60918 45799.87 40706 49889 942152 942152 0.00
crit 4.46 17.80% 91480.62 69907 121836 90821.84 0 121836 407599 407599 0.00
DPS Timeline Chart

Action details: gargoyle_strike

Static Values
  • id:51963
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:51963
  • name:Gargoyle Strike
  • school:nature
  • tooltip:(null)
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.826000
  • base_dd_min:623.15
  • base_dd_max:623.15
pet - ghoul 15850 / 15850
claw 2006 1.8% 61.4 6.12sec 11966 0 10139 20297 11966 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.35 61.35 0.00 0.00 0.0000 0.0000 734161.13 734161.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.32 82.02% 10139.45 6596 18159 10140.30 9159 11132 510217 510217 0.00
crit 11.03 17.98% 20296.68 13192 33784 20298.53 16220 26384 223944 223944 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 9168 8.2% 283.8 1.29sec 11822 9834 10565 21128 11822 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 283.82 283.82 0.00 0.00 1.2022 0.0000 3355319.28 3355319.28 0.00 9833.50 9833.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 164.92 58.10% 10564.68 5277 17458 10564.61 9718 11291 1742280 1742280 0.00
crit 50.81 17.90% 21127.70 10554 34916 21127.12 18629 24320 1073397 1073397 0.00
glance 68.10 24.00% 7923.79 3958 13094 7923.66 7054 8948 539642 539642 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
sweeping_claws 4676 4.2% 78.3 4.30sec 21855 21053 18543 37077 21855 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sweeping_claws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.31 78.31 0.00 0.00 1.0381 0.0000 1711438.41 1711438.41 0.00 21053.23 21053.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.31 82.13% 18542.66 15831 26187 18542.05 17405 19599 1192524 1192524 0.00
crit 14.00 17.87% 37077.26 31662 52374 37074.21 33464 42652 518915 518915 0.00
DPS Timeline Chart

Action details: sweeping_claws

Static Values
  • id:91778
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91778
  • name:Sweeping Claws
  • school:physical
  • tooltip:(null)
  • description:Rakes an enemy with deformed claws, dealing $91778s1% of normal damage to the target and up to ${$91778x1-1} additional targets.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
pet - army_of_the_dead 81250 / 7770
claw 32349 2.8% 175.8 1.70sec 6441 0 5461 10924 6441 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.79 175.79 0.00 0.00 0.0000 0.0000 1132216.58 1132216.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.26 82.06% 5460.85 4123 6820 5460.81 4891 5730 787784 787784 0.00
crit 31.53 17.94% 10923.95 8245 13639 10924.72 9374 12175 344432 344432 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:91776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:91776
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, dealing $s1% of normal melee damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
melee 48901 4.2% 345.9 0.78sec 4948 6204 4425 8848 4948 17.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 345.89 345.89 0.00 0.00 0.7975 0.0000 1711520.19 1711520.19 0.00 6204.28 6204.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 200.76 58.04% 4424.65 3298 5456 4424.65 3936 4631 888307 888307 0.00
crit 61.78 17.86% 8848.24 6596 10911 8848.72 7713 9777 546653 546653 0.00
glance 83.35 24.10% 3318.18 2474 4092 3318.19 2919 3594 276560 276560 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_charge 17.5 76.5 20.7sec 3.8sec 85.18% 85.18%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_charge
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • blood_charge_1:14.3%
  • blood_charge_2:18.3%
  • blood_charge_3:17.9%
  • blood_charge_4:19.7%
  • blood_charge_5:6.6%
  • blood_charge_6:6.6%
  • blood_charge_7:0.7%
  • blood_charge_8:0.6%
  • blood_charge_9:0.2%
  • blood_charge_10:0.1%
  • blood_charge_11:0.1%
  • blood_charge_12:0.1%

Spelldata details

  • id:114851
  • name:Blood Charge
  • tooltip:Stored blood energy. Blood Tap consumes 5 Blood Charges to activate a random fully-depleted rune as a Death Rune.
  • description:$@spelldesc45529
  • max_stacks:12
  • duration:25.00
  • cooldown:0.00
  • default_chance:1.01%
blood_fury 4.0 0.0 120.6sec 120.6sec 12.90% 12.90%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:12.9%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 27.02%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_transformation 7.2 0.0 50.3sec 50.3sec 57.23% 56.49%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_dark_transformation
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_transformation_1:57.2%

Spelldata details

  • id:63560
  • name:Dark Transformation
  • tooltip:Transformed into an undead monstrosity. Damage dealt increased by $s1%.
  • description:Consume 5 charges of Shadow Infusion on your Ghoul to transform it into a powerful undead monstrosity for $d. The Ghoul's abilities are empowered and take on new functions while the transformation is active.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
darkmist_vortex 5.9 0.0 67.2sec 67.2sec 31.61% 31.61%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.6%
mogu_power_potion 2.0 0.0 334.1sec 0.0sec 11.98% 11.98%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.0%
relic_of_xuen 7.8 0.0 50.2sec 50.2sec 31.18% 31.18%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.2%
rune_of_the_fallen_crusader 8.1 31.7 46.1sec 9.0sec 80.49% 79.65%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_rune_of_the_fallen_crusader
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_the_fallen_crusader_1:80.5%
shadow_infusion 7.7 31.4 50.0sec 9.1sec 36.69% 37.32%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_shadow_infusion
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_infusion_1:8.0%
  • shadow_infusion_2:8.3%
  • shadow_infusion_3:8.4%
  • shadow_infusion_4:8.0%
  • shadow_infusion_5:4.0%

Spelldata details

  • id:91342
  • name:Shadow Infusion
  • tooltip:$?$w3>0[Pet damage dealt increased by $s1%.][Damage dealt increased by $s1%.]
  • description:Grants your successful Death Coils a chance to empower your active Ghoul, increasing its damage dealt by $91342s1% for $91342d. Stacks up to 5 times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
sudden_doom 27.4 0.4 13.0sec 13.0sec 6.82% 6.82%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_sudden_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • sudden_doom_1:6.8%

Spelldata details

  • id:81340
  • name:Sudden Doom
  • tooltip:Your next Death Coil consumes no Runic Power.
  • description:Your autoattacks have a chance to cause your next Death Coil to consume no Runic Power.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 6.0 0.0 60.5sec 60.5sec 16.40% 16.40%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.4%
unholy_frenzy 2.5 0.0 180.8sec 180.8sec 16.46% 100.00%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_frenzy
  • max_stacks:1
  • duration:30.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unholy_frenzy_1:16.5%

Spelldata details

  • id:49016
  • name:Unholy Frenzy
  • tooltip:Melee and ranged haste increased by $w1%.$?$w2!=0[ Suffering damage equal to $w2% of maximum health every $t2 sec.][]
  • description:Incites a friendly party or raid member into a killing frenzy for $d, increasing the target's melee and ranged haste by $s1%$?s58616[][, but causing them to lose health equal to $s2% of their maximum health every $t2 sec].
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:0.00%
unholy_presence 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H
  • cooldown name:buff_unholy_presence
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • unholy_presence_1:100.0%

Spelldata details

  • id:48265
  • name:Unholy Presence
  • tooltip:Attack speed and rune regeneration increased by $w1%. Movement speed increased by $s2%.
  • description:You are infused with unholy fury, increasing attack speed and rune regeneration by $s1%, and movement speed by $s2%. Only one Presence may be active at a time, and assuming a new Presence will consume $?s58647[${(100-$58647m1)}% of][any] stored Runic Power.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
ghoul-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Death_Knight_Unholy_T14H_ghoul
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Death_Knight_Unholy_T14H
death_coil Runic Power 94.0 2139.7 22.8 22.8 2703.8
summon_gargoyle Runic Power 2.2 134.7 60.0 60.0 0.0
pet - ghoul
claw Energy 61.4 2454.1 40.0 40.0 299.2
sweeping_claws Energy 78.3 3132.3 40.0 40.0 546.4
pet - army_of_the_dead
claw Energy 175.8 7031.6 40.0 40.0 161.0
Resource Gains Type Count Total Average Overflow
rp_horn_of_winter Runic Power 13.53 135.32 10.00 0.00 0.00%
rp_army_of_the_dead Runic Power 1.00 30.00 30.00 0.00 0.00%
rp_soul_reaper Runic Power 18.74 186.64 9.96 0.73 0.39%
rp_dark_transformation Runic Power 7.19 70.85 9.85 1.05 1.46%
rp_empower_rune_weapon Runic Power 1.64 40.90 24.99 0.01 0.03%
rp_scourge_strike Runic Power 129.04 1290.38 10.00 0.00 0.00%
rp_festering_strike Runic Power 29.16 575.39 19.73 7.76 1.33%
rune_regen_all None 4578.94 161.91 0.04 8.13 4.78%
rune_regen_unholy None 1496.14 55.56 0.04 1.20 2.11%
rune_regen_blood None 1566.60 51.83 0.03 4.75 8.39%
rune_regen_frost None 1516.20 54.52 0.04 2.18 3.85%
empower_rune_weapon Rune 1.64 5.89 3.60 3.93 40.02%
blood_tap Rune 37.07 37.07 1.00 0.00 0.00%
blood_tap_blood Rune 7.89 7.89 1.00 0.00 0.00%
blood_tap_frost Rune 8.98 8.98 1.00 0.00 0.00%
blood_tap_unholy Rune 20.19 20.19 1.00 0.00 0.00%
plague_leech Rune 5.87 5.87 1.00 0.00 0.00%
pet - ghoul
energy_regen Energy 1463.00 5501.34 3.76 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
pet - army_of_the_dead
energy_regen Energy 139.00 794.35 5.71 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Runic Power 6.36 6.21
Combat End Resource Mean Min Max
Health -6346146.00 -6346146.00 -6346146.00
Runic Power 55.16 0.00 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 59.6 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 112237.64
Minimum 103967.52
Maximum 120947.71
Spread ( max - min ) 16980.18
Range [ ( max - min ) / 2 * 100% ] 7.56%
Standard Deviation 2171.5205
5th Percentile 108707.40
95th Percentile 115818.53
( 95th Percentile - 5th Percentile ) 7111.14
Mean Distribution
Standard Deviation 21.7195
95.00% Confidence Intervall ( 112195.07 - 112280.21 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1437
0.1 Scale Factor Error with Delta=300 40254
0.05 Scale Factor Error with Delta=300 161016
0.01 Scale Factor Error with Delta=300 4025423
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 112237.64

Damage

Sample Data
Count 9996
Mean 31084568.02

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 373.08
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 presence,choose=unholy
3 0.00 horn_of_winter
4 0.00 army_of_the_dead
5 0.00 snapshot_stats
6 0.00 raise_dead
7 0.00 mogu_power_potion
Default action list
# count action,conditions
8 4.00 blood_fury,if=time>=2
9 1.00 mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
A 15.00 auto_attack
B 2.51 unholy_frenzy,if=time>=4
C 6.04 use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
D 6.92 outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
E 18.74 soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
F 0.00 unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
G 0.00 icy_touch,if=!dot.frost_fever.ticking
H 0.00 plague_strike,if=!dot.blood_plague.ticking
I 5.98 plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
J 2.25 summon_gargoyle
K 7.19 dark_transformation
L 0.17 empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
M 2.05 scourge_strike,if=unholy=2&runic_power<90
N 3.55 festering_strike,if=blood=2&frost=2&runic_power<90
O 12.09 death_coil,if=runic_power>90
P 17.74 death_coil,if=buff.sudden_doom.react
Q 37.07 blood_tap,if=talent.blood_tap.enabled
R 126.99 scourge_strike
S 25.61 festering_strike
T 64.21 death_coil,if=cooldown.summon_gargoyle.remains>8
U 12.53 horn_of_winter
V 1.47 empower_rune_weapon

Sample Sequence

ADR8SJBCRSTVMNRPRROQRRRORRRPKOOORNOORQRNORQRROQRRRORRATQRRTTSUTRQRASIDRRRCTRROQRRTTUKPPQRRTQRSTRTTQRSRRATRTQRRPRUTRTQRRTSPQRTRTASTKQRRID8RPRCRRTQRTRTURATQRSTRSTQRRRTRURRTRRTQRPSPKQRTASTRTQRRURAIDRJBRCRRTRTQRSRTSTURPQRPRRRTQRRRRTTSTKQRPUTQRRASRATRRTRETQRRID8ESRCPTQRTTSUETQRRTRERTQKREAUSTEPTQRSTEARRTEQRRTUREPIDERSCTQRSTETQRPKARTEPQRRTRUETQRVMNR9PSOTQERRRTTPAQERRRTUESTQRTESAID8RB

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 25042 22280 18240
Agility 218 208 80
Stamina 22694 20631 20440
Intellect 121 115 80
Spirit 151 151 80
Health 464119 435237 0
Runic Power 100 100 0
Spell Power 0 0 0
Spell Hit 15.44% 15.44% 2570
Spell Crit 15.89% 10.88% 6524
Spell Haste 14.46% 9.01% 3831
Mana Per 5 0 0 0
Attack Power 55367 44810 0
Melee Hit 7.56% 7.56% 2570
Melee Crit 20.90% 15.89% 6524
Melee Haste 30.82% 9.01% 3831
Swing Speed 43.90% 9.01% 3831
Expertise 7.88% 7.88% 2340
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 7.07% 6.36% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.23% 34.73% 3531

Gear

Average Item Level: 507.73
Head helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_crit
Neck shackle_of_eversparks,id=90508,reforge=hit_crit
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=mastery_haste
Shirt empty
Chest breastplate_of_the_lost_catacomb,id=86913,gems=80str_160crit_80str_160crit_120crit,enchant=80all
Waist waistplate_of_overwhelming_assault,id=86955,gems=80str_160crit_80str_160hit_160str_120haste,reforge=mastery_crit
Legs greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit,reforge=mastery_crit
Feet impaling_treads,id=86979,gems=80str_160crit_60hit,enchant=175haste,reforge=hit_crit
Wrists bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
Hands gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii
Finger1 ring_of_the_bladed_tempest,id=86957,enchant=160str
Finger2 dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=haste_crit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Roiling Blood Plague Leech Unholy Blight
30 Lichborne Anti-Magic Zone Purgatory
45 Death's Advance Chilblains Asphyxiate
60 Death Pact Death Siphon Conversion
75 Blood Tap Runic Empowerment Runic Corruption
90 Gorefiend's Grasp Remorseless Winter Desecrated Ground

Profile

#!./simc

deathknight="Death_Knight_Unholy_T14H"
origin="unknown"
level=90
race=orc
spec=unholy
role=attack
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#db!1...0.

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/presence,choose=unholy
actions.precombat+=/horn_of_winter
actions.precombat+=/army_of_the_dead
actions.precombat+=/snapshot_stats
actions.precombat+=/raise_dead
actions.precombat+=/mogu_power_potion

actions=blood_fury,if=time>=2
actions+=/mogu_power_potion,if=buff.dark_transformation.up&target.time_to_die<=35
actions+=/auto_attack
actions+=/unholy_frenzy,if=time>=4
actions+=/use_item,name=gauntlets_of_the_lost_catacomb,if=time>=4
actions+=/outbreak,if=dot.frost_fever.remains<3|dot.blood_plague.remains<3
actions+=/soul_reaper,if=target.health.pct<=35|((target.health.pct-3*(target.health.pct%target.time_to_die))<=35)
actions+=/unholy_blight,if=talent.unholy_blight.enabled&(dot.frost_fever.remains<3|dot.blood_plague.remains<3)
actions+=/icy_touch,if=!dot.frost_fever.ticking
actions+=/plague_strike,if=!dot.blood_plague.ticking
actions+=/plague_leech,if=talent.plague_leech.enabled&(cooldown.outbreak.remains<1)
actions+=/summon_gargoyle
actions+=/dark_transformation
actions+=/empower_rune_weapon,if=target.time_to_die<=60&buff.mogu_power_potion.up
actions+=/scourge_strike,if=unholy=2&runic_power<90
actions+=/festering_strike,if=blood=2&frost=2&runic_power<90
actions+=/death_coil,if=runic_power>90
actions+=/death_coil,if=buff.sudden_doom.react
actions+=/blood_tap,if=talent.blood_tap.enabled
actions+=/scourge_strike
actions+=/festering_strike
actions+=/death_coil,if=cooldown.summon_gargoyle.remains>8
actions+=/horn_of_winter
actions+=/empower_rune_weapon

head=helmet_of_the_lost_catacomb,id=86915,gems=reverberating_primal_80str_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160str_60str,enchant=200str_100crit,reforge=mastery_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=haste_crit
chest=breastplate_of_the_lost_catacomb,id=86913,gems=80str_160crit_80str_160crit_120crit,enchant=80all
wrists=bracers_of_defiled_earth,id=90506,enchant=180str,reforge=hit_haste
hands=gauntlets_of_the_lost_catacomb,id=86914,enchant=170str,addon=synapse_springs_mark_ii
waist=waistplate_of_overwhelming_assault,id=86955,gems=80str_160crit_80str_160hit_160str_120haste,reforge=mastery_crit
legs=greaves_of_the_lost_catacomb,id=86916,gems=160str_60str,enchant=285str_165crit,reforge=mastery_crit
feet=impaling_treads,id=86979,gems=80str_160crit_60hit,enchant=175haste,reforge=hit_crit
finger1=ring_of_the_bladed_tempest,id=86957,enchant=160str
finger2=dread_shadow_ring,id=87158,enchant=160str,reforge=hit_haste
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=rune_of_the_fallen_crusader

# Gear Summary
# gear_strength=18240
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2340
# gear_hit_rating=2570
# gear_crit_rating=6524
# gear_haste_rating=3831
# gear_mastery_rating=3531
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gauntlets_of_the_lost_catacomb,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=rune_of_the_fallen_crusader

Druid_Balance_T14H : 97993 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
97993.4 97993.4 50.34 / 0.05% 4228 / 4.3% 23.5 4161.1 4082.4 Mana 0.00% 43.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
Glyphs
  • moonbeast

Charts

http://5.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:313803|148029|76117|48904&chds=0,627605&chco=69CCF0,8AD0B1,69CCF0,ABD473&chm=t++313803++starfall,69CCF0,0,0,15|t++148029++starsurge,8AD0B1,1,0,15|t++76117++starfire,69CCF0,2,0,15|t++48904++wrath,ABD473,3,0,15&chtt=Druid_Balance_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:28,18,14,13,13,12,0&chds=0,100&chdls=ffffff&chco=69CCF0,8AD0B1,ABD473,69CCF0,ABD473,69CCF0,ABD473&chl=starfire|starsurge|wrath|moonfire|sunfire|starfall|wild_mushroom_detonate&chtt=Druid_Balance_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:mmpqstuvwxx0134568310yxuspnljhedcbaYWUTSSRRSSSTTSSSSSSRRRRSSRRRRRQQQQRRQQQQQRRSSSSSSSSSSSSSSRRRQQQPPPPPPPOONOOOOOPPPQQRRSSSSSSRSSSSSRRRRRQQQPPPPPPPQQQRRSSSTTTTTTTSSSSSRRRQQPOOOOOOOPPQRSTUVWYZacdfghijjklmmmmmllkjihgfdcbZXWUTSRRQQPPOONNNNNOOPPQQQQRRRRRRRSSSSSSSSRRRRQQQQQQRRRRRRRRRRRRRSSSSRRRRQQQQPPQQPPPPPPOOOOPPPQQQRRRSSSSTTTTTTUUTTTSSRRQQQQQQQQQQQQQQPPPQQRRRRRRRRRQ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=97993|max=279603&chxp=1,1,35,100&chtt=Druid_Balance_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,11,13,16,18,32,50,60,76,115,141,153,194,253,321,339,391,403,454,532,537,570,550,587,546,504,466,482,440,344,291,279,192,156,130,84,82,65,33,26,18,11,14,6,3,4,0,0,0,2&chds=0,587&chbh=5&chxt=x&chxl=0:|min=89731|avg=97993|max=108095&chxp=0,1,45,100&chtt=Druid_Balance_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:36.4,28.8,11.9,6.4,5.9,3.9,0.8&chds=0,100&chdls=ffffff&chco=69CCF0,ABD473,8AD0B1,69CCF0,ABD473,69CCF0,C79C6E&chl=starfire 133.4s|wrath 105.5s|starsurge 43.4s|moonfire 23.5s|sunfire 21.5s|starfall 14.3s|incarnation 2.8s&chtt=Druid_Balance_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Balance_T14H 97993
berserking 0 0.0% 3.0 181.15sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
moonfire 13136 13.4% 21.4 17.13sec 224418 204157 15814 33095 19728 22.6% 0.0% 0.0% 0.0% 256.7 13721 28608 17084 22.6% 0.0% 94.7%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.42 21.42 256.68 256.68 1.0992 1.3501 4807704.79 4807704.79 0.00 12989.90 204157.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.57 77.35% 15814.05 9490 45373 15810.00 12874 18387 262058 262058 0.00
crit 4.85 22.65% 33094.92 19549 71332 32947.68 0 56034 160568 160568 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.7 77.41% 13721.12 9072 26274 13721.13 12738 14800 2726516 2726516 0.00
crit 58.0 22.59% 28608.33 18688 54124 28607.00 23232 34021 1658562 1658562 0.00
DPS Timeline Chart

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:Burns the enemy for $s2 Arcane damage and then an additional $o1 Arcane damage over $d.$?s79577[ Your Starfire and Starsurge critical strikes on the target will extend your Moonfire's duration by $8921t1 sec.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
starfall 12229 12.5% 13.0 31.00sec 344967 313803 0 0 0 0.0% 0.0% 0.0% 0.0% 128.8 27865 58170 34762 22.8% 0.0% 35.2%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.97 12.97 128.75 128.75 1.0993 1.0000 4475765.09 4475765.09 0.00 31295.55 313802.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.5 77.24% 27865.25 15267 44014 27864.17 26103 29658 2771207 2771207 0.00
crit 29.3 22.76% 58170.05 31450 90668 58178.53 48318 70820 1704558 1704558 0.00
DPS Timeline Chart

Action details: starfall

Static Values
  • id:48505
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:19560.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.starfall.up
Spelldata
  • id:48505
  • name:Starfall
  • school:arcane
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: starfall_star

Static Values
  • id:50288
  • school:arcane
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:50288
  • name:Starfall
  • school:arcane
  • tooltip:(null)
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.330000
  • base_dd_min:533.66
  • base_dd_max:620.20
starfire 27742 28.3% 72.5 4.95sec 140084 76117 112305 234261 140084 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.48 72.48 0.00 0.00 1.8404 0.0000 10153634.40 10153634.40 0.00 76117.05 76117.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.97 77.22% 112304.96 68839 197774 112288.75 99947 126407 6286033 6286033 0.00
crit 16.51 22.78% 234260.90 141808 407415 234259.10 163648 312973 3867602 3867602 0.00
DPS Timeline Chart

Action details: starfire

Static Values
  • id:2912
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:0.00
  • base_execute_time:2.70
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse>=60&eclipse_dir>=0
Spelldata
  • id:2912
  • name:Starfire
  • school:arcane
  • tooltip:(null)
  • description:Causes $s1 Arcane damage to the target.$?s78674[ Generates $s2 Solar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.759000
  • base_dd_min:3466.63
  • base_dd_max:4457.10
starsurge 17547 17.9% 37.5 9.63sec 171468 148029 138181 287716 172075 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.45 37.32 0.00 0.00 1.1583 0.0000 6422229.19 6422229.19 0.00 148028.79 148028.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.86 77.33% 138181.23 83054 238890 138191.80 118647 159317 3988303 3988303 0.00
crit 8.46 22.67% 287715.64 171091 492113 287760.19 175927 492113 2433926 2433926 0.00
DPS Timeline Chart

Action details: starsurge

Static Values
  • id:78674
  • school:spellstorm
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6180.0
  • cooldown:15.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78674
  • name:Starsurge
  • school:spellstorm
  • tooltip:(null)
  • description:You fuse the power of the moon and sun, launching a devastating blast of energy at the target. Causes $78674s1 Spellstorm damage to the target and generates $78674s2 Lunar or Solar energy, whichever is more beneficial to you.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.133000
  • base_dd_min:3731.12
  • base_dd_max:5147.21
sunfire 12842 13.1% 21.4 17.25sec 220140 218525 15639 32611 19479 22.6% 0.0% 0.0% 0.0% 253.4 13606 28240 16909 22.6% 0.0% 93.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.35 21.35 253.38 253.38 1.0074 1.3537 4700262.95 4700262.95 0.00 12894.35 218525.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.52 77.37% 15639.18 9490 27201 15640.85 12314 18409 258359 258359 0.00
crit 4.83 22.63% 32611.05 19549 56034 32542.05 0 56034 157552 157552 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 196.2 77.43% 13605.90 9072 26274 13604.71 12147 14841 2669464 2669464 0.00
crit 57.2 22.57% 28240.32 18688 54124 28237.90 23471 34094 1614888 1614888 0.00
DPS Timeline Chart

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5400.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $s1 Nature damage every $t1 seconds.
  • description:Burns the enemy for $s2 Nature damage and then an additional $o1 Nature damage over $d. Your Wrath and Starsurge critical strikes on the target will extend your Sunfire's duration by $93402t1 sec.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.240000
  • base_dd_min:562.59
  • base_dd_max:687.61
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:262.74
  • num_ticks:8
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
wild_mushroom_detonate 395 0.4% 1.0 1.#Rsec 144719 0 28421 58997 36180 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_mushroom_detonate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 4.00 0.00 0.00 0.0000 0.0000 144719.30 144719.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.98 74.62% 28421.26 0 38054 28313.32 0 38054 84837 84837 0.00
crit 1.02 25.38% 58996.71 0 78392 40728.40 0 78392 59882 59882 0.00
DPS Timeline Chart

Action details: wild_mushroom_detonate

Static Values
  • id:88751
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:6120.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.wild_mushroom.stack>0&buff.solar_eclipse.up
Spelldata
  • id:88751
  • name:Wild Mushroom: Detonate
  • school:nature
  • tooltip:(null)
  • description:Detonates all of your Wild Mushrooms, dealing $78777s1 Nature damage to all nearby targets within $78777A1 yards, and creating a Fungal Growth in each mushroom's wake covering an area within 8 yards, slowing all enemy targets by $81281s1%, and lasting $81283d.
wrath 14102 14.4% 75.1 4.73sec 68690 48904 55600 114749 68754 22.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.14 75.07 0.00 0.00 1.4046 0.0000 5161256.77 5161256.77 0.00 48904.25 48904.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.37 77.76% 55599.90 40117 115304 55578.65 51254 61443 3245625 3245625 0.00
crit 16.69 22.24% 114748.50 82640 227201 114711.01 85395 139878 1915632 1915632 0.00
DPS Timeline Chart

Action details: wrath

Static Values
  • id:5176
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5040.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:eclipse<=-70&eclipse_dir<=0
Spelldata
  • id:5176
  • name:Wrath
  • school:nature
  • tooltip:(null)
  • description:Causes $s1 Nature damage to the target. $?s78674[Generates $s2 Lunar Energy.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.027000
  • base_dd_min:1966.56
  • base_dd_max:2528.44

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 6.16% 7.83%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.2%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.82%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
celestial_alignment 2.0 0.0 187.5sec 187.5sec 8.20% 8.20%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • celestial_alignment_1:8.2%

Spelldata details

  • id:112071
  • name:Celestial Alignment
  • tooltip:Damage done by your Nature and Arcane spells increased by $w1%. Cannot gain Lunar or Solar Energy.
  • description:Grants you the simultaneous damage benefit of both your Lunar Eclipse and Solar Eclipse, increasing damage done by your Nature and Arcane spells by $s1%. In addition, casting Moonfire also applies the the periodic damage effect of Sunfire to your target. Activating this ability consumes all Lunar and Solar Energy and prevents gaining more during its duration. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
chosen_of_elune 2.7 0.0 180.9sec 180.9sec 16.81% 26.44%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chosen_of_elune_1:16.8%

Spelldata details

  • id:122114
  • name:Chosen of Elune
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 63.1sec 63.1sec 32.78% 32.78%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
jade_serpent_potion 2.0 0.0 200.0sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 54.8sec 54.8sec 22.86% 22.94%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
lunar_eclipse 10.9 0.0 35.1sec 35.1sec 41.83% 79.89%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_eclipse_1:41.8%

Spelldata details

  • id:48518
  • name:Eclipse (Lunar)
  • tooltip:Damage done by your Arcane spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Arcane spells by $s1%. Cancelled when Starfire causes Lunar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
lunar_shower 29.1 11.7 12.6sec 8.9sec 28.35% 22.31%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_lunar_shower
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • lunar_shower_1:18.8%
  • lunar_shower_2:9.6%
  • lunar_shower_3:0.0%

Spelldata details

  • id:81192
  • name:Lunar Shower
  • tooltip:Direct damage of your Moonfire and Sunfire increased by $s1%, and mana cost reduced by $s2%.
  • description:When you cast Moonfire or Sunfire, you gain Lunar Shower. Lunar Shower increases the direct damage done by your Moonfire and Sunfire spells by $81192s1%, and reduces the mana cost by $81192s2%. This effect stacks up to 3 times and lasts $81192d.
  • max_stacks:3
  • duration:3.00
  • cooldown:0.00
  • default_chance:1.01%
moonkin_form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • moonkin_form_1:100.0%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by $24905s3%. Immune to Polymorph effects. All damage taken reduced by $24905s1%.
  • description:Shapeshift into $?s114301[Astral Form][Moonkin Form], increasing Arcane and Nature damage you deal by $24905s3% and reducing all damage you take by $24905s1%.$?s116209[][ The Druid cannot cast healing spells while shapeshifted.] While in this form, you increase the spell haste of all party and raid members within $24907a1 yards by $24907s1%. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
natures_grace 17.8 3.3 20.9sec 17.5sec 82.93% 82.93%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_grace
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_grace_1:82.9%

Spelldata details

  • id:16886
  • name:Nature's Grace
  • tooltip:Spell casting speed increased by $s1%.
  • description:You gain $s1% spell haste each time you trigger an Eclipse.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
natures_vigil 2.7 0.0 180.8sec 180.8sec 16.61% 26.41%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_natures_vigil
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • natures_vigil_1:16.6%

Spelldata details

  • id:124974
  • name:Nature's Vigil
  • tooltip:Damage and healing done increased by $s1%. $s3% of single-target damage done heals a nearby target and $s3% of single-target healing done damages a nearby target.
  • description:Increases all damage and healing done by $s1% for $d. While active, all single-target healing spells also damage a nearby enemy target for $s3% of the healing done, and all single-target damage spells and abilities also heal a nearby friendly target for $s3% of the damage done.
  • max_stacks:
  • duration:30.00
  • cooldown:180.00
  • default_chance:1.00%
relic_of_yulon 7.3 0.0 52.3sec 52.3sec 28.88% 28.88%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.9%
shooting_stars 30.2 4.3 11.7sec 10.2sec 15.90% 78.53%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_shooting_stars
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • shooting_stars_1:15.9%

Spelldata details

  • id:93400
  • name:Shooting Stars
  • tooltip:Your next Starsurge spell is instant cast.
  • description:You have a $93399h% chance when you deal critical periodic damage with your Moonfire or Sunfire to instantly reset the cooldown of your Starsurge and cause its next cast within $93400d to be instant.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
solar_eclipse 11.1 0.0 32.4sec 32.4sec 37.29% 58.35%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_solar_eclipse
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • solar_eclipse_1:37.3%

Spelldata details

  • id:48517
  • name:Eclipse (Solar)
  • tooltip:Damage done by your Nature spells increased by $w1%. Cancelled when Balance Energy reaches 0.
  • description:Increases damage done by your Nature spells by $s1%. Cancelled when Wrath causes Solar Energy to reach 0.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
starfall 13.0 0.0 29.3sec 31.0sec 35.21% 35.21%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_starfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • starfall_1:35.2%

Spelldata details

  • id:48505
  • name:Starfall
  • tooltip:Summoning stars from the sky.
  • description:You summon a flurry of stars from the sky on all targets within $50286a yards of the caster that you're in combat with, each dealing $50288s1 Arcane damage. Maximum $48505s2 stars. Lasts $48505d. Triggering a Lunar Eclipse resets the cooldown of this spell. Shapeshifting into an animal form or mounting cancels the effect. Any effect which causes you to lose control of your character will suppress the Starfall effect.
  • max_stacks:
  • duration:10.00
  • cooldown:90.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Druid_Balance_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Balance_T14H
moonfire Mana 21.4 99026.5 4622.4 4622.4 48.5
starfall Mana 13.0 253781.0 19560.0 19560.0 17.6
starfire Mana 72.5 447943.0 6180.0 6180.0 22.7
starsurge Mana 37.5 231468.7 6180.0 6180.0 27.7
sunfire Mana 21.4 105940.7 4961.8 4961.8 44.4
wild_mushroom_detonate Mana 1.0 6120.0 6120.0 6120.0 23.6
wrath Mana 75.1 378698.8 5040.0 5040.0 13.6
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 545015.48 372.53 3609.52 0.66%
eclipse Mana 21.16 949133.24 44855.99 1272620.96 57.28%
incoming_damage Rage 152.00 100.00 0.66 178.49 64.09%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 4082.37 4161.14
Rage 0.27 0.00
Combat End Resource Mean Min Max
Health -6347588.00 -6347588.00 -6347588.00
Mana 271827.23 249240.00 300000.00
Rage 100.00 100.00 100.00
Energy 100.00 100.00 100.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 115.2 3.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 97993.37
Minimum 89731.10
Maximum 108095.26
Spread ( max - min ) 18364.16
Range [ ( max - min ) / 2 * 100% ] 9.37%
Standard Deviation 2567.9352
5th Percentile 93698.36
95th Percentile 102154.94
( 95th Percentile - 5th Percentile ) 8456.58
Mean Distribution
Standard Deviation 25.6845
95.00% Confidence Intervall ( 97943.03 - 98043.71 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2637
0.1 Scale Factor Error with Delta=300 56292
0.05 Scale Factor Error with Delta=300 225170
0.01 Scale Factor Error with Delta=300 5629266
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 97993.37

Damage

Sample Data
Count 9996
Mean 35865572.50

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 262.56
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 moonkin_form
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
8 12.97 starfall,if=!buff.starfall.up
9 0.00 treants,if=talent.force_of_nature.enabled
A 3.00 berserking
B 1.00 wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
C 0.00 natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
D 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
E 2.74 incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
F 2.00 celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
G 2.66 natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
H 10.11 wrath,if=eclipse<=-70&eclipse_dir<=0
I 10.21 starfire,if=eclipse>=60&eclipse_dir>=0
J 12.14 moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
K 9.14 sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
L 9.28 moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
M 10.27 sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
N 37.88 starsurge
O 12.89 starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
P 0.40 wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
Q 55.27 starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
R 69.58 wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
S 0.00 moonfire,moving=1,if=!dot.sunfire.ticking
T 0.00 sunfire,moving=1,if=!dot.moonfire.ticking
U 0.00 wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
V 0.00 starsurge,moving=1,if=buff.shooting_stars.react
W 0.00 moonfire,moving=1,if=buff.lunar_eclipse.up
X 0.00 sunfire,moving=1

Sample Sequence

8AHEGJMNQJQQ8NFBJNONOON8OOOOQMNIKLRRRRRRRRRNH8JNQMQQQNQQIKLNRNRRRRRRH8JQQMNQQQQIKNRLRRRRRRRRH8JMNQNQNQQQIKLRRRRNRRNRRH8JQMQQNQQQQIKRLAREGNRRNRRRRF78JNOOOOOOPRRMN8JNQQQQQMQNQIKRLNRRNRNRRH8JMQNQNQQNIKRRRRRLRRNRRRH8JQQQMNQQQIKNRLRRRRRRRRH8JNQQNMQQQIIKLNRRRRRRNRRARH8

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 186 177 80
Stamina 22591 20537 20418
Intellect 20858 18565 18400
Spirit 4511 4511 4322
Health 462677 433921 0
Mana 300000 300000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 31630 26462 7907
Spell Hit 15.17% 15.17% 835
Spell Crit 24.85% 18.95% 5862
Spell Haste 16.79% 11.23% 4771
Mana Per 5 7500 7500 0
Attack Power 499 445 0
Melee Hit 15.17% 15.17% 835
Melee Crit 22.40% 17.39% 5862
Melee Haste 11.23% 11.23% 4771
Swing Speed 22.35% 11.23% 4771
Expertise 0.00% 0.00% 0
Armor 18619 18619 18619
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.20% 0.19% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.81% 23.44% 2698

Gear

Average Item Level: 507.81
Head eternal_blossom_cover,id=86934,gems=burning_primal_80int_160spi_180int
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
Shoulders eternal_blossom_mantle,id=86932,gems=80int_160spi_60int,enchant=200int_100crit
Shirt empty
Chest eternal_blossom_vestment,id=86936,gems=80int_160crit_80int_160crit_180haste,enchant=80all,reforge=haste_mastery
Waist stonebound_cinch,id=87019,gems=160int_160int,reforge=haste_crit
Legs eternal_blossom_leggings,id=86935,gems=160int_60int,enchant=285int_165spi,reforge=mastery_spi
Feet asanis_uncleansed_sandals,id=90514,gems=160int,enchant=175hit
Wrists pearlescent_butterfly_wristbands,id=86996,enchant=180int,reforge=mastery_crit
Hands eternal_blossom_gloves,id=86933,enchant=170haste,reforge=haste_crit
Finger1 watersoul_signet,id=90511,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_crit
Main Hand kritak_imperial_scepter_of_the_swarm,id=86990,weapon=mace_1.90speed_1620min_3010max,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Balance_T14H"
origin="unknown"
level=90
race=troll
spec=balance
role=spell
position=back
professions=enchanting=600/alchemy=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ua!.0.1.2
glyphs=moonbeast

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40|buff.celestial_alignment.up
actions+=/starfall,if=!buff.starfall.up
actions+=/treants,if=talent.force_of_nature.enabled
actions+=/berserking
actions+=/wild_mushroom_detonate,moving=0,if=buff.wild_mushroom.stack>0&buff.solar_eclipse.up
actions+=/natures_swiftness,if=talent.dream_of_cenarius.enabled&talent.natures_swiftness.enabled
actions+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions+=/incarnation,if=talent.incarnation.enabled&(buff.lunar_eclipse.up|buff.solar_eclipse.up)
actions+=/celestial_alignment,if=((eclipse_dir=-1&eclipse<=0)|(eclipse_dir=1&eclipse>=0))&(buff.chosen_of_elune.up|!talent.incarnation.enabled)
actions+=/natures_vigil,if=((talent.incarnation.enabled&buff.chosen_of_elune.up)|(!talent.incarnation.enabled&buff.celestial_alignment.up))&talent.natures_vigil.enabled
actions+=/wrath,if=eclipse<=-70&eclipse_dir<=0
actions+=/starfire,if=eclipse>=60&eclipse_dir>=0
actions+=/moonfire,if=buff.lunar_eclipse.up&(dot.moonfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/sunfire,if=buff.solar_eclipse.up&!buff.celestial_alignment.up&(dot.sunfire.remains<(buff.natures_grace.remains-2+2*set_bonus.tier14_4pc_caster))
actions+=/moonfire,if=!dot.moonfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/sunfire,if=!dot.sunfire.ticking&!buff.celestial_alignment.up&(buff.dream_of_cenarius_damage.up|!talent.dream_of_cenarius.enabled)
actions+=/starsurge
actions+=/starfire,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/wrath,if=buff.celestial_alignment.up&cast_time<buff.celestial_alignment.remains
actions+=/starfire,if=eclipse_dir=1|(eclipse_dir=0&eclipse>0)
actions+=/wrath,if=eclipse_dir=-1|(eclipse_dir=0&eclipse<=0)
actions+=/moonfire,moving=1,if=!dot.sunfire.ticking
actions+=/sunfire,moving=1,if=!dot.moonfire.ticking
actions+=/wild_mushroom,moving=1,if=buff.wild_mushroom.stack<5
actions+=/starsurge,moving=1,if=buff.shooting_stars.react
actions+=/moonfire,moving=1,if=buff.lunar_eclipse.up
actions+=/sunfire,moving=1

head=eternal_blossom_cover,id=86934,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=eternal_blossom_mantle,id=86932,gems=80int_160spi_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_crit
chest=eternal_blossom_vestment,id=86936,gems=80int_160crit_80int_160crit_180haste,enchant=80all,reforge=haste_mastery
wrists=pearlescent_butterfly_wristbands,id=86996,enchant=180int,reforge=mastery_crit
hands=eternal_blossom_gloves,id=86933,enchant=170haste,reforge=haste_crit
waist=stonebound_cinch,id=87019,gems=160int_160int,reforge=haste_crit
legs=eternal_blossom_leggings,id=86935,gems=160int_60int,enchant=285int_165spi,reforge=mastery_spi
feet=asanis_uncleansed_sandals,id=90514,gems=160int,enchant=175hit
finger1=watersoul_signet,id=90511,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,weapon=mace_1.90speed_1620min_3010max,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20418
# gear_intellect=18400
# gear_spirit=4322
# gear_spell_power=7907
# gear_hit_rating=835
# gear_crit_rating=5862
# gear_haste_rating=4771
# gear_mastery_rating=2698
# gear_armor=18619
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_1.90speed_1620min_3010max,enchant=jade_spirit

Druid_Feral_T14H : 66340 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
66339.9 66339.9 79.99 / 0.12% 6727 / 10.1% 15131.5 940.3 940.3 3.82 / 0.41% 326 / 34.6% 220.3 4.3 4.3 Energy 74.07% 15.8 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
Glyphs
  • savagery

Charts

http://5.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:623514|301168|82910|26363&chds=0,1247028&chco=C55D54,C55D54,C79C6E,C79C6E&chm=t++623514++rip,C55D54,0,0,15|t++301168++rake,C55D54,1,0,15|t++82910++ferocious_bite,C79C6E,2,0,15|t++26363++cat_melee,C79C6E,3,0,15&chtt=Druid_Feral_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:52,39,9,2,1,0&chds=0,100&chdls=ffffff&chco=C55D54,C79C6E,C55D54,C79C6E,ABD473,C79C6E&chl=rake|cat_melee|rip|symbiosis_wolf: melee|symbiosis_wolf: spirit_bite|ferocious_bite&chtt=Druid_Feral_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:30311855653452221100zz0zyxtsrqqqppqoopoonmmllllkkjjijiihihhhihiiijjkllmnnmnnnooonnoonnnmnmmllkllllkkklkkjjkjjjjjkkkkjjklllllllmmmnnnnooooppppppqqpqpqqppppooonnnnkkkkkkkjjiiijjjiiijjjkkkkllllkmmmmmmmnnnmnnmnnnnnnnmnnmmmlkkkkkkkjjjjjjjkjjkkkllmmmmnnmnnnoooooopppoooooonooooooonnnmmnmnnonooooooopoppppqqqqpppooonoonnnnnnnnnnnooooppqqrrqrrrrrrsssssrrrrrqooopoonnnnmmlklk&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=66340|max=99327&chxp=1,1,67,100&chtt=Druid_Feral_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,4,8,14,24,24,33,46,64,102,121,185,217,230,293,324,408,477,504,590,581,562,584,585,550,562,468,398,367,316,293,248,208,143,128,78,81,56,42,25,16,7,8,6,1,4,4,2,1,2&chds=0,590&chbh=5&chxt=x&chxl=0:|min=52892|avg=66340|max=82901&chxp=0,1,45,100&chtt=Druid_Feral_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:11.2,5.1,3.8,1.4,0.9,0.3,74.1&chds=0,100&chdls=ffffff&chco=C55D54,ABD473,C79C6E,ABD473,C55D54,C79C6E,ffffff&chl=rake 40.9s|healing_touch 18.5s|savage_roar 14.0s|feral_spirit 5.2s|rip 3.4s|ferocious_bite 0.9s|waiting 271.1s&chtt=Druid_Feral_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Druid_Feral_T14H 66340
berserking 0 0.0% 3.0 180.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
cat_melee 24946 37.6% 411.9 0.89sec 22165 26363 16023 33323 22165 41.0% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 411.94 411.94 0.00 0.00 0.8407 0.0000 9130412.30 9130412.30 0.00 26363.33 26363.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.82 34.91% 16022.94 11981 21789 16022.93 15815 16301 2304425 2304425 0.00
crit 168.99 41.02% 33323.24 24681 44884 33323.04 32847 33906 5631187 5631187 0.00
glance 98.91 24.01% 12079.60 8986 16341 12079.59 11860 12345 1194800 1194800 0.00
dodge 0.16 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.06 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
feral_spirit 0 0.0% 4.0 120.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.3079 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:110807
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:110807
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves under the command of the Druid, lasting $d.
ferocious_bite 214 0.3% 0.9 42.52sec 86042 82910 50341 104476 86042 66.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.91 0.91 0.00 0.00 1.0378 0.0000 78433.06 78433.06 0.00 82910.21 82910.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.31 33.99% 50341.44 16709 159478 13296.77 0 134683 15597 15597 0.00
crit 0.60 65.98% 104475.95 40463 340962 46481.52 0 277447 62836 62836 0.00
dodge 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&dot.rip.ticking&target.health.pct<=25
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point$?s67598[, consumes up to 25 additional Energy to increase damage by up to 100%, and heals you for $67598m1% of your total maximum health for each $67598m2 Energy used.][ and consumes up to 25 additional Energy to increase damage by up to 100%.] When used on targets below 25% health, Ferocious Bite will also refresh the duration of your Rip on your target. Critical strike chance increased by $s2% against bleeding targets. 1 point : ${$m1+$b1*1+0.196*$AP}-${$M1+$b1*1+0.196*$AP} damage 2 points: ${$m1+$b1*2+0.196*2*$AP}-${$M1+$b1*2+0.196*2*$AP} damage 3 points: ${$m1+$b1*3+0.196*3*$AP}-${$M1+$b1*3+0.196*3*$AP} damage 4 points: ${$m1+$b1*4+0.196*4*$AP}-${$M1+$b1*4+0.196*4*$AP} damage 5 points: ${$m1+$b1*5+0.196*5*$AP}-${$M1+$b1*5+0.196*5*$AP} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:0.980000
  • base_dd_min:315.19
  • base_dd_max:685.41
healing_touch 940 100.0% 14.4 24.98sec 23927 18580 0 0 23927 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: healing_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 14.38 14.38 0.00 0.00 1.2878 0.0000 344155.99 344155.99 0.00 18579.93 18579.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.38 100.00% 23926.72 21668 32502 23942.35 22390 27085 344156 344156 0.00
HPS Timeline Chart

Action details: healing_touch

Static Values
  • id:5185
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17340.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:false
  • if_expr:!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
Spelldata
  • id:5185
  • name:Healing Touch
  • school:nature
  • tooltip:(null)
  • description:Heals a friendly target for $s1$?s54825[ and reduces your remaining cooldown on Swiftmend by $54825m1 sec][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.860000
  • base_dd_min:18459.28
  • base_dd_max:21800.87
natures_swiftness 0 0.0% 3.0 106.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: natures_swiftness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: natures_swiftness

Static Values
  • id:132158
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
Spelldata
  • id:132158
  • name:Nature's Swiftness
  • school:physical
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
rake 33684 50.8% 39.4 9.33sec 312839 301168 53954 113173 78043 40.7% 0.1% 0.0% 0.0% 120.5 52895 111113 76791 41.0% 0.0% 98.8%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.41 39.41 120.49 120.49 1.0388 3.0000 12328320.70 12328320.70 0.00 30635.84 301168.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.34 59.23% 53953.98 42958 94507 53915.27 47945 60762 1259266 1259266 0.00
crit 16.05 40.72% 113173.43 88493 194684 112909.09 90320 131168 1816243 1816243 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.0 58.95% 52895.09 42958 94507 52895.67 46546 59736 3757472 3757472 0.00
crit 49.5 41.05% 111113.06 88493 194684 111111.30 98768 124332 5495339 5495339 0.00
DPS Timeline Chart

Action details: rake

Static Values
  • id:1822
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 seconds.
  • description:Rake the target for $s1 Bleed damage and an additional $o2 Bleed damage over $d. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.368000
  • base_dd_min:118.23
  • base_dd_max:118.23
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.368000
  • base_td:118.23
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
rip 5733 8.6% 3.2 83.73sec 646552 623514 0 0 0 0.0% 0.1% 0.0% 0.0% 37.2 39215 81350 56357 40.7% 0.0% 20.3%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.25 3.25 37.23 37.23 1.0369 2.0000 2098124.74 2098124.74 0.00 26960.56 623514.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.24 99.94% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.1 59.32% 39214.57 32185 55568 39089.73 0 52650 865953 865953 0.00
crit 15.1 40.68% 81349.94 66301 114470 80760.01 0 108459 1232172 1232172 0.00
DPS Timeline Chart

Action details: rip

Static Values
  • id:1079
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 seconds.
  • description:Finishing move that causes Bleed damage over time. Damage increases per combo point: 1 point : ${$floor($m1+$b1*1*$<mastery>+0.0484*$AP*$<mastery>)*8} damage over $d. 2 points: ${$floor($m1+$b1*2*$<mastery>+0.0484*2*$AP*$<mastery>)*8} damage over $d. 3 points: ${$floor($m1+$b1*3*$<mastery>+0.0484*3*$AP*$<mastery>)*8} damage over $d. 4 points: ${$floor($m1+$b1*4*$<mastery>+0.0484*4*$AP*$<mastery>)*8} damage over $d. 5 points: ${$floor($m1+$b1*5*$<mastery>+0.0484*5*$AP*$<mastery>)*8} damage over $d. Each time you Shred, Ravage, or Mangle the target while in Cat Form the duration of your Rip on that target is extended by $s2 sec, up to a maximum of $s3 sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.242000
  • base_td:112.76
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
savage_roar 0 0.0% 14.5 27.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 0.00 0.00 0.9655 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 14.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
pet - symbiosis_wolf 6863 / 1763
melee 3773 1.5% 154.6 4.75sec 2294 1936 1633 3352 2294 43.9% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 154.60 154.60 0.00 0.00 1.1848 0.0000 354675.20 354675.20 0.00 1936.35 1936.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.52 32.03% 1633.11 1516 2009 1633.27 1540 1741 80867 80867 0.00
crit 67.92 43.93% 3352.48 3032 4237 3352.27 3138 3547 227694 227694 0.00
glance 37.08 23.98% 1243.65 1137 1589 1243.65 1164 1344 46114 46114 0.00
dodge 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 3090 1.2% 32.0 12.68sec 9079 5808 6315 12841 9079 42.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.99 31.99 0.00 0.00 1.5632 0.0000 290452.50 290452.50 0.00 5807.77 5807.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.42 57.56% 6315.39 5871 8381 6314.79 5871 6857 116309 116309 0.00
crit 13.56 42.39% 12841.18 11742 15852 12843.65 11742 14202 174143 174143 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserk 0.1 0.0 208.4sec 208.4sec 0.25% 0.25%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserk_1:0.3%
berserking 3.0 0.0 180.7sec 180.3sec 6.72% 6.19%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.7%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 10.62%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cat_form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • cat_form_1:100.0%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Causes Agility to increase attack power, increases autoattack damage by $s3%, and increases movement speed by $113636s1%.$?$w2=100[ Additionally, all healing done to you is increased by $47180s1%][]
  • description:Shapeshift into Cat Form, causing Agility to increase attack power, increasing autoattack damage by $s3%, and increasing movement speed by $113636s1%.$?s47180[ Additionally, all healing done to you is increased by $47180s1%.][] Also protects the caster from Polymorph effects and allows the use of various cat abilities. Energy regeneration continues while not in Cat Form. The act of shapeshifting frees the caster of movement impairing effects.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
dancing_steel 6.0 1.6 54.9sec 41.9sec 21.76% 21.59%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:21.8%
dream_of_cenarius_damage 14.4 0.0 25.8sec 24.9sec 10.70% 64.62%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_dream_of_cenarius_damage
  • max_stacks:2
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dream_of_cenarius_damage_1:5.0%
  • dream_of_cenarius_damage_2:5.7%

Spelldata details

  • id:108381
  • name:Dream of Cenarius
  • tooltip:Moonfire and Sunfire damage increased by $s3%, and melee ability damage increased by $s1%.
  • description:Nourish, Healing Touch, and Regrowth increase the damage done by your next $n Moonfire or Sunfire casts by $108381s3% or by your next $n melee abilities by $108381s1%.
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
natures_swiftness 3.0 0.0 106.4sec 106.4sec 0.00% 22.41%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_natures_swiftness
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

Spelldata details

  • id:132158
  • name:Nature's Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth will be instant, free, and castable in all forms, with $s2% increased healing and duration.
  • description:When activated, your next Cyclone, Entangling Roots, Healing Touch, Hibernate, Nourish, Rebirth, or Regrowth becomes instant, free, and castable in all forms. The healing and duration of the spell is increased by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:60.00
  • default_chance:0.00%
omen_of_clarity 12.9 3.6 27.4sec 21.1sec 23.35% 24.76%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_omen_of_clarity
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:4.00%
  • default_value:-1.00

Stack Uptimes

  • omen_of_clarity_1:23.4%

Spelldata details

  • id:16870
  • name:Clearcasting
  • tooltip:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%.
  • description:Your next cast-time Druid class damaging or healing spell or offensive feral ability has its Mana, Rage or Energy cost reduced by $s1%. Does not affect Nourish.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
predatory_swiftness 10.6 0.2 32.2sec 31.5sec 19.95% 100.00%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • predatory_swiftness_1:19.9%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth will be instant, free, and castable in all forms.
  • description:Your finishing moves have a chance per combo point to make your next Cyclone, Entangling Roots, Healing Touch, Hibernate, or Rebirth become instant, free, and castable in all forms.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 6.0 0.0 65.1sec 65.1sec 24.13% 24.13%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.1%
savage_roar 1.1 13.5 235.5sec 27.5sec 99.99% 99.63%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • savage_roar_1:100.0%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Physical damage done increased by $w2%.
  • description:Finishing move that increases physical damage done by $62071s1%. Lasts longer per combo point: 1 point : 18 seconds 2 points: 24 seconds 3 points: 30 seconds 4 points: 36 seconds 5 points: 42 seconds
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
symbiosis 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_symbiosis
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • symbiosis_1:100.0%

Spelldata details

  • id:110309
  • name:Symbiosis
  • tooltip:Grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death.
  • description:Creates a symbiotic link which grants the Druid one ability belonging to the target's class, varying by the Druid's specialization. Also grants the target one Druid ability based on their class and combat role. Lasts $d and persists through death. Cannot be cast on other Druids. Effect cancelled if Druid and target become too far apart.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
synapse_springs_2 0.1 0.0 150.5sec 150.5sec 0.17% 0.17%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:0.2%
terror_in_the_mists 6.0 0.0 65.3sec 65.3sec 32.53% 32.53%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.5%
tigers_fury 0.1 0.0 98.6sec 98.6sec 0.10% 0.16%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:0.1%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Increases physical damage done by $s1%.
  • description:Increases physical damage done by $s1% for $d and instantly restores $s2 Energy. Cannot be activated while Berserk (Cat) is active. Only useable in Cat Form.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 326.2sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Druid_Feral_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
symbiosis_wolf-stunned 2.0 0.0 135.0sec 0.0sec 2.13% 2.13%

Buff details

  • buff initial source:Druid_Feral_T14H_symbiosis_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
symbiosis_wolf-stunned 2.0 0.0 135.0sec 0.0sec 2.13% 2.13%

Buff details

  • buff initial source:Druid_Feral_T14H_symbiosis_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Druid_Feral_T14H
ferocious_bite Energy 1.8 39.8 21.8 43.7 1969.7
rake Energy 39.4 1092.2 27.7 27.7 11287.7
rip Energy 3.2 92.1 28.4 28.4 22785.9
savage_roar Energy 14.5 337.9 23.2 23.2 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1463.00 1341.95 0.92 2608.09 66.03%
energy_refund Energy 0.24 0.47 1.94 0.00 0.00%
incoming_damage Rage 152.00 100.00 0.66 177.72 63.99%
lotp_health Health 49.02 891176.69 18180.93 18512.18 2.04%
lotp_mana Mana 49.02 0.00 0.00 235282.11 100.00%
omen_of_clarity Mana 3.75 64992.04 17340.00 0.00 0.00%
omen_of_clarity Energy 8.55 296.17 34.63 0.00 0.00%
soul_of_the_forest Energy 16.70 212.19 12.70 3.57 1.65%
tigers_fury Energy 0.06 3.84 60.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 2434.91 18607.28
Rage 0.27 0.00
Energy 4.26 4.27
Combat End Resource Mean Min Max
Health -5454291.55 -5548280.20 -5362694.20
Mana 60000.00 60000.00 60000.00
Rage 100.00 100.00 100.00
Energy 96.13 54.00 100.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 81.3 4.5sec
primal_fury 16.0 22.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 66339.94
Minimum 52892.13
Maximum 82901.20
Spread ( max - min ) 30009.07
Range [ ( max - min ) / 2 * 100% ] 22.62%
Standard Deviation 4080.4507
5th Percentile 59696.48
95th Percentile 73151.22
( 95th Percentile - 5th Percentile ) 13454.74
Mean Distribution
Standard Deviation 40.8127
95.00% Confidence Intervall ( 66259.95 - 66419.93 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 145
0.1% Error 14533
0.1 Scale Factor Error with Delta=300 142134
0.05 Scale Factor Error with Delta=300 568538
0.01 Scale Factor Error with Delta=300 14213464
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 66339.94

Damage

Sample Data
Count 9996
Mean 23635290.79

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 940.32
Minimum 266.41
Maximum 1568.84
Spread ( max - min ) 1302.43
Range [ ( max - min ) / 2 * 100% ] 69.25%
Standard Deviation 195.0741
5th Percentile 592.01
95th Percentile 1243.23
( 95th Percentile - 5th Percentile ) 651.22
Mean Distribution
Standard Deviation 1.9511
95.00% Confidence Intervall ( 936.49 - 944.14 )
Normalized 95.00% Confidence Intervall ( 99.59% - 100.41% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1653
0.1% Error 165328
0.1 Scale Factor Error with Delta=300 324
0.05 Scale Factor Error with Delta=300 1299
0.01 Scale Factor Error with Delta=300 32484
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 940.32

Heal

Sample Data
Count 9996
Mean 344155.99

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 96.68
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 mark_of_the_wild,if=!aura.str_agi_int.up
3 0.00 healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
4 0.00 symbiosis,class=shaman
5 0.00 cat_form
6 0.00 savage_roar
7 0.00 snapshot_stats
8 0.00 virmens_bite_potion
Default action list
# count action,conditions
9 1.00 virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
A 15.00 auto_attack
B 0.00 skull_bash_cat
C 9.89 healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
D 3.00 healing_touch,if=prev.natures_swiftness
E 0.06 use_item,name=eternal_blossom_grips,sync=tigers_fury
F 0.06 tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
G 0.06 berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
H 0.00 natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
I 0.00 incarnation,if=buff.berserk.up&talent.incarnation.enabled
J 3.00 berserking
K 13.43 savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
L 0.00 faerie_fire,if=debuff.weakened_armor.stack<3
M 0.00 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
N 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
O 0.02 ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
P 0.61 ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
Q 0.00 ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
R 0.00 shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
S 1.79 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
T 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
U 3.25 rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
V 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
W 0.00 ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
X 0.12 savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
Y 0.00 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
Z 1.20 natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
a 0.06 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
b 0.44 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
c 25.98 rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
d 0.00 rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
e 13.42 rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
f 0.00 ravage,if=buff.omen_of_clarity.react
g 0.00 shred,if=buff.omen_of_clarity.react
h 0.22 ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
i 0.00 healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
j 0.06 ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
k 0.00 ravage,if=(buff.tigers_fury.up|buff.berserk.up)
l 0.00 ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
m 0.00 ravage,if=cooldown.tigers_fury.remains<=3.0
n 0.00 ravage,if=target.time_to_die<=8.5
o 0.00 ravage,if=energy.time_to_max<=1.0
p 0.00 shred,if=(buff.tigers_fury.up|buff.berserk.up)
q 0.00 shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
r 0.00 shred,if=cooldown.tigers_fury.remains<=3.0
s 0.00 shred,if=target.time_to_die<=8.5
t 0.00 shred,if=energy.time_to_max<=1.0
u 4.00 feral_spirit

Sample Sequence

AJcucKCcceKAeAeKeAeKeAueKAeCcceSDUcKCccAAJeKCcceKAeAeCccueSDUcKCccAeKACcceAKbcc9ZDcAcUCcKcAJuP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 194 185 80
Agility 21662 19265 18252
Stamina 22683 20621 20502
Intellect 257 245 80
Spirit 269 269 80
Health 463965 435097 0
Mana 60000 60000 0
Rage 100 100 0
Energy 100 100 0
Spell Power 271 235 0
Spell Hit 14.95% 14.95% 2545
Spell Crit 15.49% 10.49% 5124
Spell Haste 8.34% 3.18% 1351
Mana Per 5 1500 1500 0
Attack Power 48134 445 0
Melee Hit 7.49% 7.49% 2545
Melee Crit 38.22% 31.32% 5124
Melee Haste 3.18% 3.18% 1351
Swing Speed 13.50% 3.18% 1351
Expertise 7.46% 7.46% 2537
Armor 18644 18644 18644
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 19.55% 17.71% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 78.19% 62.54% 7188

Gear

Average Item Level: 507.73
Head eternal_blossom_headpiece,id=86925,gems=agile_primal_80agi_160hit_180agi,reforge=exp_crit
Neck choker_of_the_unleashed_storm,id=86953
Shoulders eternal_blossom_spaulders,id=86927,gems=80agi_160hit_60agi,enchant=520agi_100crit,reforge=haste_mastery
Shirt empty
Chest eternal_blossom_raiment,id=86923,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=160agi_160agi,reforge=crit_mastery
Legs legguards_of_failing_purification,id=90504,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=hit_exp
Feet boots_of_the_still_breath,id=86943,gems=160agi,enchant=140mastery,reforge=haste_mastery
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_mastery
Hands eternal_blossom_grips,id=86924,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=hit_mastery
Finger1 regails_band_of_the_endless,id=90503,reforge=haste_mastery
Finger2 painful_thorned_ring,id=86974,reforge=exp_crit
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180hit,reforge=crit_exp
Main Hand gaorei_staff_of_the_legendary_protector,id=87156,gems=500agi,enchant=dancing_steel,reforge=exp_hit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Feline Swiftness Displacer Beast Wild Charge
30 Nature's Swiftness Renewal Cenarion Ward
45 Faerie Swarm Mass Entanglement Typhoon
60 Soul of the Forest Incarnation Force of Nature
75 Disorienting Roar Ursol's Vortex Mighty Bash
90 Heart of the Wild Dream of Cenarius Nature's Vigil

Profile

#!./simc

druid="Druid_Feral_T14H"
origin="unknown"
level=90
race=troll
spec=feral
role=attack
position=back
professions=engineering=600/inscription=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#UZ!000001
glyphs=savagery

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/mark_of_the_wild,if=!aura.str_agi_int.up
actions.precombat+=/healing_touch,if=!buff.dream_of_cenarius_damage.up&talent.dream_of_cenarius.enabled
actions.precombat+=/symbiosis,class=shaman
actions.precombat+=/cat_form
actions.precombat+=/savage_roar
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|(target.health.pct<=25&buff.berserk.up)|target.time_to_die<=40
actions+=/auto_attack
actions+=/skull_bash_cat
actions+=/healing_touch,if=buff.predatory_swiftness.up&buff.predatory_swiftness.remains<=1&talent.dream_of_cenarius.enabled&(buff.dream_of_cenarius_damage.down|(buff.dream_of_cenarius_damage.stack=1&!buff.omen_of_clarity.up))
actions+=/healing_touch,if=prev.natures_swiftness
actions+=/use_item,name=eternal_blossom_grips,sync=tigers_fury
actions+=/tigers_fury,if=energy<=35&!buff.omen_of_clarity.react
actions+=/berserk,if=buff.tigers_fury.up|(target.time_to_die<15&cooldown.tigers_fury.remains>6)
actions+=/natures_vigil,if=buff.berserk.up&talent.natures_vigil.enabled
actions+=/incarnation,if=buff.berserk.up&talent.incarnation.enabled
actions+=/berserking
actions+=/savage_roar,if=buff.savage_roar.remains<=1|(buff.savage_roar.remains<=3&combo_points>0&(buff.dream_of_cenarius_damage.down|combo_points<5))
actions+=/faerie_fire,if=debuff.weakened_armor.stack<3
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>action.healing_touch.gcd&target.Fluffy_Pillow.health.pct<=25)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.ticking&target.health.pct<=25
actions+=/ferocious_bite,if=combo_points>=1&dot.rip.ticking&dot.rip.remains<=2&target.health.pct<=25
actions+=/ravage,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/shred,extend_rip=1,if=dot.rip.ticking&dot.rip.remains<=4
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&talent.natures_swiftness.enabled&target.Fluffy_Pillow.health.pct>25&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.time_to_die>=(6+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rip.remains<(2+action.healing_touch.gcd)&(buff.berserk.up|target.Fluffy_Pillow.dot.rip.remains<=cooldown.tigers_fury.remains))))
actions+=/rip,if=combo_points>=5&target.time_to_die>=6&dot.rip.remains<2.0&(buff.berserk.up|dot.rip.remains<=cooldown.tigers_fury.remains)
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>(5+action.healing_touch.gcd)&buff.savage_roar.remains>=(1+action.healing_touch.gcd)&buff.berserk.remains>action.healing_touch.gcd)))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>5.0&buff.savage_roar.remains>=1.0&buff.berserk.up
actions+=/savage_roar,if=combo_points>=5&target.time_to_die>=8.5&dot.rip.remains<=12&buff.savage_roar.remains<=(dot.rip.remains+4)
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&buff.tigers_fury.up)))
actions+=/natures_swiftness,if=!buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.health.pct<=25|(dot.rip.remains>4&set_bonus.tier14_4pc_melee))&(((target.time_to_die>=(8.5+action.healing_touch.gcd)&dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&(buff.tigers_fury.remains>=action.healing_touch.gcd|(cooldown.tigers_fury.remains>21&target.Fluffy_Pillow.dot.rake.remains<(12.0+action.healing_touch.gcd))))))
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(target.Fluffy_Pillow.health.pct<=25|target.Fluffy_Pillow.dot.rip.remains>4)&(((target.Fluffy_Pillow.time_to_die>=(8.5+action.healing_touch.gcd)&target.Fluffy_Pillow.dot.rake.remains<(3.0+action.healing_touch.gcd)&(buff.berserk.remains>action.healing_touch.gcd|(cooldown.tigers_fury.remains+0.8)>=target.Fluffy_Pillow.dot.rake.remains))))
actions+=/rake,if=target.time_to_die>=8.5&buff.dream_of_cenarius_damage.up&(dot.rake.multiplier<=tick_multiplier)&!prev.rake
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<9.0&!talent.dream_of_cenarius.enabled&buff.tigers_fury.up&(dot.rake.multiplier<tick_multiplier)
actions+=/rake,if=target.time_to_die>=8.5&dot.rake.remains<3.0&(buff.berserk.up|(cooldown.tigers_fury.remains+0.8)>=dot.rake.remains)
actions+=/ravage,if=buff.omen_of_clarity.react
actions+=/shred,if=buff.omen_of_clarity.react
actions+=/ferocious_bite,if=(target.time_to_die<=4&combo_points>=5)|target.time_to_die<=1
actions+=/healing_touch,if=buff.predatory_swiftness.up&talent.dream_of_cenarius.enabled&buff.dream_of_cenarius_damage.down&(((combo_points>=5&target.Fluffy_Pillow.dot.rip.remains>=(8.0+action.healing_touch.gcd)&buff.savage_roar.remains>=(action.healing_touch.gcd))))
actions+=/ferocious_bite,if=combo_points>=5&dot.rip.remains>=8.0&buff.savage_roar.up
actions+=/ravage,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/ravage,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/ravage,if=cooldown.tigers_fury.remains<=3.0
actions+=/ravage,if=target.time_to_die<=8.5
actions+=/ravage,if=energy.time_to_max<=1.0
actions+=/shred,if=(buff.tigers_fury.up|buff.berserk.up)
actions+=/shred,if=((combo_points<5&dot.rip.remains<3.0)|(combo_points=0&buff.savage_roar.remains<2))
actions+=/shred,if=cooldown.tigers_fury.remains<=3.0
actions+=/shred,if=target.time_to_die<=8.5
actions+=/shred,if=energy.time_to_max<=1.0
actions+=/feral_spirit

head=eternal_blossom_headpiece,id=86925,gems=agile_primal_80agi_160hit_180agi,reforge=exp_crit
neck=choker_of_the_unleashed_storm,id=86953
shoulders=eternal_blossom_spaulders,id=86927,gems=80agi_160hit_60agi,enchant=520agi_100crit,reforge=haste_mastery
back=legbreaker_greatcloak,id=86963,enchant=180hit,reforge=crit_exp
chest=eternal_blossom_raiment,id=86923,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_mastery
hands=eternal_blossom_grips,id=86924,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=hit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=160agi_160agi,reforge=crit_mastery
legs=legguards_of_failing_purification,id=90504,gems=160agi_80agi_160hit_120agi,enchant=285agi_165crit,reforge=hit_exp
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140mastery,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503,reforge=haste_mastery
finger2=painful_thorned_ring,id=86974,reforge=exp_crit
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=gaorei_staff_of_the_legendary_protector,id=87156,gems=500agi,enchant=dancing_steel,reforge=exp_hit

# Gear Summary
# gear_strength=80
# gear_agility=18252
# gear_stamina=20502
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2537
# gear_hit_rating=2545
# gear_crit_rating=5124
# gear_haste_rating=1351
# gear_mastery_rating=7188
# gear_armor=18644
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=eternal_blossom_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=gaorei_staff_of_the_legendary_protector,heroic=1,weapon=staff_3.30speed_13314min_19972max,enchant=dancing_steel

Hunter_BM_T14H : 101910 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
101909.5 101909.5 38.32 / 0.04% 3192 / 3.1% 3954.5 11.0 10.8 Focus 0.00% 55.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

Charts

http://3.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:824921|407799|153023|115675|110659|96274|42827|18467|13164&chds=0,1649842&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,69CCF0,ABD473,C79C6E&chm=t++824921++stampede,C79C6E,0,0,15|t++407799++lynx_rush,C79C6E,1,0,15|t++153023++dire_beast,C79C6E,2,0,15|t++115675++kill_command,C79C6E,3,0,15|t++110659++kill_shot,C79C6E,4,0,15|t++96274++glaive_toss,C79C6E,5,0,15|t++42827++arcane_shot,69CCF0,6,0,15|t++18467++cobra_shot,ABD473,7,0,15|t++13164++ranged,C79C6E,8,0,15&chtt=Hunter_BM_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:38,32,28,27,27,15,15,13,12,9,7,1,1,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=cat: kill_command|cat: melee|ranged|arcane_shot|cat: claw|cobra_shot|glaive_toss|cat: lynx_rush|dire_beast: dire_beast_melee|kill_shot|serpent_sting|devilsaur: melee|hyena: melee|wolf: melee|raptor: melee|devilsaur: claw|raptor: claw|hyena: claw|wolf: claw&chtt=Hunter_BM_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:3855434323234431vtpnlkggedcaYYWVUUTTSSTVVWWWWXXWVWVVVVVVWWWUTTTSSSRRSTTTUUUUUUUUUTTTTTTTTSSRRRQQQPPPPQRRQQQQQQQRRRRRRRSSSSRRRRRRRSSTTUUUUUUUUUUVVVWWWWVVUTTTSSSSSSRRSSSTTTTSTTTTUUUUUUUVUUTSSRRRRRRRRRRRRRRRRSSSSTTTTTUTSSRRSSTTTTTTTTUUTUUUVWWXXWWWVVWVVVVVVVUUUUUUTTSSSSSRRRRRRRRRRQQQQQQRQRRRRRSSTTUUWWXYZabcccccddefggghgffedddccccdcccbZYXXXXXXYYXXXXXXXXXWVWXXWWWWWWWWVV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=101910|max=269504&chxp=1,1,38,100&chtt=Hunter_BM_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,1,3,3,5,13,20,32,27,62,81,94,128,176,220,289,352,398,412,530,509,573,636,577,609,623,566,517,435,383,360,355,249,203,140,115,79,66,45,40,25,13,9,8,5,1,2,2,1,1&chds=0,636&chbh=5&chxt=x&chxl=0:|min=94768|avg=101910|max=109801&chxp=0,1,48,100&chtt=Hunter_BM_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.6,27.3,14.5,6.7,3.5,3.5,2.2,1.4,0.9,0.6,0.3&chds=0,100&chdls=ffffff&chco=ABD473,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,ABD473&chl=cobra_shot 130.2s|arcane_shot 99.9s|kill_command 53.1s|glaive_toss 24.6s|dire_beast 12.9s|kill_shot 12.7s|focus_fire 8.0s|lynx_rush 5.2s|serpent_sting 3.5s|stampede 2.1s|aspect_of_the_hawk 1.0s&chtt=Hunter_BM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_BM_T14H 101910
arcane_shot 11692 11.5% 96.2 3.75sec 44470 42827 33698 69827 44602 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.23 95.94 0.00 0.00 1.0384 0.0000 4279153.12 4279153.12 0.00 42827.08 42827.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.98 69.82% 33697.68 31200 40193 33699.15 32844 34614 2257232 2257232 0.00
crit 28.96 30.18% 69827.39 64272 82797 69832.27 66238 74504 2021921 2021921 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bestial_wrath 0 0.0% 6.9 59.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bestial_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bestial_wrath

Static Values
  • id:19574
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:focus>60&!buff.beast_within.up
Spelldata
  • id:19574
  • name:Bestial Wrath
  • school:physical
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
blood_fury 0 0.0% 4.0 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 3.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 6570 6.4% 88.3 3.88sec 27243 18467 20694 42676 27288 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.27 88.12 0.00 0.00 1.4752 0.0000 2404738.00 2404738.00 0.00 18467.30 18467.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.69 70.00% 20694.40 20060 26177 20694.40 20307 21052 1276652 1276652 0.00
crit 26.43 30.00% 42675.63 41324 53925 42673.64 41403 44197 1128087 1128087 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (5378) 0.0% (5.3%) 12.4 29.72sec 158806 153023 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.39 12.39 0.00 0.00 1.0378 0.0000 0.00 0.00 0.00 153022.52 153022.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&focus<=80
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
focus_fire 0 0.0% 7.7 44.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: focus_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.69 7.69 0.00 0.00 1.0381 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: focus_fire

Static Values
  • id:82692
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:82692
  • name:Focus Fire
  • school:physical
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
glaive_toss 6484 6.4% 23.8 15.70sec 99877 96274 38205 79267 50551 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.76 46.94 0.00 0.00 1.0374 0.0000 2373064.10 2373064.10 0.00 96274.25 96274.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.83 69.93% 38205.12 34811 50529 38201.89 36319 39995 1254252 1254252 0.00
crit 14.11 30.07% 79266.58 71710 104090 79283.88 72262 88752 1118812 1118812 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_command 0 (16776) 0.0% (16.5%) 51.1 7.12sec 120065 115675 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.14 51.14 0.00 0.00 1.0380 0.0000 0.00 0.00 0.00 115674.62 115674.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 51.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:34026
  • school:physical
  • resource:focus
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:6.00
  • base_execute_time:-10.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:34026
  • name:Kill Command
  • school:physical
  • tooltip:Give the command to kill, causing your pet to instantly inflict $ damage to its target. The pet must be within 25 yards of the target to Kill Command.
  • description:Give the command to kill, causing your pet to instantly inflict $<damage> damage to its target$?s53243[ and apply the Hunter's Mark effect][]. The pet must be within 25 yards of the target to Kill Command.
kill_shot 3837 3.8% 12.2 5.52sec 114836 110659 87369 180271 116106 30.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.23 12.09 0.00 0.00 1.0377 0.0000 1404258.48 1404258.48 0.00 110658.67 110658.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.35 69.07% 87368.72 80976 101923 87371.83 80976 98266 729829 729829 0.00
crit 3.74 30.93% 180270.95 166811 209961 178392.87 0 209961 674429 674429 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (5775) 0.0% (5.7%) 5.0 79.15sec 422724 407799 0 0 0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 0 13.0% 0.0% 5.5%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 45.00 45.00 1.0366 0.4444 0.00 0.00 0.00 83930.51 407798.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.1 86.95% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.9 13.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 11989 11.8% 157.7 2.30sec 27817 13164 21016 43490 27817 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.74 157.74 0.00 0.00 2.1131 0.0000 4387990.58 4387990.58 0.00 13164.22 13164.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.01 69.74% 21015.53 19852 26070 21015.61 20590 21356 2311819 2311819 0.00
crit 47.74 30.26% 43490.14 40896 53705 43490.23 41759 45321 2076171 2076171 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 3.0 102.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up&!buff.beast_within.up
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
serpent_sting 3010 3.0% 3.3 102.63sec 330800 318947 0 0 0 0.0% 0.0% 0.0% 0.0% 119.5 6985 14451 9215 29.9% 0.0% 98.0%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.33 3.33 119.55 119.55 1.0372 3.0000 1101641.95 1101641.95 0.00 3042.44 318946.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.8 70.13% 6985.19 6577 9053 6985.20 6808 7187 585615 585615 0.00
crit 35.7 29.87% 14450.86 13548 18650 14451.05 13759 15160 516027 516027 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (4672) 0.0% (4.6%) 2.0 300.72sec 855031 824921 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 824921.08 824921.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 48278 / 48278
claw 11635 11.4% 105.0 3.50sec 40545 26275 25776 52148 40545 56.2% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.03 105.03 0.00 0.00 1.5431 0.0000 4258363.28 4258363.28 0.00 26274.52 26274.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.74 43.55% 25776.49 16058 82892 25781.47 19842 33721 1178970 1178970 0.00
crit 59.01 56.19% 52148.15 32117 165784 52154.83 41064 68325 3077315 3077315 0.00
block 0.07 0.06% 31627.07 16058 82892 2036.20 0 82892 2079 2079 0.00
parry 0.21 0.20% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
kill_command 16776 16.5% 51.1 7.12sec 120065 0 85011 172671 120065 40.2% 0.3% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_command

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.14 51.14 0.00 0.00 0.0000 0.0000 6140008.73 6140008.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.37 59.38% 85011.42 70144 180772 85003.09 74339 97065 2581673 2581673 0.00
crit 20.58 40.24% 172671.21 140288 361544 172706.46 145598 216575 3553389 3553389 0.00
block 0.05 0.10% 93290.44 70144 180772 4797.24 0 180772 4946 4946 0.00
parry 0.14 0.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: kill_command

Static Values
  • id:83381
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:83381
  • name:Kill Command
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc34026
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:697.93
  • base_dd_max:697.93
lynx_rush 5775 5.7% 45.0 7.29sec 46969 0 33480 70456 46969 39.7% 3.5% 0.0% 1.3% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 45.00 0.00 0.00 0.0000 0.0000 2113621.99 2113621.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.94 55.43% 33480.32 25429 64800 33463.72 26162 41115 835069 835069 0.00
crit 17.88 39.73% 70455.62 50857 129600 70463.15 51818 99064 1259687 1259687 0.00
block 0.58 1.29% 32381.83 25429 64800 14403.85 0 64800 18867 18867 0.00
parry 1.60 3.55% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 14092 13.8% 245.6 1.49sec 20999 15124 15336 31603 20999 40.4% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 245.61 245.61 0.00 0.00 1.3885 0.0000 5157649.06 5157649.06 0.00 15124.18 15124.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.94 35.40% 15335.78 12714 32400 15334.55 14038 16867 1333267 1333267 0.00
crit 99.18 40.38% 31603.39 25429 64800 31604.33 28885 34875 3134464 3134464 0.00
glance 58.93 23.99% 11684.58 9536 24300 11685.00 10541 13543 688570 688570 0.00
block 0.08 0.03% 15972.86 12714 32400 1297.89 0 32400 1349 1349 0.00
parry 0.48 0.19% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 5.0 84.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 10702 / 1170
claw 4952 0.5% 12.9 26.67sec 15312 9939 10675 21174 15312 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.94 12.94 0.00 0.00 1.5407 0.0000 198084.63 198084.63 0.00 9938.52 9938.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.22 55.83% 10674.58 5991 17269 10692.08 6574 17269 77088 77088 0.00
crit 5.71 44.17% 21173.59 11982 34538 21171.04 0 34538 120996 120996 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5750 0.6% 28.0 11.78sec 8202 6222 5753 11841 8202 45.6% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.04 28.04 0.00 0.00 1.3182 0.0000 229988.09 229988.09 0.00 6222.12 6222.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.55 30.51% 5752.53 4707 6750 5750.96 4707 6750 49211 49211 0.00
crit 12.78 45.58% 11841.05 9413 13500 11839.46 10134 13500 151328 151328 0.00
glance 6.71 23.92% 4391.05 3530 5062 4390.78 0 5062 29450 29450 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 8.0 45.92sec 0 0 0 0 0 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.96 7.96 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.53 56.92% 0.00 0 0 0.00 0 0 0 0 0.00
crit 3.43 43.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:5.60
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 300.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 10685 / 1168
claw 4943 0.5% 12.9 26.74sec 15322 9944 10699 21151 15322 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 12.90 0.00 0.00 1.5408 0.0000 197707.18 197707.18 0.00 9944.03 9944.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.20 55.77% 10698.53 5991 17269 10715.12 5991 16387 76983 76983 0.00
crit 5.71 44.23% 21150.76 11982 34538 21123.81 0 34538 120724 120724 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5742 0.6% 28.0 11.77sec 8192 6211 5749 11845 8192 45.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.04 28.04 0.00 0.00 1.3190 0.0000 229682.40 229682.40 0.00 6210.99 6210.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.55 30.49% 5748.80 4707 6750 5745.88 0 6750 49143 49143 0.00
crit 12.74 45.44% 11845.49 9413 13500 11843.77 10318 13500 150907 150907 0.00
glance 6.75 24.07% 4391.17 3530 5062 4389.75 0 5062 29633 29633 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 10684 / 1168
cackling_howl 0 0.0% 2.0 300.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:63.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 4936 0.5% 12.9 26.73sec 15302 9932 10690 21172 15302 44.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 12.90 0.00 0.00 1.5407 0.0000 197453.81 197453.81 0.00 9931.78 9931.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.23 56.00% 10689.78 5991 17269 10703.58 6574 15649 77246 77246 0.00
crit 5.68 44.00% 21171.59 11982 34538 21143.77 0 34538 120207 120207 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5748 0.6% 28.0 11.79sec 8199 6218 5748 11846 8199 45.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.04 28.04 0.00 0.00 1.3185 0.0000 229906.96 229906.96 0.00 6218.41 6218.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.55 30.50% 5748.49 4707 6750 5747.41 4707 6750 49159 49159 0.00
crit 12.77 45.53% 11846.43 9413 13500 11843.95 10060 13316 151233 151233 0.00
glance 6.72 23.98% 4389.94 3530 5062 4386.24 0 5062 29515 29515 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 10681 / 1167
claw 4934 0.5% 12.9 26.74sec 15295 9927 10721 21095 15295 44.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.90 12.90 0.00 0.00 1.5408 0.0000 197358.41 197358.41 0.00 9926.99 9926.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.21 55.90% 10720.60 5991 17269 10739.48 6768 16093 77330 77330 0.00
crit 5.69 44.10% 21094.77 11982 34538 21071.16 0 34538 120029 120029 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 5747 0.6% 28.0 11.78sec 8200 6219 5748 11848 8200 45.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.03 28.03 0.00 0.00 1.3185 0.0000 229879.92 229879.92 0.00 6219.19 6219.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.55 30.50% 5747.74 4707 6750 5745.86 0 6750 49138 49138 0.00
crit 12.76 45.53% 11847.69 9413 13500 11844.01 10112 13500 151235 151235 0.00
glance 6.72 23.97% 4391.42 3530 5062 4389.66 0 5062 29507 29507 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 300.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:84.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 11851 / 5378
dire_beast_melee 11851 5.3% 76.6 4.53sec 25687 15788 20186 41214 25687 31.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.63 76.63 0.00 0.00 1.6270 0.0000 1968328.72 1968328.72 0.00 15787.55 15787.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.95 44.30% 20185.71 18918 26183 20186.45 19085 21625 685292 685292 0.00
crit 24.33 31.75% 41213.89 37836 52367 41218.49 37967 45337 1002748 1002748 0.00
glance 18.35 23.95% 15275.30 14188 19638 15276.13 14188 16831 280289 280289 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
beast_within 6.9 0.0 59.3sec 59.3sec 28.38% 27.86%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_beast_within
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • beast_within_1:28.4%

Spelldata details

  • id:34471
  • name:The Beast Within
  • tooltip:Enraged.
  • description:When your pet is under the effects of Bestial Wrath, you also go into a rage causing $34471s2% additional damage and reducing Focus costs of all your shots and abilities by $34471s1% for $19574d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.0 0.0 120.7sec 120.7sec 12.78% 12.78%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:12.8%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.98%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
cobra_strikes 11.5 3.0 30.5sec 23.8sec 21.91% 27.30%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_cobra_strikes
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • cobra_strikes_1:11.3%
  • cobra_strikes_2:7.7%
  • cobra_strikes_3:1.9%
  • cobra_strikes_4:0.7%
  • cobra_strikes_5:0.2%
  • cobra_strikes_6:0.0%

Spelldata details

  • id:53257
  • name:Cobra Strikes
  • tooltip:Pet's critical strike chance with Basic Attacks increased by 100%.
  • description:$@spelldesc53260
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
focus_fire 7.5 0.2 45.7sec 44.5sec 40.74% 37.27%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_focus_fire
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • focus_fire_1:40.7%

Spelldata details

  • id:82692
  • name:Focus Fire
  • tooltip:Ranged haste increased by $w1%.
  • description:Consumes your pet's Frenzy stack, restoring $s2 Focus to your pet and increasing your ranged haste by $s1% for each Frenzy stack consumed. Lasts for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 9.0 0.0 41.7sec 41.7sec 24.59% 23.20%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.6%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 3.0 0.0 102.8sec 102.8sec 12.30% 10.13%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:12.3%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 5.5 0.0 69.4sec 69.4sec 22.37% 22.37%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:22.4%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
terror_in_the_mists 6.0 0.0 65.6sec 65.6sec 32.34% 32.34%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.3%
virmens_bite_potion 2.0 0.0 310.4sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Hunter_BM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
cat-bestial_wrath 5.9 0.0 71.4sec 71.4sec 24.01% 24.27%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_bestial_wrath
  • max_stacks:1
  • duration:16.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bestial_wrath_1:24.0%

Spelldata details

  • id:19574
  • name:Bestial Wrath
  • tooltip:Enraged.
  • description:Send your pet into a rage causing $s2% additional damage for $d. The beast does not feel pity or remorse or fear and it cannot be stopped $?s119410[or][unless] killed.
  • max_stacks:
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
cat-frenzy_effect 9.1 32.9 41.6sec 8.6sec 81.68% 82.94%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:20.7%
  • frenzy_effect_2:20.3%
  • frenzy_effect_3:19.9%
  • frenzy_effect_4:19.4%
  • frenzy_effect_5:1.4%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
cat-rabid 3.0 0.0 169.1sec 169.3sec 16.39% 16.87%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:16.4%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
cat-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_BM_T14H_cat
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
devilsaur-frenzy_effect 1.9 3.3 300.6sec 68.7sec 76.19% 73.66%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.9%
  • frenzy_effect_2:2.6%
  • frenzy_effect_3:1.3%
  • frenzy_effect_4:0.4%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-rabid 2.0 0.0 300.9sec 300.9sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_BM_T14H_devilsaur
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
dire_beast-stunned 6.9 0.0 49.9sec 0.0sec 4.09% 4.09%

Buff details

  • buff initial source:Hunter_BM_T14H_dire_beast
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.9%
dire_beast-stunned 1.0 0.0 0.0sec 0.0sec 6.51% 6.51%

Buff details

  • buff initial source:Hunter_BM_T14H_dire_beast
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
hyena-frenzy_effect 1.9 3.2 300.6sec 68.8sec 75.66% 73.20%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.9%
  • frenzy_effect_2:2.6%
  • frenzy_effect_3:1.3%
  • frenzy_effect_4:0.4%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-rabid 2.0 0.0 300.9sec 300.9sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_BM_T14H_hyena
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
raptor-frenzy_effect 1.9 3.2 300.6sec 69.2sec 75.51% 73.08%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.9%
  • frenzy_effect_2:2.7%
  • frenzy_effect_3:1.3%
  • frenzy_effect_4:0.4%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-rabid 2.0 0.0 300.9sec 300.9sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_BM_T14H_raptor
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
wolf-frenzy_effect 1.9 3.3 300.7sec 68.3sec 75.66% 73.22%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_frenzy_effect
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • frenzy_effect_1:3.8%
  • frenzy_effect_2:2.7%
  • frenzy_effect_3:1.3%
  • frenzy_effect_4:0.4%
  • frenzy_effect_5:0.1%

Spelldata details

  • id:19615
  • name:Frenzy
  • tooltip:$?$w1>0[Attack speed increased by $w1%.][Pet attack speed increased by $s1%]
  • description:The Hunter's pet gains attack speed after performing a Basic Attack, lasting for $19615d and stacking up to $19615u times.
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-rabid 2.0 0.0 300.9sec 300.9sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 300.8sec 300.8sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_BM_T14H_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_BM_T14H
arcane_shot Focus 96.2 1924.5 20.0 20.0 2223.5
glaive_toss Focus 23.8 303.0 12.8 12.8 7832.7
kill_command Focus 51.1 1744.7 34.1 34.1 3519.2
serpent_sting Focus 3.3 61.5 18.5 18.5 17923.9
pet - cat
claw Focus 105.0 3404.8 32.4 32.4 1250.7
pet - devilsaur
claw Focus 12.9 473.4 36.6 36.6 418.4
pet - raptor
claw Focus 12.9 472.6 36.6 36.6 418.4
pet - hyena
claw Focus 12.9 472.6 36.6 36.6 417.8
pet - wolf
claw Focus 12.9 472.6 36.6 36.6 417.6
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1463.00 1878.00 1.28 11.64 0.62%
invigoration Focus 23.44 455.99 19.45 12.89 2.75%
cobra_shot Focus 88.12 1232.63 13.99 1.12 0.09%
dire_beast Focus 76.63 382.55 4.99 0.60 0.16%
pet - cat
focus_regen Focus 1463.00 2362.01 1.61 0.04 0.00%
focus_fire Focus 7.69 230.74 30.00 0.00 0.00%
go_for_the_throat Focus 47.74 716.04 15.00 0.04 0.01%
pet - devilsaur
focus_regen Focus 160.00 254.08 1.59 0.18 0.07%
pet - raptor
focus_regen Focus 160.00 254.07 1.59 0.18 0.07%
pet - hyena
focus_regen Focus 160.00 254.08 1.59 0.18 0.07%
pet - wolf
focus_regen Focus 160.00 254.08 1.59 0.18 0.07%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Focus 10.79 11.02
Combat End Resource Mean Min Max
Health -6349422.00 -6349422.00 -6349422.00
Focus 33.66 0.04 108.26
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.6%
cat-Focus Cap 0.6%
raptor-Focus Cap 0.6%
wolf-Focus Cap 0.6%
dire_beast-Focus Cap 0.6%

Procs

Count Interval
invigoration 23.4 15.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 101909.51
Minimum 94767.63
Maximum 109801.04
Spread ( max - min ) 15033.42
Range [ ( max - min ) / 2 * 100% ] 7.38%
Standard Deviation 1954.9924
5th Percentile 98717.62
95th Percentile 105101.46
( 95th Percentile - 5th Percentile ) 6383.84
Mean Distribution
Standard Deviation 19.5538
95.00% Confidence Intervall ( 101871.18 - 101947.83 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1413
0.1 Scale Factor Error with Delta=300 32626
0.05 Scale Factor Error with Delta=300 130507
0.01 Scale Factor Error with Delta=300 3262675
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 101909.51

Damage

Sample Data
Count 9996
Mean 15950846.23

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 339.03
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 15.00 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 7.69 focus_fire,five_stacks=1
D 3.33 serpent_sting,if=!ticking
E 3.98 blood_fury
F 0.00 fervor,if=enabled&!ticking&focus<=65
G 6.90 bestial_wrath,if=focus>60&!buff.beast_within.up
H 0.00 multi_shot,if=target.adds>5
I 0.00 cobra_shot,if=target.adds>5
J 12.23 kill_shot
K 0.00 a_murder_of_crows,if=enabled&!ticking
L 2.00 stampede
M 23.76 glaive_toss,if=enabled
N 0.00 barrage,if=enabled
O 0.00 powershot,if=enabled
P 0.00 blink_strike,if=enabled
Q 5.00 lynx_rush,if=enabled&!ticking
R 3.00 rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
S 51.14 kill_command
T 12.39 dire_beast,if=enabled&focus<=80
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 1.00 readiness,wait_for_rapid_fire=1
W 96.23 arcane_shot,if=focus>=69|buff.beast_within.up
X 0.00 focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
Y 93.38 cobra_shot

Sample Sequence

8ADEGLMQSWWWWWSTWWWWDMSWWYWWSYYYWSYMYWWSYYTWYARSVMQTCGSWWWWWASYWDMYSWYRYYYSYWWYYMSTWYYSWYWAWSYMYYSYYWWSYYMTGSWAWCWYSWWEWWYMSWYYYSYAYYQSMTWWYSYYWWSYMYWSYYWWSYYAMSTYYGWSAWWWWYYMSWCWWYYSYYYWSMTYYWSYYWWSWWMYYSAYYAWQSYYMWCSTGWWEWWYSWWYMWSYYWRYYSYYWWYMSYACTWSYYWWYSMYYAWWSYYWJJSYCMYGSLWJJ7WSWTWWWSMAJJDYQSYYWJJSMYYYSYJJWASTYMWYSJJWWYSYAWMEJJS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22364 19934 18773
Stamina 22460 20418 20266
Intellect 191 182 80
Spirit 195 195 80
Health 460843 432255 0
Focus 120 120 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2575
Spell Crit 11.78% 6.78% 4056
Spell Haste 11.77% 6.45% 2741
Mana Per 5 0 0 0
Attack Power 49377 40028 0
Melee Hit 7.57% 7.57% 2575
Melee Crit 27.99% 21.06% 4056
Melee Haste 6.45% 6.45% 2741
Swing Speed 17.09% 6.45% 2741
Expertise 7.52% 7.52% 2556
Armor 25344 25344 25344
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 45.78% 35.78% 5933

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
Shirt empty
Chest zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
Waist fetters_of_death,id=87034,gems=320agi_320agi_160agi
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
Wrists jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
Hands yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
Finger1 painful_thorned_ring,id=86974,enchant=160agi
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_BM_T14H"
origin="unknown"
level=90
race=orc
spec=beast_mastery
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Ya!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/focus_fire,five_stacks=1
actions+=/serpent_sting,if=!ticking
actions+=/blood_fury
actions+=/fervor,if=enabled&!ticking&focus<=65
actions+=/bestial_wrath,if=focus>60&!buff.beast_within.up
actions+=/multi_shot,if=target.adds>5
actions+=/cobra_shot,if=target.adds>5
actions+=/kill_shot
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/stampede
actions+=/glaive_toss,if=enabled
actions+=/barrage,if=enabled
actions+=/powershot,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/rapid_fire,if=!buff.bloodlust.up&!buff.beast_within.up
actions+=/kill_command
actions+=/dire_beast,if=enabled&focus<=80
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=69|buff.beast_within.up
actions+=/focus_fire,five_stacks=1,if=!ticking&!buff.beast_within.up
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=exp_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_hit
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_hit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=zorloks_fizzing_chestguard,id=87822,gems=160agi_80agi_160mastery_120agi,enchant=80all,reforge=mastery_crit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi,reforge=hit_exp
hands=yaungol_slayers_gloves,id=87003,enchant=170mastery,reforge=hit_mastery
waist=fetters_of_death,id=87034,gems=320agi_320agi_160agi
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_mastery
finger1=painful_thorned_ring,id=86974,enchant=160agi
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=haste_crit

# Gear Summary
# gear_strength=80
# gear_agility=18773
# gear_stamina=20266
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2556
# gear_hit_rating=2575
# gear_crit_rating=4056
# gear_haste_rating=2741
# gear_mastery_rating=5933
# gear_armor=25344
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_MM_T14H : 97041 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
97041.0 97041.0 36.26 / 0.04% 3030 / 3.1% 6041.5 11.4 11.3 Focus 0.00% 58.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:611459|298506|142018|109383|96329|95820|47478|41513|14460|11274&chds=0,1222918&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,69CCF0,C79C6E,C79C6E&chm=t++611459++stampede,C79C6E,0,0,15|t++298506++lynx_rush,C79C6E,1,0,15|t++142018++dire_beast,C79C6E,2,0,15|t++109383++kill_shot,C79C6E,3,0,15|t++96329++glaive_toss,C79C6E,4,0,15|t++95820++chimera_shot,ABD473,5,0,15|t++47478++aimed_shot,C79C6E,6,0,15|t++41513++arcane_shot,69CCF0,7,0,15|t++14460++ranged,C79C6E,8,0,15|t++11274++steady_shot,C79C6E,9,0,15&chtt=Hunter_MM_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,13,12,12,10,8,8,7,6,6,6,6,5,4,1,1,1,1,1,1,1,1&chds=0,100&chdls=ffffff&chco=C79C6E,ABD473,C79C6E,69CCF0,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=ranged|chimera_shot|cat: melee|arcane_shot|wild_quiver_shot|glaive_toss|cat: claw|dire_beast: dire_beast_melee|aimed_shot|steady_shot|aimed_shot_mm|cat: lynx_rush|piercing_shots|kill_shot|serpent_sting|devilsaur: melee|wolf: melee|hyena: melee|raptor: melee|hyena: claw|raptor: claw|wolf: claw|devilsaur: claw&chtt=Hunter_MM_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:333212442345785431xvuqonmmkggfcaaYYXWVWWWWWWWWWWUUTUUTTTTUUVVVVVUVVVWXXXXXXYYYYYXWWWWWWWWWWWWWWWVVVVVWWXWWVWWVVUTTTTUTUUUUUUVVVVVVVVVVVVVVWWWWWVVUVVVVVVVVVVVVVVVUUUTTTTTTTTSSSSRSSSSTTUUUVVVVVWWXXXYYYXYXXXXXXXXWWWWWWVVUUTTTTTTSSSSSTTTUUUVVVWWWXXXXXXXYYYYYXXXXXXXWWWWWWWWWWWXXXWVVVVVVWWWWWWXXXWWWWWXYYZZaabbaaaabbccdeeeeeeeeddddeffffedbaaZZZZZZZZYYYYXXXWWXXYYYYXXXXXXX&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=97041|max=233618&chxp=1,1,42,100&chtt=Hunter_MM_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,0,4,2,7,11,16,21,31,38,70,109,105,142,197,240,304,363,442,491,550,543,608,595,624,619,573,559,495,450,389,325,289,207,163,119,89,73,50,25,17,13,9,7,2,2,2,1,1&chds=0,624&chbh=5&chxt=x&chxl=0:|min=89737|avg=97041|max=104283&chxp=0,1,50,100&chtt=Hunter_MM_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:38.3,20.7,10.7,10.0,6.9,3.7,3.3,1.4,0.6,0.3,0.3&chds=0,100&chdls=ffffff&chco=C79C6E,69CCF0,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473&chl=steady_shot 140.0s|arcane_shot 75.7s|aimed_shot 39.1s|chimera_shot 36.4s|glaive_toss 25.1s|dire_beast 13.5s|kill_shot 12.3s|lynx_rush 5.2s|stampede 2.1s|serpent_sting 1.2s|aspect_of_the_hawk 1.0s&chtt=Hunter_MM_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_MM_T14H 97041
aimed_shot 5072 5.2% 16.4 15.10sec 112975 47478 68846 152151 112975 53.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.43 16.43 0.00 0.00 2.3795 0.0000 1856307.81 1856307.81 0.00 47478.33 47478.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.73 47.03% 68846.32 68398 76184 68825.83 68398 74020 531989 531989 0.00
crit 8.70 52.97% 152150.96 140899 161611 152475.27 146004 161611 1324319 1324319 0.00
DPS Timeline Chart

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • cooldown:0.00
  • base_execute_time:2.90
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.master_marksman_fire.react
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6602.39
  • base_dd_max:7356.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
aimed_shot_mm 4255 4.4% 16.5 20.97sec 94525 0 69541 144308 94694 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: aimed_shot_mm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.44 0.00 0.00 0.0000 0.0000 1557238.73 1557238.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.91 66.36% 69540.68 68398 76184 69536.31 68398 71882 758853 758853 0.00
crit 5.53 33.64% 144307.92 140899 161611 144166.19 0 156939 798385 798385 0.00
DPS Timeline Chart

Action details: aimed_shot_mm

Static Values
  • id:82928
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:82928
  • name:Aimed Shot!
  • school:physical
  • tooltip:(null)
  • description:A powerful aimed shot that deals $m2% ranged weapon damage plus $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:6598.90
  • base_dd_max:7359.64
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.80
arcane_shot 8582 8.8% 72.9 4.14sec 43095 41513 31892 65915 43247 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.89 72.63 0.00 0.00 1.0381 0.0000 3141028.28 3141028.28 0.00 41512.85 41512.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.39 66.62% 31891.59 31163 35297 31890.81 31388 32418 1543182 1543182 0.00
crit 24.24 33.38% 65914.78 64195 72711 65913.19 64195 68353 1597847 1597847 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.thrill_of_the_hunt.react
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
blood_fury 0 0.0% 4.0 120.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
chimera_shot 9537 9.8% 35.1 9.88sec 99490 95820 74034 153020 99879 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chimera_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.08 34.95 0.00 0.00 1.0383 0.0000 3490440.52 3490440.52 0.00 95820.15 95820.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.51 67.28% 74034.34 72436 82419 74032.17 72589 75470 1740666 1740666 0.00
crit 11.43 32.72% 153019.53 149217 169783 153029.19 149217 163930 1749774 1749774 0.00
DPS Timeline Chart

Action details: chimera_shot

Static Values
  • id:53209
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:45.0
  • cooldown:9.00
  • base_execute_time:-1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=90
Spelldata
  • id:53209
  • name:Chimera Shot
  • school:nature
  • tooltip:(null)
  • description:An instant shot that causes $s3% ranged weapon Nature damage plus $<damage>, refreshing the duration of your Serpent Sting and healing you for $?s119447[${$53353m1+$119447m1}][$53353m1]% of your total health.$?s53243[ Applies the Hunter's Mark effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.10
dire_beast 0 (5235) 0.0% (5.4%) 13.0 28.99sec 147414 142018 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.0380 0.0000 0.00 0.00 0.00 142018.08 142018.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 13.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
glaive_toss 6603 6.8% 24.2 15.29sec 99953 96329 37062 77085 50352 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.18 48.00 0.00 0.00 1.0376 0.0000 2416804.02 2416804.02 0.00 96329.23 96329.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.06 66.79% 37062.02 34711 49074 37058.70 35113 38572 1188187 1188187 0.00
crit 15.94 33.21% 77085.46 71504 101093 77102.46 71504 85717 1228617 1228617 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3662 3.8% 11.8 5.80sec 113531 109383 84392 174748 114419 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.80 11.71 0.00 0.00 1.0379 0.0000 1340162.81 1340162.81 0.00 109383.19 109383.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.82 66.77% 84392.16 80871 92550 84387.14 80871 89791 659983 659983 0.00
crit 3.89 33.23% 174747.60 166594 190653 173293.63 0 190653 680180 680180 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4226) 0.0% (4.4%) 5.0 69.86sec 309371 298506 0 0 0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 0 16.8% 0.0% 5.5%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 45.00 45.00 1.0364 0.4444 0.00 0.00 0.00 61427.04 298505.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.4 83.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.6 16.79% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
piercing_shots 3828 3.9% 63.4 5.54sec 22099 0 0 0 0 0.0% 0.0% 0.0% 0.0% 273.7 5119 0 5119 0.0% 0.0% 74.8%

Stats details: piercing_shots

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.39 63.39 273.68 273.68 0.0000 1.0000 1400892.84 1400892.84 0.00 5118.78 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 273.7 100.00% 5118.77 801 24291 5119.86 3365 6945 1400893 1400893 0.00
DPS Timeline Chart

Action details: piercing_shots

Static Values
  • id:63468
  • school:bleed
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:63468
  • name:Piercing Shots
  • school:physical
  • tooltip:Bleeding.
  • description:Your critical Aimed, Steady and Chimera Shots cause the target to bleed for $53238s1% of the damage dealt over $63468d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:5595.66
  • num_ticks:8
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
ranged 12047 12.4% 159.7 2.28sec 27612 14460 20375 42185 27612 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 159.69 159.69 0.00 0.00 1.9095 0.0000 4409327.05 4409327.05 0.00 14459.89 14459.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.70 66.82% 20374.89 19826 23673 20374.69 20150 20589 2174100 2174100 0.00
crit 52.99 33.18% 42184.92 40841 48766 42185.17 41328 43222 2235227 2235227 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 3.0 110.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.bloodlust.up|target.time_to_die<=30
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
serpent_sting 2867 3.0% 1.2 112.21sec 887081 856021 0 0 0 0.0% 0.0% 0.0% 0.0% 113.9 6822 14145 9215 32.7% 0.0% 93.4%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.18 1.18 113.89 113.89 1.0363 3.0000 1049481.22 1049481.22 0.00 3060.61 856020.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.7 67.32% 6822.05 6562 8215 6821.98 6672 6991 523089 523089 0.00
crit 37.2 32.68% 14144.67 13517 16923 14145.31 13622 14911 526392 526392 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.health.pct<=90
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
stampede 0 (3463) 0.0% (3.6%) 2.0 301.15sec 633777 611459 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 611459.15 611459.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
steady_shot 4312 4.4% 108.5 3.27sec 14547 11274 10560 22109 14591 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: steady_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.50 108.17 0.00 0.00 1.2904 0.0000 1578331.73 1578331.73 0.00 11273.72 11273.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.42 65.10% 10559.98 10365 11756 10560.00 10449 10688 743648 743648 0.00
crit 37.75 34.90% 22108.82 21353 25051 22113.82 21740 22682 834683 834683 0.00
DPS Timeline Chart

Action details: steady_shot

Static Values
  • id:56641
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>5
Spelldata
  • id:56641
  • name:Steady Shot
  • school:physical
  • tooltip:(null)
  • description:A steady shot that causes $m2% weapon damage plus $m1. Generates $77443s1 Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1994.08
  • base_dd_max:1994.08
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
wild_quiver_shot 8363 8.6% 145.4 2.49sec 21058 0 15818 31813 21116 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_quiver_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.35 144.95 0.00 0.00 0.0000 0.0000 3060790.40 3060790.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.94 66.88% 15817.85 15402 18274 15817.89 15602 16033 1533377 1533377 0.00
crit 48.01 33.12% 31812.63 30803 36549 31812.81 31085 32673 1527413 1527413 0.00
DPS Timeline Chart

Action details: wild_quiver_shot

Static Values
  • id:76663
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:45.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76663
  • name:Wild Quiver
  • school:physical
  • tooltip:(null)
  • description:Deals ranged weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.80
pet - cat 19215 / 19215
claw 5801 6.0% 103.9 3.54sec 20441 13258 14058 28966 20441 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 103.87 103.87 0.00 0.00 1.5418 0.0000 2123161.10 2123161.10 0.00 13258.16 13258.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.90 56.71% 14058.00 10982 47281 14055.53 11871 16418 827986 827986 0.00
crit 44.66 43.00% 28966.04 21963 94562 28968.59 24029 34991 1293538 1293538 0.00
block 0.08 0.08% 20201.87 10982 47281 1588.00 0 47281 1637 1637 0.00
parry 0.23 0.22% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4226 4.4% 45.0 6.44sec 34375 0 23715 50327 34375 43.3% 3.6% 0.0% 1.2% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 45.00 0.00 0.00 0.0000 0.0000 1546855.72 1546855.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.35 51.88% 23715.05 17391 36962 23699.25 18182 30072 553690 553690 0.00
crit 19.48 43.29% 50326.51 34782 73924 50314.69 37072 66154 980486 980486 0.00
block 0.55 1.22% 23179.24 17391 36962 9815.92 0 36962 12679 12679 0.00
parry 1.62 3.61% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9187 9.5% 238.0 1.54sec 14128 9906 10083 20788 14128 43.3% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.00 238.00 0.00 0.00 1.4263 0.0000 3362503.72 3362503.72 0.00 9905.77 9905.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.03 32.37% 10082.97 8695 18481 10082.55 9159 11093 776721 776721 0.00
crit 103.15 43.34% 20788.29 17391 36962 20789.54 19244 22638 2144261 2144261 0.00
glance 57.23 24.05% 7700.06 6522 13861 7699.80 6842 8743 440654 440654 0.00
block 0.08 0.03% 11345.63 8695 18481 837.36 0 18481 868 868 0.00
parry 0.51 0.21% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.0 120.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7925 / 866
claw 3814 0.4% 13.5 25.53sec 11267 7291 7471 15507 11267 47.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 13.54 0.00 0.00 1.5453 0.0000 152574.30 152574.30 0.00 7291.14 7291.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.15 52.77% 7471.09 4097 11820 7468.05 4399 11087 53388 53388 0.00
crit 6.40 47.23% 15507.40 8194 23640 15524.47 0 23640 99186 99186 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4111 0.5% 28.7 11.53sec 5739 4468 3929 8092 5739 48.8% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 1.2845 0.0000 164425.17 164425.17 0.00 4467.59 4467.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.81 27.24% 3928.68 3219 4620 3926.38 0 4620 30667 30667 0.00
crit 13.99 48.81% 8091.53 6437 9241 8090.77 7097 8899 113161 113161 0.00
glance 6.86 23.94% 3002.36 2414 3465 3001.90 2414 3465 20598 20598 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.73sec 0 0 0 0 0 46.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.24 54.00% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.76 46.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 301.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7920 / 866
claw 3818 0.4% 13.5 25.53sec 11278 7298 7478 15489 11278 47.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 13.54 0.00 0.00 1.5453 0.0000 152736.38 152736.38 0.00 7298.18 7298.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.12 52.57% 7477.64 4097 11820 7475.69 0 11820 53236 53236 0.00
crit 6.42 47.43% 15489.42 8194 23640 15513.09 0 23640 99500 99500 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4101 0.5% 28.7 11.53sec 5726 4457 3931 8092 5726 48.5% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 1.2846 0.0000 164047.55 164047.55 0.00 4457.33 4457.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.85 27.41% 3931.26 3219 4620 3928.33 0 4620 30877 30877 0.00
crit 13.90 48.51% 8091.58 6437 9241 8092.10 6935 9150 112473 112473 0.00
glance 6.90 24.07% 3000.93 2414 3465 2999.97 0 3465 20697 20697 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7924 / 866
cackling_howl 0 0.0% 2.0 301.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3820 0.4% 13.5 25.53sec 11281 7301 7476 15494 11281 47.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 13.54 0.00 0.00 1.5452 0.0000 152786.67 152786.67 0.00 7300.93 7300.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.12 52.54% 7475.86 4097 11820 7471.49 4097 11820 53195 53195 0.00
crit 6.43 47.46% 15494.47 8194 23640 15513.74 0 23640 99592 99592 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4104 0.5% 28.7 11.53sec 5729 4460 3930 8089 5729 48.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 1.2846 0.0000 164166.85 164166.85 0.00 4460.09 4460.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.84 27.36% 3929.51 3219 4620 3926.43 0 4620 30802 30802 0.00
crit 13.93 48.62% 8088.93 6437 9241 8088.49 7142 9241 112681 112681 0.00
glance 6.89 24.03% 3004.09 2414 3465 3003.85 0 3465 20684 20684 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7920 / 866
claw 3815 0.4% 13.5 25.54sec 11270 7293 7475 15502 11270 47.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.54 13.54 0.00 0.00 1.5452 0.0000 152595.08 152595.08 0.00 7293.17 7293.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.14 52.73% 7474.85 4097 11820 7475.70 0 11820 53368 53368 0.00
crit 6.40 47.27% 15502.17 8194 23640 15532.41 0 23640 99227 99227 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4106 0.5% 28.7 11.53sec 5731 4462 3928 8093 5731 48.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.65 28.65 0.00 0.00 1.2846 0.0000 164222.80 164222.80 0.00 4461.73 4461.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.86 27.42% 3928.33 3219 4620 3925.64 0 4620 30859 30859 0.00
crit 13.93 48.62% 8093.48 6437 9241 8093.48 6980 8979 112751 112751 0.00
glance 6.87 23.96% 3001.88 2414 3465 3000.17 0 3465 20613 20613 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 301.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 10709 / 5235
dire_beast_melee 10709 5.4% 102.3 3.52sec 18727 12327 14167 29206 18727 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.32 102.32 0.00 0.00 1.5191 0.0000 1916107.91 1916107.91 0.00 12327.47 12327.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.21 40.27% 14166.80 12942 17925 14162.85 13231 15194 583781 583781 0.00
crit 36.56 35.73% 29205.78 25884 35851 29193.96 26506 31675 1067723 1067723 0.00
glance 24.55 24.00% 10777.27 9707 13444 10775.72 9832 11952 264604 264604 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.0 0.0 120.7sec 120.7sec 13.07% 13.07%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.1%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 17.99%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lord_blastingtons_scope_of_doom 9.0 0.0 41.4sec 41.4sec 24.59% 23.27%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.6%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
master_marksman 17.2 33.4 20.6sec 6.9sec 55.87% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:50.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_1:28.2%
  • master_marksman_2:27.7%

Spelldata details

  • id:82925
  • name:Ready, Set, Aim...
  • tooltip:After $u stacks, your next Aimed Shot will be instant cast.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
master_marksman_fire 16.6 0.0 20.9sec 20.9sec 7.61% 6.42%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_master_marksman_fire
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • master_marksman_fire_1:7.6%

Spelldata details

  • id:82926
  • name:Fire!
  • tooltip:Aimed Shot cast time and Focus cost reduced by $s1%.
  • description:The Hunter's Steady Shots have a chance to grant the Master Marksman effect. After reaching $82925u stacks, the Hunter's next Aimed Shot's cast time and Focus cost will be reduced by $82926s1% for $82926d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
rapid_fire 3.0 0.0 110.8sec 110.8sec 12.30% 17.10%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:12.3%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 5.8 0.0 66.0sec 66.0sec 23.67% 23.67%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.7%
steady_focus 14.1 26.4 26.2sec 8.8sec 87.43% 83.47%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_steady_focus
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • steady_focus_1:87.4%

Spelldata details

  • id:53220
  • name:Steady Focus
  • tooltip:Ranged attack speed increased by $w1%. Steady Shot Focus generation increased by $w2.
  • description:$@spelldesc53224
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
terror_in_the_mists 6.0 0.0 64.7sec 64.7sec 32.61% 32.61%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.6%
virmens_bite_potion 2.0 0.0 310.5sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Hunter_MM_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
cat-rabid 4.0 0.0 120.6sec 120.7sec 17.52% 21.17%

Buff details

  • buff initial source:Hunter_MM_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:17.5%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
cat-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_MM_T14H_cat
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
devilsaur-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_MM_T14H_devilsaur
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
dire_beast-stunned 7.3 0.0 49.8sec 0.0sec 3.94% 3.94%

Buff details

  • buff initial source:Hunter_MM_T14H_dire_beast
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.9%
dire_beast-stunned 0.0 0.0 0.0sec 0.0sec 0.29% 0.29%

Buff details

  • buff initial source:Hunter_MM_T14H_dire_beast
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.0%
hyena-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_MM_T14H_hyena
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
raptor-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_MM_T14H_raptor
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
wolf-rabid 2.0 0.0 301.2sec 301.2sec 99.91% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 301.2sec 301.2sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-stunned 1.0 0.0 0.0sec 0.0sec 2.50% 2.50%

Buff details

  • buff initial source:Hunter_MM_T14H_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_MM_T14H
aimed_shot Focus 16.4 759.1 46.2 46.2 2445.3
arcane_shot Focus 72.9 1457.7 20.0 20.0 2154.8
chimera_shot Focus 35.1 1578.8 45.0 45.0 2210.9
glaive_toss Focus 24.2 362.7 15.0 15.0 6663.5
serpent_sting Focus 1.2 29.6 25.0 25.0 35483.2
pet - cat
claw Focus 103.9 2794.0 26.9 26.9 759.9
pet - devilsaur
claw Focus 13.5 513.2 37.9 37.9 297.3
pet - raptor
claw Focus 13.5 513.2 37.9 37.9 297.6
pet - hyena
claw Focus 13.5 513.2 37.9 37.9 297.7
pet - wolf
claw Focus 13.5 513.2 37.9 37.9 297.4
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1463.00 2104.62 1.44 62.17 2.87%
rapid_recuperation Focus 180.00 44.93 0.25 5.47 10.85%
steady_shot Focus 108.17 1496.89 13.84 17.56 1.16%
dire_beast Focus 102.32 481.60 4.71 29.99 5.86%
pet - cat
focus_regen Focus 1463.00 2708.49 1.85 0.00 0.00%
pet - devilsaur
focus_regen Focus 160.00 343.09 2.14 0.25 0.07%
pet - raptor
focus_regen Focus 160.00 343.09 2.14 0.25 0.07%
pet - hyena
focus_regen Focus 160.00 343.09 2.14 0.24 0.07%
pet - wolf
focus_regen Focus 160.00 343.09 2.14 0.24 0.07%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Focus 11.28 11.44
Combat End Resource Mean Min Max
Health -6349058.00 -6349058.00 -6349058.00
Focus 41.38 1.67 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 2.3%
cat-Focus Cap 2.3%
raptor-Focus Cap 2.3%
wolf-Focus Cap 2.3%
dire_beast-Focus Cap 2.3%

Procs

Count Interval
wild_quiver 145.4 2.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 97040.95
Minimum 89736.56
Maximum 104282.64
Spread ( max - min ) 14546.08
Range [ ( max - min ) / 2 * 100% ] 7.49%
Standard Deviation 1849.7624
5th Percentile 93980.62
95th Percentile 100041.44
( 95th Percentile - 5th Percentile ) 6060.81
Mean Distribution
Standard Deviation 18.5013
95.00% Confidence Intervall ( 97004.69 - 97077.21 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1395
0.1 Scale Factor Error with Delta=300 29208
0.05 Scale Factor Error with Delta=300 116835
0.01 Scale Factor Error with Delta=300 2920892
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 97040.95

Damage

Sample Data
Count 9996
Mean 25300805.41

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 354.20
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 1.00 aspect_of_the_hawk,moving=0
9 0.00 aspect_of_the_fox,moving=1
A 31.36 auto_shot
B 0.00 explosive_trap,if=target.adds>0
C 4.00 blood_fury
D 24.18 glaive_toss,if=enabled
E 0.00 powershot,if=enabled
F 0.00 barrage,if=enabled
G 0.00 blink_strike,if=enabled
H 5.00 lynx_rush,if=enabled&!ticking
I 0.00 multi_shot,if=target.adds>5
J 0.00 steady_shot,if=target.adds>5
K 1.18 serpent_sting,if=!ticking&target.health.pct<=90
L 35.08 chimera_shot,if=target.health.pct<=90
M 13.00 dire_beast,if=enabled
N 2.00 stampede
O 3.00 rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
P 1.00 readiness,wait_for_rapid_fire=1
Q 25.11 steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
R 11.80 kill_shot
S 14.30 aimed_shot,if=buff.master_marksman_fire.react
T 0.00 a_murder_of_crows,if=enabled&!ticking
U 0.00 arcane_shot,if=buff.thrill_of_the_hunt.react
V 19.11 aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
W 72.89 arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
X 0.00 fervor,if=enabled&focus<=50
Y 89.18 steady_shot

Sample Sequence

8ACDHMNOPDHMVAVAYQVAVAYYVAVAYDYVAYQVAYYVAYYVVADKMYLYQVAVAOVAYYLSDYYVAYAVAYLWYQYSDMLWWWYQYWLWWWYDYQLWAYWYSYHLMDWYQWWLWYWYQAQDLSWWCYYYWLWYMYDWYALWYQYSWWLYDWYQYWLWYWYMQDLSWWYYAQLWWWYYADYQLWWHYYMYLWDWYQYWLWWWYQYDLSWWYQYWLMWAYDAOVAYQYLVVAYYYVACVAYDYQKLSYWMYQWLWDYYYWWLWWAYQSYDLWHWYQMAWLWYYDRRYLWSWYQYNL7RDRSYQWMALWWRRYQDWLSWYRRYQLWWYDYARRLMWYQYWWDLRRWAYCQWW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 32.56% 22.56% 1965

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
Shirt empty
Chest sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
Waist rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
Wrists stonemaw_armguards,id=87014,enchant=180agi
Hands yaungol_slayers_gloves,id=87003,enchant=170haste
Finger1 painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_MM_T14H"
origin="unknown"
level=90
race=orc
spec=marksmanship
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#YZ!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/blood_fury
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/multi_shot,if=target.adds>5
actions+=/steady_shot,if=target.adds>5
actions+=/serpent_sting,if=!ticking&target.health.pct<=90
actions+=/chimera_shot,if=target.health.pct<=90
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire,if=!buff.bloodlust.up|target.time_to_die<=30
actions+=/readiness,wait_for_rapid_fire=1
actions+=/steady_shot,if=buff.pre_steady_focus.up&buff.steady_focus.remains<3
actions+=/kill_shot
actions+=/aimed_shot,if=buff.master_marksman_fire.react
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/arcane_shot,if=buff.thrill_of_the_hunt.react
actions+=/aimed_shot,if=target.health.pct>90|buff.rapid_fire.up|buff.bloodlust.react
actions+=/arcane_shot,if=(focus>=66|cooldown.chimera_shot.remains>=5)&(target.health.pct<90&!buff.rapid_fire.up&!buff.bloodlust.react)
actions+=/fervor,if=enabled&focus<=50
actions+=/steady_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Hunter_SV_T14H : 98791 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
98790.9 98790.9 26.25 / 0.03% 2194 / 2.2% 7478.1 9.7 9.6 Focus 0.00% 54.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

Charts

http://5.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:589302|300714|191400|135978|108334|96744|71929|48521|20004|12509&chds=0,1178605&chco=C79C6E,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C41F3B,69CCF0,ABD473,C79C6E&chm=t++589302++stampede,C79C6E,0,0,15|t++300714++lynx_rush,C79C6E,1,0,15|t++191400++black_arrow,9482C9,2,0,15|t++135978++dire_beast,C79C6E,3,0,15|t++108334++kill_shot,C79C6E,4,0,15|t++96744++glaive_toss,C79C6E,5,0,15|t++71929++explosive_shot,C41F3B,6,0,15|t++48521++arcane_shot,69CCF0,7,0,15|t++20004++cobra_shot,ABD473,8,0,15|t++12509++ranged,C79C6E,9,0,15&chtt=Hunter_SV_T14H Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,16,13,12,11,10,9,8,7,7,6,5,1,1,1,1,1,1,1,1,0&chds=0,100&chdls=ffffff&chco=C41F3B,C79C6E,C79C6E,69CCF0,9482C9,ABD473,C79C6E,ABD473,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473&chl=explosive_shot|ranged|cat: melee|arcane_shot|black_arrow|serpent_sting|glaive_toss|cobra_shot|dire_beast: dire_beast_melee|cat: claw|cat: lynx_rush|kill_shot|hyena: melee|wolf: melee|devilsaur: melee|raptor: melee|wolf: claw|raptor: claw|devilsaur: claw|hyena: claw|serpent_sting_burst&chtt=Hunter_SV_T14H Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:uxz2435555567875564420wuroolkihffedcbaZZZYYYXXWVVUUUVTTTTUUTUUUUVVVWWWXWWWXXXYYZZYYYYYYYYYZZZZZYYYXXXXYYXWWWWWWWWVWWWWWWWVVVVVWWXXXXXXYXXYYYYZZaaZZaaZZYYYXYXXXXXWWWVVVVVVVUTTTUTTTTUUUVWWWWWWXXYYYYYYYYZZZZZZZaaababbbbaaZZYYXXXWWVVVUUUUUUVWXYZZZZZZZZZZZZZZYZYYYXXWWWWWWWWWXXXYYYXXXWXXXYXYYYZZZZZZYYYZZYZabcccccddddeefggghiiihhggghgggggfeeeedcccccbbbbaaZYXYZZZYYYYXYXXY&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=98791|max=220676&chxp=1,1,45,100&chtt=Hunter_SV_T14H DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,1,7,11,10,24,23,35,37,50,82,99,142,176,245,299,320,394,435,506,538,543,553,599,625,606,560,481,462,436,344,296,249,193,158,117,99,79,56,25,30,16,12,10,1,3,2,2,0,1&chds=0,625&chbh=5&chxt=x&chxl=0:|min=94039|avg=98791|max=104065&chxp=0,1,47,100&chtt=Hunter_SV_T14H DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.7,29.2,17.4,6.8,4.1,3.6,3.2,1.4,0.6,0.6,0.3&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,69CCF0,C79C6E,9482C9,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ABD473&chl=explosive_shot 108.6s|cobra_shot 106.7s|arcane_shot 63.6s|glaive_toss 24.9s|black_arrow 15.1s|dire_beast 13.1s|kill_shot 11.6s|lynx_rush 5.2s|stampede 2.1s|serpent_sting 2.1s|aspect_of_the_hawk 1.0s&chtt=Hunter_SV_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Hunter_SV_T14H 98791
arcane_shot 8426 8.5% 61.2 5.69sec 50360 48521 37141 76953 50524 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.24 61.04 0.00 0.00 1.0379 0.0000 3084068.14 3084068.14 0.00 48520.63 48520.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.52 66.38% 37140.53 36236 42444 37139.77 36535 37863 1505027 1505027 0.00
crit 20.52 33.62% 76953.15 74646 87434 76954.00 74646 80322 1579041 1579041 0.00
DPS Timeline Chart

Action details: arcane_shot

Static Values
  • id:3044
  • school:arcane
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:20.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus>=67
Spelldata
  • id:3044
  • name:Arcane Shot
  • school:arcane
  • tooltip:(null)
  • description:An instant shot that causes $m2% weapon damage plus $m1 as Arcane damage$?s53243[ and applies the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:2305.65
  • base_dd_max:2305.65
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
black_arrow 7898 8.0% 14.6 25.06sec 198611 191400 0 0 0 0.0% 0.0% 0.0% 0.0% 142.5 14897 31096 20278 33.2% 0.0% 77.9%

Stats details: black_arrow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 142.55 142.55 1.0377 2.0000 2890527.67 2890527.67 0.00 9628.77 191400.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.2 66.78% 14896.64 13847 19899 14896.59 14294 15527 1418116 1418116 0.00
crit 47.4 33.22% 31096.04 28525 40993 31095.81 29103 33507 1472411 1472411 0.00
DPS Timeline Chart

Action details: black_arrow

Static Values
  • id:3674
  • school:shadow
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:24.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&target.time_to_die>=8
Spelldata
  • id:3674
  • name:Black Arrow
  • school:shadow
  • tooltip:$s1 Shadow damage every $t1 seconds.
  • description:Fires a Black Arrow at the target, dealing $3674o1 damage over $3674d. Black Arrow shares a cooldown with other Fire Trap spells.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.150000
  • base_td:186.94
  • num_ticks:10
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
blood_fury 0 0.0% 4.0 120.72sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
cobra_shot 5832 5.9% 66.9 5.14sec 31893 20004 23782 49154 31977 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cobra_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.92 66.75 0.00 0.00 1.5943 0.0000 2134411.47 2134411.47 0.00 20004.23 20004.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.19 67.70% 23782.30 23296 27641 23781.94 23441 24200 1074755 1074755 0.00
crit 21.56 32.30% 49154.38 47990 56941 49155.72 47990 50742 1059656 1059656 0.00
DPS Timeline Chart

Action details: cobra_shot

Static Values
  • id:77767
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:77767
  • name:Cobra Shot
  • school:nature
  • tooltip:(null)
  • description:Deals $s2% weapon damage in the form of Nature damage and increases the duration of your Serpent Sting on the target by $s3 sec. Generates $91954s1 Focus.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.70
dire_beast 0 (4860) 0.0% (4.9%) 12.6 29.82sec 141127 135978 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.60 12.60 0.00 0.00 1.0379 0.0000 0.00 0.00 0.00 135978.25 135978.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dire_beast

Static Values
  • id:120679
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled
Spelldata
  • id:120679
  • name:Dire Beast
  • school:nature
  • tooltip:(null)
  • description:Summons a powerful wild beast to attack your target for $d. Each time the beast deals damage, you will gain $120694s1 Focus.
explosive_shot 21349 21.6% 104.7 3.47sec 74661 71929 18589 38785 25302 33.2% 0.0% 0.0% 0.0% 179.1 21558 43630 28877 33.2% 0.0% 48.9%

Stats details: explosive_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.66 104.42 179.10 179.10 1.0380 1.0000 7813809.18 7813809.18 0.00 27156.93 71928.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.71 66.76% 18588.51 17448 25074 18588.07 17956 19143 1295791 1295791 0.00
crit 34.71 33.24% 38784.60 35943 51652 38787.25 36598 41680 1346252 1346252 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.7 66.84% 21558.11 17448 46707 21557.08 20048 23256 2580637 2580637 0.00
crit 59.4 33.16% 43629.60 34896 93414 43629.17 38606 48485 2591130 2591130 0.00
DPS Timeline Chart

Action details: explosive_shot

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(remains<2.0)
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:true
  • direct_power_mod:0.234000
  • base_dd_min:145.82
  • base_dd_max:437.45

Action details: explosive_shot_tick

Static Values
  • id:53301
  • school:fire
  • resource:focus
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:6.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53301
  • name:Explosive Shot
  • school:fire
  • tooltip:Taking Fire damage every second.
  • description:You fire an explosive charge into the enemy target, dealing ${($m1+$M1)/2+$RAP*$m3/1000} Fire damage initially and every second for $d$?s53243[ and applying the Hunter's Mark effect][].
Direct Damage
  • may_crit:false
  • direct_power_mod:0.234000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:21712.19
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
glaive_toss 6586 6.7% 24.0 15.44sec 100438 96744 37045 77086 50228 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: glaive_toss

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.00 47.99 0.00 0.00 1.0382 0.0000 2410563.79 2410563.79 0.00 96743.74 96743.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.19 67.07% 37045.10 34711 49074 37041.94 35246 38727 1192503 1192503 0.00
crit 15.80 32.93% 77085.51 71504 101093 77101.52 71504 84675 1218061 1218061 0.00
DPS Timeline Chart

Action details: glaive_toss

Static Values
  • id:117050
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:enabled
Spelldata
  • id:117050
  • name:Glaive Toss
  • school:stormstrike
  • tooltip:(null)
  • description:You hurl two glaives toward a target, each dealing $120761s1 damage to each enemy struck and reducing movement speed by $120761s2% for $120761d. The primary target will take $s1 times as much damage from each strike. The Glaives will return back to you, damaging and snaring targets again as they return.
kill_shot 3439 3.5% 11.2 6.16sec 112489 108334 84484 174721 114758 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: kill_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.19 10.97 0.00 0.00 1.0384 0.0000 1258517.92 1258517.92 0.00 108334.16 108334.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.29 66.45% 84484.30 80871 92550 84484.55 80871 90873 615672 615672 0.00
crit 3.68 33.55% 174720.93 166594 190653 172903.44 0 190653 642846 642846 0.00
DPS Timeline Chart

Action details: kill_shot

Static Values
  • id:53351
  • school:physical
  • resource:none
  • range:45.0
  • travel_speed:40.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53351
  • name:Kill Shot
  • school:physical
  • tooltip:(null)
  • description:You attempt to finish the wounded target off, firing a long range attack dealing $m2% weapon damage. Kill Shot can only be used on enemies that have 20% or less health. If Kill Shot fails to kill the target, the cooldown is instantly reset, but cannot be reset more often than once every $90967d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:4.20
  • base_dd_max:4.20
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.20
lynx_rush 0 (4261) 0.0% (4.3%) 5.0 70.18sec 311901 300714 0 0 0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 0 16.7% 0.0% 5.5%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 45.00 45.00 1.0372 0.4444 0.00 0.00 0.00 61919.42 300713.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.5 83.26% 0.00 0 0 0.00 0 0 0 0 0.00
crit 7.5 16.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120697
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:enabled&!ticking
Spelldata
  • id:120697
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:Your pet rapidly charges from target to target, attacking $s1 times over $d, dealing $120699m2% of its normal attack damage to each target. The pet must be within 10 yards of the target to Lynx Rush.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:8
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: lynx_rush_bite

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
ranged 11375 11.5% 149.8 2.44sec 27793 12509 20445 42424 27793 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ranged

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.79 149.79 0.00 0.00 2.2218 0.0000 4163206.92 4163206.92 0.00 12509.19 12509.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.71 66.57% 20444.69 19826 23673 20444.53 20167 20669 2038544 2038544 0.00
crit 50.08 33.43% 42423.74 40841 48766 42424.79 41371 43907 2124663 2124663 0.00
DPS Timeline Chart

Action details: ranged

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rapid_fire 0 0.0% 3.0 99.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rapid_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rapid_fire

Static Values
  • id:3045
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:3045
  • name:Rapid Fire
  • school:physical
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
serpent_sting 7102 (7377) 7.2% (7.5%) 2.0 63.95sec 1359993 1312013 0 0 0 0.0% 0.0% 0.0% 0.0% 119.8 16000 33265 21698 33.0% 0.0% 98.2%

Stats details: serpent_sting

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 119.80 119.80 1.0366 3.0000 2599504.59 2599504.59 0.00 7469.90 1312012.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.3 67.00% 16000.30 15260 20226 15999.94 15635 16422 1284251 1284251 0.00
crit 39.5 33.00% 33264.69 31435 41665 33265.60 31901 35098 1315253 1315253 0.00
DPS Timeline Chart

Action details: serpent_sting

Static Values
  • id:1978
  • school:nature
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:-1000.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.adds>2
Spelldata
  • id:1978
  • name:Serpent Sting
  • school:nature
  • tooltip:Causes $118253s1 Nature damage every $118253t1 seconds.
  • description:Causes $118253o1 Nature damage over $118253d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.080000
  • base_td:1620.19
  • num_ticks:2
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
serpent_sting_burst 275 0.3% 2.0 63.95sec 50679 0 35423 73336 50679 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: serpent_sting_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 0.0000 0.0000 100617.87 100617.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.19 59.76% 35422.68 29345 38894 28683.68 0 38894 42028 42028 0.00
crit 0.80 40.24% 73336.24 60450 80122 45810.83 0 80122 58590 58590 0.00
DPS Timeline Chart

Action details: serpent_sting_burst

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
stampede 0 (3341) 0.0% (3.4%) 2.0 303.14sec 611401 589302 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stampede

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0375 0.0000 0.00 0.00 0.00 589302.38 589302.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stampede

Static Values
  • id:121818
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121818
  • name:Stampede
  • school:nature
  • tooltip:(null)
  • description:Summons all of your pets to fight your current target for $d. Your pets deal ${100+$130201m1}% of their normal damage while summoned this way.
pet - cat 18308 / 18308
claw 4858 4.9% 88.0 4.20sec 20204 13041 13880 28590 20204 43.1% 0.2% 0.0% 0.1% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.00 88.00 0.00 0.00 1.5493 0.0000 1777945.96 1777945.96 0.00 13041.01 13041.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.81 56.60% 13879.71 10982 47281 13878.05 11809 16114 691322 691322 0.00
crit 37.97 43.15% 28590.45 21963 94562 28597.50 23689 34900 1085525 1085525 0.00
block 0.06 0.06% 19584.77 10982 47281 1065.69 0 47281 1099 1099 0.00
parry 0.17 0.19% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
lynx_rush 4261 4.3% 45.0 6.47sec 34656 0 23840 50769 34656 43.4% 3.6% 0.0% 1.2% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lynx_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.00 45.00 0.00 0.00 0.0000 0.0000 1559502.62 1559502.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.32 51.82% 23839.68 17391 36962 23830.87 18918 29197 555956 555956 0.00
crit 19.52 43.37% 50768.55 34782 73924 50807.34 36761 66363 990759 990759 0.00
block 0.55 1.21% 23407.05 17391 36962 9970.10 0 36962 12788 12788 0.00
parry 1.62 3.60% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lynx_rush

Static Values
  • id:120699
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120699
  • name:Lynx Rush
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc120697
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
melee 9190 9.3% 238.0 1.54sec 14132 9908 10097 20779 14132 43.3% 0.2% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 238.00 238.00 0.00 0.00 1.4263 0.0000 3363388.86 3363388.86 0.00 9908.17 9908.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.30 32.48% 10096.65 8695 18481 10096.44 9300 11089 780483 780483 0.00
crit 103.15 43.34% 20778.60 17391 36962 20779.40 19201 22368 2143262 2143262 0.00
glance 57.02 23.96% 7696.00 6522 13861 7696.21 6786 8751 438792 438792 0.00
block 0.07 0.03% 11400.06 8695 18481 827.18 0 18481 852 852 0.00
parry 0.46 0.19% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 4.0 120.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - devilsaur 7642 / 835
claw 3547 0.4% 13.0 26.80sec 10913 7058 7226 14953 10913 47.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5461 0.0000 141863.74 141863.74 0.00 7058.25 7058.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.80 52.29% 7226.36 4097 11820 7218.67 4097 11820 49126 49126 0.00
crit 6.20 47.71% 14953.22 8194 23640 14958.92 0 23640 92738 92738 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4095 0.5% 28.9 11.53sec 5669 4449 3891 7965 5669 49.1% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.89 28.89 0.00 0.00 1.2743 0.0000 163796.89 163796.89 0.00 4448.83 4448.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.79 26.97% 3891.01 3219 4620 3890.04 3219 4620 30322 30322 0.00
crit 14.18 49.09% 7964.99 6437 9241 7964.49 7055 8872 112975 112975 0.00
glance 6.92 23.93% 2964.40 2414 3465 2962.99 0 3465 20499 20499 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
monstrous_bite 0 0.0% 6.0 63.98sec 0 0 0 0 0 46.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: monstrous_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.19 53.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.81 46.88% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: monstrous_bite

Static Values
  • id:54680
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54680
  • name:Monstrous Bite
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:Your devilsaur ferociously bites the enemy, reducing the effectiveness of any healing received for $d.
rabid 0 0.0% 2.0 303.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - raptor 7637 / 835
claw 3548 0.4% 13.0 26.80sec 10916 7060 7224 14958 10916 47.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5461 0.0000 141908.13 141908.13 0.00 7060.46 7060.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.79 52.26% 7224.05 4097 11820 7217.10 4097 11820 49082 49082 0.00
crit 6.21 47.74% 14958.04 8194 23640 14982.17 0 23640 92826 92826 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4090 0.5% 28.9 11.53sec 5662 4443 3891 7967 5662 48.9% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.89 28.89 0.00 0.00 1.2743 0.0000 163581.40 163581.40 0.00 4442.97 4442.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.80 27.01% 3890.76 3219 4620 3890.04 3219 4541 30359 30359 0.00
crit 14.13 48.92% 7967.46 6437 9241 7966.92 7023 8969 112616 112616 0.00
glance 6.95 24.07% 2962.95 2414 3465 2961.40 0 3465 20606 20606 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - hyena 7642 / 835
cackling_howl 0 0.0% 2.0 303.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cackling_howl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cackling_howl

Static Values
  • id:128432
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128432
  • name:Cackling Howl
  • school:physical
  • tooltip:Melee and ranged attack speed increased by $s1%.
  • description:The hyena lets out a cackling howl, increasing the melee and ranged attack speed of all party and raid members within $a1 yards by $s1% for $d.
claw 3545 0.4% 13.0 26.80sec 10907 7054 7229 14949 10907 47.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5461 0.0000 141787.58 141787.58 0.00 7054.46 7054.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.81 52.36% 7228.62 4097 11820 7226.30 4097 11820 49201 49201 0.00
crit 6.19 47.64% 14948.80 8194 23640 14970.55 0 23640 92587 92587 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4097 0.5% 28.9 11.52sec 5672 4451 3892 7964 5672 49.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.89 28.89 0.00 0.00 1.2743 0.0000 163893.81 163893.81 0.00 4451.10 4451.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.77 26.89% 3891.76 3219 4620 3891.70 0 4620 30235 30235 0.00
crit 14.21 49.17% 7964.30 6437 9241 7963.57 7055 8811 113157 113157 0.00
glance 6.92 23.94% 2963.99 2414 3465 2963.33 0 3465 20502 20502 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - wolf 7649 / 836
claw 3554 0.4% 13.0 26.80sec 10935 7073 7217 14972 10935 47.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: claw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.00 13.00 0.00 0.00 1.5461 0.0000 142159.17 142159.17 0.00 7072.95 7072.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.77 52.05% 7216.61 4097 11820 7209.04 4097 11215 48831 48831 0.00
crit 6.23 47.95% 14972.01 8194 23640 14982.02 0 23640 93328 93328 0.00
DPS Timeline Chart

Action details: claw

Static Values
  • id:16827
  • school:physical
  • resource:focus
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:16827
  • name:Claw
  • school:physical
  • tooltip:(null)
  • description:Claw the enemy, causing ${$<damage>} damage. Deals $62762s2% more damage and costs $62762s1% more Focus when your pet has 50 or more Focus.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.168000
  • base_dd_min:117.21
  • base_dd_max:166.94
melee 4095 0.5% 28.9 11.53sec 5670 4449 3892 7968 5670 49.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.89 28.89 0.00 0.00 1.2743 0.0000 163811.73 163811.73 0.00 4448.99 4448.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.75 26.83% 3892.37 3219 4620 3893.08 3219 4620 30179 30179 0.00
crit 14.19 49.11% 7967.78 6437 9241 7967.91 7055 8798 113050 113050 0.00
glance 6.95 24.06% 2960.89 2414 3465 2959.54 0 3465 20583 20583 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.2000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rabid 0 0.0% 2.0 303.18sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rabid

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rabid

Static Values
  • id:53401
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:53401
  • name:Rabid
  • school:physical
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
pet - dire_beast 10650 / 4860
dire_beast_melee 10650 4.9% 95.5 3.70sec 18622 12277 14073 28868 18622 36.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dire_beast_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.51 95.51 0.00 0.00 1.5168 0.0000 1778595.52 1778595.52 0.00 12276.59 12276.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.06 39.85% 14073.09 12942 17925 14073.84 13274 15109 535600 535600 0.00
crit 34.60 36.22% 28868.12 25884 35851 28869.75 26690 31678 998775 998775 0.00
glance 22.86 23.93% 10685.15 9707 13444 10686.30 9811 11632 244221 244221 0.00
DPS Timeline Chart

Action details: dire_beast_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
aspect_of_the_hawk 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_aspect_of_the_hawk
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • aspect_of_the_hawk_1:100.0%

Spelldata details

  • id:13165
  • name:Aspect of the Hawk
  • tooltip:Ranged attack power increased by $w1%.
  • description:The Hunter takes on the aspects of a hawk, increasing ranged attack power by $s1%. Only one Aspect can be active at a time.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.0 0.0 120.7sec 120.7sec 13.33% 13.33%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40

    Stack Uptimes

    • blood_fury_1:13.3%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by $s1.
  • description:Increases attack power by $s1. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 18.67%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
lock_and_load 24.5 0.0 14.6sec 14.6sec 12.55% 46.73%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:12.00
  • cooldown:10.00
  • default_chance:40.00%
  • default_value:-1.00

Stack Uptimes

  • lock_and_load_1:7.6%
  • lock_and_load_2:5.0%

Spelldata details

  • id:56453
  • name:Lock and Load
  • tooltip:Your Explosive Shot triggers no cooldown and costs no Focus.
  • description:$@spelldesc56343
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
lord_blastingtons_scope_of_doom 9.0 0.0 41.5sec 41.5sec 24.59% 23.63%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_lord_blastingtons_scope_of_doom
  • max_stacks:1
  • duration:10.00
  • cooldown:40.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    Stack Uptimes

    • lord_blastingtons_scope_of_doom_1:24.6%

Spelldata details

  • id:109085
  • name:Lord Blastington's Scope of Doom
  • tooltip:Agility increased by $s1.
  • description:
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
rapid_fire 3.0 0.0 99.6sec 99.6sec 12.30% 19.11%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_rapid_fire
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rapid_fire_1:12.3%

Spelldata details

  • id:3045
  • name:Rapid Fire
  • tooltip:Increases ranged attack speed by $w1$?s131564[ and PvP Power by $w2][]%.
  • description:Increases ranged attack speed by $s1%$?s131564[ and PvP Power by $m2][] for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
relic_of_xuen 5.7 0.0 67.1sec 67.1sec 23.24% 23.24%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:23.2%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
terror_in_the_mists 6.0 0.0 65.1sec 65.1sec 32.58% 32.58%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.6%
virmens_bite_potion 2.0 0.0 310.5sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Hunter_SV_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
cat-rabid 4.0 0.0 120.7sec 120.5sec 17.49% 21.51%

Buff details

  • buff initial source:Hunter_SV_T14H_cat
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:17.5%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
cat-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Hunter_SV_T14H_cat
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
devilsaur-rabid 2.0 0.0 303.3sec 303.3sec 99.90% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
devilsaur-stampede 2.0 0.0 303.3sec 303.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
devilsaur-stunned 0.9 0.0 0.0sec 0.0sec 2.33% 2.33%

Buff details

  • buff initial source:Hunter_SV_T14H_devilsaur
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
dire_beast-stunned 7.2 0.0 47.5sec 0.0sec 4.14% 4.14%

Buff details

  • buff initial source:Hunter_SV_T14H_dire_beast
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.9%
hyena-rabid 2.0 0.0 303.3sec 303.3sec 99.90% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
hyena-stampede 2.0 0.0 303.3sec 303.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
hyena-stunned 0.9 0.0 0.0sec 0.0sec 2.33% 2.33%

Buff details

  • buff initial source:Hunter_SV_T14H_hyena
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
raptor-rabid 2.0 0.0 303.3sec 303.3sec 99.90% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raptor-stampede 2.0 0.0 303.3sec 303.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
raptor-stunned 0.9 0.0 0.0sec 0.0sec 2.33% 2.33%

Buff details

  • buff initial source:Hunter_SV_T14H_raptor
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
wolf-rabid 2.0 0.0 303.3sec 303.3sec 99.90% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_rabid
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rabid_1:10.9%

Spelldata details

  • id:53401
  • name:Rabid
  • tooltip:Attack power increased by $s1%.
  • description:Increases your pet's attack power by $s1% for $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
wolf-stampede 2.0 0.0 303.3sec 303.3sec 100.00% 100.00%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_stampede
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stampede_1:10.9%

Spelldata details

  • id:130201
  • name:Stampede
  • tooltip:(null)
  • description:
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
wolf-stunned 0.9 0.0 0.0sec 0.0sec 2.33% 2.33%

Buff details

  • buff initial source:Hunter_SV_T14H_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Hunter_SV_T14H
arcane_shot Focus 61.2 1224.8 20.0 20.0 2518.0
black_arrow Focus 14.6 509.4 35.0 35.0 5674.6
explosive_shot Focus 104.7 1393.9 13.3 13.3 5605.8
glaive_toss Focus 24.0 360.0 15.0 15.0 6695.9
serpent_sting Focus 2.0 49.6 25.0 25.0 54399.7
pet - cat
claw Focus 88.0 2325.0 26.4 26.4 764.7
pet - devilsaur
claw Focus 13.0 475.0 36.5 36.5 298.7
pet - raptor
claw Focus 13.0 475.0 36.5 36.5 298.8
pet - hyena
claw Focus 13.0 475.0 36.5 36.5 298.5
pet - wolf
claw Focus 13.0 475.0 36.5 36.5 299.3
Resource Gains Type Count Total Average Overflow
focus_regen Focus 1463.00 1755.34 1.20 34.04 1.90%
cobra_shot Focus 66.75 922.19 13.82 12.30 1.32%
dire_beast Focus 95.51 469.10 4.91 8.46 1.77%
viper_venom Focus 119.80 355.09 2.96 4.32 1.20%
pet - cat
focus_regen Focus 1463.00 2236.72 1.53 0.00 0.00%
pet - devilsaur
focus_regen Focus 159.98 305.78 1.91 0.22 0.07%
pet - raptor
focus_regen Focus 159.98 305.79 1.91 0.22 0.07%
pet - hyena
focus_regen Focus 159.98 305.78 1.91 0.22 0.07%
pet - wolf
focus_regen Focus 159.98 305.78 1.91 0.22 0.07%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Focus 9.57 9.67
Combat End Resource Mean Min Max
Health -6349058.00 -6349058.00 -6349058.00
Focus 64.06 3.94 100.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 0.5%
cat-Focus Cap 0.5%
raptor-Focus Cap 0.5%
wolf-Focus Cap 0.5%
dire_beast-Focus Cap 0.5%

Procs

Count Interval
lock_and_load 24.5 14.6sec
explosive_shot_focus_starved 0.2 88.5sec
black_arrow_focus_starved 0.3 89.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 98790.88
Minimum 94038.93
Maximum 104065.40
Spread ( max - min ) 10026.47
Range [ ( max - min ) / 2 * 100% ] 5.07%
Standard Deviation 1338.8708
5th Percentile 96615.15
95th Percentile 101002.54
( 95th Percentile - 5th Percentile ) 4387.39
Mean Distribution
Standard Deviation 13.3914
95.00% Confidence Intervall ( 98764.64 - 98817.13 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 705
0.1 Scale Factor Error with Delta=300 15302
0.05 Scale Factor Error with Delta=300 61209
0.01 Scale Factor Error with Delta=300 1530245
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 98790.88

Damage

Sample Data
Count 9996
Mean 26455227.57

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 333.75
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
3 0.00 summon_pet
4 0.00 trueshot_aura
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 4.00 blood_fury
9 1.00 aspect_of_the_hawk,moving=0
A 0.00 aspect_of_the_fox,moving=1
B 15.00 auto_shot
C 0.00 explosive_trap,if=target.adds>0
D 0.00 a_murder_of_crows,if=enabled&!ticking
E 0.00 blink_strike,if=enabled
F 5.00 lynx_rush,if=enabled&!ticking
G 24.00 glaive_toss,if=enabled
H 0.00 powershot,if=enabled
I 0.00 barrage,if=enabled
J 0.00 multi_shot,if=target.adds>2
K 0.00 cobra_shot,if=target.adds>2
L 1.99 serpent_sting,if=!ticking&target.time_to_die>=10
M 104.66 explosive_shot,if=(remains<2.0)
N 11.19 kill_shot
O 14.55 black_arrow,if=!ticking&target.time_to_die>=8
P 12.60 dire_beast,if=enabled
Q 2.00 stampede
R 3.00 rapid_fire
S 1.00 readiness,wait_for_rapid_fire=1
T 61.24 arcane_shot,if=focus>=67
U 0.00 fervor,if=enabled&focus<=50
V 71.52 cobra_shot

Sample Sequence

89BFGLMOPQRSFGMPVTTTMMMTTTTRTGMMMMOLVVVMTMMMGVPTTBMVVTTMVOGBVMMMMVVTTMMGMMPVVTMOVVTMGMMBMVVTTMFVTTGMPVOVMVTBTMMMG8VVTMVVTMMMOVBGPMVVTTMMMTTVGTMVVOVMVMMMTGPVBMVTTMMMVBVGOVMVFMMMTVVTGMPTVRTTMVOVTTMGVMMMTVVTMBTVBMGMMOPVVMT8VTTMGMMVTTVMMMMOVGVMPMMMVBTVVMGMMFTTOVBMMMVVGNMNPTVTMMMMV7NGNOMQMMBMVVNNMGMMMPTVTNMNOVTGMMBMVNNTTMMMMVGVNM8BNPTTV

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 177 169 80
Agility 22294 19867 18709
Stamina 22486 20442 20290
Intellect 191 182 80
Spirit 195 195 80
Health 461207 432591 0
Focus 100 100 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2551
Spell Crit 14.68% 9.68% 5797
Spell Haste 17.63% 12.03% 5111
Mana Per 5 0 0 0
Attack Power 49223 39894 0
Melee Hit 7.50% 7.50% 2551
Melee Crit 30.83% 23.91% 5797
Melee Haste 12.03% 12.03% 5111
Swing Speed 23.23% 12.03% 5111
Expertise 7.50% 7.50% 2550
Armor 25356 25356 25356
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 16.28% 11.28% 1965

Gear

Average Item Level: 506.80
Head yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
Shirt empty
Chest sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
Waist rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
Legs yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
Feet monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
Wrists stonemaw_armguards,id=87014,enchant=180agi
Hands yaungol_slayers_gloves,id=87003,enchant=170haste
Finger1 painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
Finger2 regails_band_of_the_endless,id=90503,enchant=160agi
Trinket1 relic_of_xuen,id=79328
Trinket2 terror_in_the_mists,id=87167
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
Main Hand taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Posthaste Narrow Escape Crouching Tiger, Hidden Chimera
30 Silencing Shot Wyvern Sting Binding Shot
45 Exhilaration Aspect of the Iron Hawk Spirit Bond
60 Fervor Dire Beast Thrill of the Hunt
75 A Murder of Crows Blink Strike Lynx Rush
90 Glaive Toss Powershot Barrage

Profile

#!./simc

hunter="Hunter_SV_T14H"
origin="unknown"
level=90
race=orc
spec=survival
role=attack
position=ranged_back
professions=jewelcrafting=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Yb!...120

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/hunters_mark,if=target.time_to_die>=21&!debuff.ranged_vulnerability.up
actions.precombat+=/summon_pet
actions.precombat+=/trueshot_aura
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/blood_fury
actions+=/aspect_of_the_hawk,moving=0
actions+=/aspect_of_the_fox,moving=1
actions+=/auto_shot
actions+=/explosive_trap,if=target.adds>0
actions+=/a_murder_of_crows,if=enabled&!ticking
actions+=/blink_strike,if=enabled
actions+=/lynx_rush,if=enabled&!ticking
actions+=/glaive_toss,if=enabled
actions+=/powershot,if=enabled
actions+=/barrage,if=enabled
actions+=/multi_shot,if=target.adds>2
actions+=/cobra_shot,if=target.adds>2
actions+=/serpent_sting,if=!ticking&target.time_to_die>=10
actions+=/explosive_shot,if=(remains<2.0)
actions+=/kill_shot
actions+=/black_arrow,if=!ticking&target.time_to_die>=8
actions+=/dire_beast,if=enabled
actions+=/stampede
actions+=/rapid_fire
actions+=/readiness,wait_for_rapid_fire=1
actions+=/arcane_shot,if=focus>=67
actions+=/fervor,if=enabled&focus<=50
actions+=/cobra_shot

head=yaungol_slayers_headguard,id=87004,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_crit
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=yaungol_slayers_spaulders,id=87006,gems=80agi_160hit_60agi,enchant=200agi_100crit,reforge=haste_crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_hit
chest=sunwrought_mail_hauberk,id=87157,gems=160agi_80agi_160crit_120agi,enchant=80all,reforge=haste_crit
wrists=stonemaw_armguards,id=87014,enchant=180agi
hands=yaungol_slayers_gloves,id=87003,enchant=170haste
waist=rangers_chain_of_unending_summer,id=87182,gems=320agi_320agi,reforge=exp_crit
legs=yaungol_slayers_legguards,id=87005,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_crit
feet=monstrous_stompers,id=86985,gems=160agi,enchant=140agi,reforge=haste_exp
finger1=painful_thorned_ring,id=86974,enchant=160agi,reforge=mastery_hit
finger2=regails_band_of_the_endless,id=90503,enchant=160agi
trinket1=relic_of_xuen,id=79328
trinket2=terror_in_the_mists,id=87167
main_hand=taoren_the_soul_burner,id=87168,gems=500agi,enchant=lord_blastingtons_scope_of_doom,reforge=mastery_crit

# Gear Summary
# gear_strength=80
# gear_agility=18709
# gear_stamina=20290
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2550
# gear_hit_rating=2551
# gear_crit_rating=5797
# gear_haste_rating=5111
# gear_mastery_rating=1965
# gear_armor=25356
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=taoren_the_soul_burner,heroic=1,weapon=gun_3.00speed_10591min_19670max,enchant=lord_blastingtons_scope_of_doom
summon_pet=cat

Mage_Arcane_T14H : 121732 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
121731.9 121731.9 76.52 / 0.06% 6442 / 5.3% 15.9 7505.9 7346.0 Mana 0.01% 41.9 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
Glyphs
  • evocation
  • mana_gem
  • slow
  • mirror_image

Charts

http://1.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:191095|186940|184048|160358|95349&chds=0,382190&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chm=t++191095++mirror_image,69CCF0,0,0,15|t++186940++arcane_barrage,69CCF0,1,0,15|t++184048++nether_tempest,69CCF0,2,0,15|t++160358++arcane_missiles,69CCF0,3,0,15|t++95349++arcane_blast,69CCF0,4,0,15&chtt=Mage_Arcane_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:40,33,15,12,2&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0&chl=arcane_blast|arcane_missiles|nether_tempest|arcane_barrage|mirror_image: arcane_blast&chtt=Mage_Arcane_T14H Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:adgjklmoqrtw024787765320ywvurpmjhfdbZYXXXXWWVVUUTTTTTTTSTSSSSRRSTTUUUUUVVVVVVWWXXWWVVUUUUUVVWWWWWWWWXYZZZaaZZZZZYYYXXXXWVVUTTSSSSSTTTTTTTTTTTUUVVVVWVWWVVVVVVVVVUUTTSTSTTTTSSRRRQQQQRQRRRSSTTTUVXZabdeffghiijjjkjjiihfedbaYXWVVUTSSRRRQQQQQQRRRRSRSSSSSSSSSSSRRRSSSTTSTTTTUUUUVVWWWWWWVVVVWWXXWXXXXWWWWWWWWXXXWWVUUTSSSSSRRRRRRSSSSTTTUVVVVWVVVVVVWWWWVVVVVUVUUTTTTTTTTSSSRRRR&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=121732|max=310522&chxp=1,1,39,100&chtt=Mage_Arcane_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,1,0,5,5,5,11,16,15,21,23,29,37,51,74,88,110,125,136,172,216,260,313,393,443,525,525,579,603,677,658,613,578,524,477,412,314,290,208,154,106,75,44,31,18,13,8,7,6&chds=0,677&chbh=5&chxt=x&chxl=0:|min=104015|avg=121732|max=133690&chxp=0,1,60,100&chtt=Mage_Arcane_T14H DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.7,24.9,9.7,7.8,1.7,1.1,0.0&chds=0,100&chdls=ffffff&chco=69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,69CCF0,ffffff&chl=arcane_blast 181.9s|arcane_missiles 91.3s|nether_tempest 35.3s|arcane_barrage 28.5s|rune_of_power 6.2s|mirror_image 3.9s|waiting 0.0s&chtt=Mage_Arcane_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Arcane_T14H 121732
alter_time_activate 0 0.0% 2.0 194.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 1.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
arcane_barrage 14533 11.9% 23.6 14.02sec 225007 186940 191951 402050 225007 15.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.64 23.64 0.00 0.00 1.2036 0.0000 5319017.16 5319017.16 0.00 186940.47 186940.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.88 84.10% 191951.50 67908 327183 192808.35 122460 222202 3816198 3816198 0.00
crit 3.74 15.81% 402049.63 142453 672329 395814.58 0 671352 1502819 1502819 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_barrage

Static Values
  • id:44425
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1500.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Spelldata
  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:(null)
  • description:Launches bolts of arcane energy at the enemy target, causing $s1 Arcane damage. Consumes all Arcane Charges. Arcane Barrage's damage is increased by $36032s1% per Arcane Charge, and it hits $36032s3 additional nearby $Ltarget:targets; per Arcane Charge for $44425s2% damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.235000
  • base_dd_min:1482.80
  • base_dd_max:1812.31
arcane_blast 47386 38.9% 117.0 3.12sec 148297 95349 126646 265091 148297 15.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.95 116.95 0.00 0.00 1.5553 0.0000 17343418.43 17343418.43 0.00 95348.52 95348.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.47 84.20% 126645.59 41392 280352 126702.33 113273 140739 12471030 12471030 0.00
crit 18.38 15.72% 265091.11 92566 577525 265246.93 183880 358614 4872388 4872388 0.00
miss 0.10 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:30451
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.$?s86209[ Also applies the Slow spell to any target it damages if no target is currently affected by your Slow.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.045000
  • base_dd_min:672.94
  • base_dd_max:782.07
arcane_missiles 39993 32.9% 54.0 6.61sec 271143 160358 0 0 0 0.0% 0.0% 0.0% 0.0% 259.1 48348 101700 56714 15.8% 0.1% 21.1%

Stats details: arcane_missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.98 53.98 259.09 258.10 1.6909 0.2988 14637593.21 14637593.21 0.00 160357.50 160357.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.2 84.15% 48347.74 16568 85838 48337.57 35430 55169 10500649 10500649 0.00
crit 40.7 15.76% 101700.11 34130 176826 101655.34 72744 128539 4136944 4136944 0.00
miss 0.2 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_missiles

Static Values
  • id:5143
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up|buff.arcane_missiles.stack=2
Spelldata
  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:Launches five waves of Arcane Missiles at the enemy over $5143d, causing $7268s1 Arcane damage per wave. Generates an Arcane Charge. Arcane Missiles' damage is increased by $36032s1% per Arcane Charge. Arcane Missiles has a chance to be activated after each of your damaging spell casts. Limit $79683s1 charges.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:5
  • base_tick_time:0.40
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: arcane_missiles_tick

Static Values
  • id:7268
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:(null)
  • description:$@spelldesc5143
Direct Damage
  • may_crit:true
  • direct_power_mod:0.295000
  • base_dd_min:392.37
  • base_dd_max:392.37
arcane_power 0 0.0% 4.0 93.36sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_power

Static Values
  • id:12042
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
berserking 0 0.0% 2.0 187.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<18
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
mirror_image 0 (2056) 0.0% (1.7%) 3.0 181.38sec 250911 191095 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.3130 0.0000 0.00 0.00 0.00 191095.22 191095.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 17763 14.6% 28.7 12.96sec 226473 184048 0 0 0 0.0% 0.1% 0.0% 0.0% 437.1 12707 26534 14873 15.7% 0.0% 91.2%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.71 28.71 437.12 437.12 1.2305 0.7638 6501321.54 6501321.54 0.00 17609.21 184048.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.68 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 368.6 84.33% 12706.82 7273 20397 12706.46 11650 13431 4684108 4684108 0.00
crit 68.5 15.67% 26533.59 14983 42019 26531.48 23575 29108 1817214 1817214 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 4.5 91.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.50 4.50 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
rune_of_power 0 0.0% 6.0 63.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 1.0412 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:(null)
  • description:Places a Rune of Power on the ground, which lasts for $116011d. While standing in your own Rune of Power, your mana regeneration is increased by $116014s1% and your spell damage is increased by $116014s2%. Only $116011s1 Runes of Power can be placed at one time.$?s56380[ While standing in your own Rune of Power, you gain 1% of your maximum health per second.][] Replaces Evocation.
pet - mirror_image 11850 / 2056
arcane_blast 11850 1.7% 112.7 3.30sec 6677 4102 5693 11618 6677 16.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: arcane_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.71 112.71 0.00 0.00 1.6277 0.0000 752532.98 752532.98 0.00 4101.98 4101.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.80 83.22% 5693.44 2517 7286 5692.82 5322 6072 534052 534052 0.00
crit 18.81 16.68% 11617.94 5033 14571 11618.11 8505 13879 218481 218481 0.00
miss 0.10 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: arcane_blast

Static Values
  • id:88084
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88084
  • name:Arcane Blast
  • school:arcane
  • tooltip:(null)
  • description:Blasts the target with energy, dealing $30451s1 Arcane damage. Generates an Arcane Charge. Arcane Blast's damage is increased by $36032s1% per Arcane Charge, and its mana cost is increased by $36032s2% per Arcane Charge.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:866.45
  • base_dd_max:1006.95

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.0 0.0 194.3sec 194.3sec 3.25% 3.25%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.2%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_charge 24.6 148.3 14.0sec 2.1sec 82.69% 96.11%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:13.9%
  • arcane_charge_2:10.6%
  • arcane_charge_3:10.4%
  • arcane_charge_4:8.0%
  • arcane_charge_5:8.3%
  • arcane_charge_6:31.5%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
arcane_missiles 29.1 23.7 12.6sec 6.8sec 50.77% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_missiles
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_missiles_1:48.1%
  • arcane_missiles_2:2.7%

Spelldata details

  • id:79683
  • name:Arcane Missiles!
  • tooltip:Arcane Missiles activated.
  • description:Your offensive spells have a chance to activate Arcane Missiles. This effect can accumulate up to $79683s1 charges and lasts $79683d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
arcane_power 4.3 1.6 84.0sec 56.5sec 19.44% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_power_1:19.4%

Spelldata details

  • id:12042
  • name:Arcane Power
  • tooltip:$?$w2=10[Increased damage and mana cost for your damaging spells.][Increased damage and reduced mana cost for your damaging spells.]
  • description:When activated, you deal $s1% more spell damage and damaging spells cost $s2% $?p99064[less][more] mana to cast. $?s56381[While Arcane Power is active, the global cooldown of your Blink, Mana Shield, and Mirror Image is reduced to zero. ][]This effect lasts $D.
  • max_stacks:
  • duration:15.00
  • cooldown:90.00
  • default_chance:0.00%
berserking 2.7 1.0 110.7sec 72.5sec 7.76% 12.94%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:7.8%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 12.0sec 12.49% 17.20%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:12.5%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 6.1 1.4 62.7sec 49.0sec 35.18% 35.18%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.2%
jade_serpent_potion 2.2 0.8 82.6sec 77.4sec 13.81% 13.81%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:13.8%
jade_spirit 7.3 0.5 51.8sec 48.3sec 23.88% 24.32%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.9%
lightweave_embroidery_3 6.3 0.9 62.8sec 53.6sec 26.33% 26.33%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.3%
mage_armor 1.0 2.0 0.0sec 194.3sec 100.00% 100.00%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_mage_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:3000.20

    Stack Uptimes

    • mage_armor_1:100.0%

Spelldata details

  • id:6117
  • name:Mage Armor
  • tooltip:Mastery increased by $6117w1. Duration of all harmful Magic effects reduced by $w2%.
  • description:Increases your Mastery by $6117s1. The duration of all harmful Magic effects used against you is reduced by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
presence_of_mind 4.5 0.0 91.3sec 91.3sec 1.10% 1.72%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.1%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
relic_of_yulon 7.3 0.7 50.7sec 45.7sec 30.12% 30.12%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.1%
rune_of_power 6.0 2.0 64.6sec 50.7sec 96.99% 96.95%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rune_of_power_1:97.0%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Mana regeneration increased by $w1%. Spell damage increased by $w2%.$?$w3=0[][ Health restored by $w3% per second.]
  • description:$@spelldesc116011
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Mage_Arcane_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
mirror_image-arcane_charge 3.0 34.6 181.2sec 9.8sec 89.86% 92.10%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.5%
  • arcane_charge_2:1.2%
  • arcane_charge_3:1.0%
  • arcane_charge_4:0.9%
  • arcane_charge_5:0.9%
  • arcane_charge_6:10.1%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 34.6 181.2sec 9.8sec 89.86% 92.10%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.5%
  • arcane_charge_2:1.2%
  • arcane_charge_3:1.0%
  • arcane_charge_4:0.9%
  • arcane_charge_5:0.9%
  • arcane_charge_6:10.1%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
mirror_image-arcane_charge 3.0 34.6 181.2sec 9.8sec 89.86% 92.10%

Buff details

  • buff initial source:Mage_Arcane_T14H_mirror_image
  • cooldown name:buff_arcane_charge
  • max_stacks:6
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • arcane_charge_1:1.5%
  • arcane_charge_2:1.2%
  • arcane_charge_3:1.0%
  • arcane_charge_4:0.9%
  • arcane_charge_5:0.9%
  • arcane_charge_6:10.1%

Spelldata details

  • id:114664
  • name:Arcane Charge
  • tooltip:(null)
  • description:An arcane charge, generated by Arcane Blast, Arcane Missiles, and Arcane Explosion, and consumed by Arcane Barrage: $@spellicon30451 $@spellname30451 Generates a charge. Arcane Blast's damage is increased by $36032s1% per charge, and its mana cost increased by $36032s2% per charge. $@spellicon5143 $@spellname5143 Generates a charge. Arcane Missiles' damage is increased by $36032s1% per charge. $@spellicon1449 $@spellname1449 Refreshes charges and has a $1449s2% chance to generate a charge if at least one target is hit. $@spellicon44425 $@spellname44425 Consumes all charges. Arcane Barrage's damage is increased by $36032s1% per charge, and it hits $36032s3 additional nearby $Ltarget:targets; per charge for $44425s2% damage. Stacks up to $36032u times and lasts $36032d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Arcane_T14H
alter_time_activate Mana 2.0 6541.6 3300.0 3300.0 0.0
arcane_barrage Mana 23.6 36291.6 1535.2 1535.2 146.6
arcane_blast Mana 117.0 2554148.0 21839.6 21839.6 6.8
mirror_image Mana 3.0 17995.2 6000.0 6000.0 41.8
nether_tempest Mana 28.7 131644.0 4585.8 4585.8 49.4
time_warp Mana 0.0 555.8 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 1293177.49 883.92 147244.14 10.22%
mana_gem Mana 2.88 162072.46 56307.39 32971.12 16.90%
rune_of_power Mana 1418.35 1233368.91 869.58 165483.02 11.83%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 7345.95 7505.92
Combat End Resource Mean Min Max
Health -6212831.96 -6308012.00 -5993172.00
Mana 187960.88 144.64 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
arcane_charge_0 12.3%
arcane_charge_1 11.9%
arcane_charge_2 11.3%
arcane_charge_3 10.6%
arcane_charge_4 10.4%
arcane_charge_5 9.1%
arcane_charge_6 34.4%
dps_rotation 100.0%
water_elemental-arcane_charge_0 12.3%
water_elemental-arcane_charge_1 11.9%
water_elemental-arcane_charge_2 11.3%
water_elemental-arcane_charge_3 10.6%
water_elemental-arcane_charge_4 10.4%
water_elemental-arcane_charge_5 9.1%
water_elemental-arcane_charge_6 34.4%
water_elemental-dps_rotation 100.0%
Uptimes %
Mana Cap 10.7%
water_elemental-Mana Cap 10.7%
mirror_image-Mana Cap 10.7%

Procs

Count Interval
hat_donor 68.5 5.2sec
mana_gem 2.9 154.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 121731.92
Minimum 104014.58
Maximum 133689.77
Spread ( max - min ) 29675.19
Range [ ( max - min ) / 2 * 100% ] 12.19%
Standard Deviation 3903.2016
5th Percentile 114725.98
95th Percentile 127610.84
( 95th Percentile - 5th Percentile ) 12884.86
Mean Distribution
Standard Deviation 39.0398
95.00% Confidence Intervall ( 121655.40 - 121808.44 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3949
0.1 Scale Factor Error with Delta=300 130054
0.05 Scale Factor Error with Delta=300 520218
0.01 Scale Factor Error with Delta=300 13005457
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 121731.92

Damage

Sample Data
Count 9996
Mean 43801350.34

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 255.63
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 mage_armor
4 0.00 snapshot_stats
5 0.00 rune_of_power
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.05 time_warp,if=target.health.pct<25|time>5
A 0.00 arcane_power,if=target.time_to_die<18
B 0.00 berserking,if=target.time_to_die<18
C 1.98 alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
D 0.00 arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
E 28.34 arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
F 5.00 rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
G 1.00 jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
H 2.88 mana_gem,if=mana.pct<84&buff.alter_time.down
I 3.00 mirror_image
J 4.00 arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
K 2.00 berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
L 4.50 presence_of_mind,if=buff.alter_time.down
M 28.71 nether_tempest,if=!ticking
N 98.14 arcane_blast,if=mana.pct>92
O 25.64 arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
P 13.69 arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
Q 9.95 arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
R 26.76 arcane_blast
S 0.00 arcane_barrage,moving=1
T 0.00 fire_blast,moving=1
U 0.00 ice_lance,moving=1

Sample Sequence

ILMNNJNKNCEENQREEMENENHNOQNNNMNNPONNNNOMNPEONNPNEMNNNONPFMNNNNONPOMNNNPNNNELMNJGNENOQNMNNENENMONPRFPNNEMNNENEONMOQNNNNQMENNNONMENOINREHLMNFJKRRRCEEQRMEOQRRRRQRMEOPRRNMNNNENOMNPRRENNMENEOFNPRMNNNNNOMNLOPNNNJNMNENONQOMRNRQRNNMNNQFNNNNEMNONRHNOMNRORRRMRROIRR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 21602 19208 18083
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 32448 27105 7907
Spell Hit 14.91% 14.91% 5070
Spell Crit 17.57% 11.62% 1879
Spell Haste 17.31% 11.72% 4983
Mana Per 5 17597 16759 0
Attack Power 117 100 0
Melee Hit 14.91% 14.91% 5070
Melee Crit 11.76% 6.75% 1879
Melee Haste 11.72% 11.72% 4983
Swing Speed 22.90% 11.72% 4983
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 58.98% 38.98% 6892

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=crit_hit
Neck amulet_of_seven_curses,id=87028,reforge=crit_mastery
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit
Shirt empty
Chest robes_of_the_unknown_fear,id=87169,gems=160int_320mastery_120int,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=320mastery_80int_160hit_160int_120haste,reforge=hit_mastery
Legs leggings_of_the_burning_scroll,id=87009,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=320mastery_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
Hands gloves_of_the_burning_scroll,id=87007,enchant=170haste
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Arcane_T14H"
origin="unknown"
level=90
race=troll
spec=arcane
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ea!000001
glyphs=evocation/mana_gem/slow/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/mage_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/rune_of_power
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/arcane_power,if=target.time_to_die<18
actions+=/berserking,if=target.time_to_die<18
actions+=/alter_time,if=buff.alter_time.down&buff.arcane_power.up&buff.arcane_missiles.stack=2&buff.arcane_charge.stack>3&buff.rune_of_power.remains>6
actions+=/arcane_blast,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/arcane_missiles,if=buff.alter_time.up|buff.arcane_missiles.stack=2
actions+=/rune_of_power,if=buff.rune_of_power.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.arcane_power.up|target.time_to_die<=50
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/mirror_image
actions+=/arcane_power,if=buff.rune_of_power.remains>15&buff.alter_time.down&buff.arcane_charge.stack>1
actions+=/berserking,if=buff.rune_of_power.remains>10&buff.alter_time.down&buff.arcane_charge.stack>2
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/arcane_blast,if=mana.pct>92
actions+=/arcane_missiles,if=buff.arcane_missiles.react&(cooldown.alter_time_activate.remains>4|target.time_to_die<10)
actions+=/arcane_barrage,if=buff.arcane_charge.up&buff.arcane_power.down&buff.alter_time.down&target.time_to_die>25&(cooldown.mana_gem.remains>10|mana_gem_charges=0)
actions+=/arcane_barrage,if=buff.arcane_charge.stack>=4&buff.arcane_missiles.down&target.time_to_die>25
actions+=/arcane_blast
actions+=/arcane_barrage,moving=1
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=crit_hit
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3
chest=robes_of_the_unknown_fear,id=87169,gems=160int_320mastery_120int,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=320mastery_80int_160hit_160int_120haste,reforge=hit_mastery
legs=leggings_of_the_burning_scroll,id=87009,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=320mastery_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18083
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5070
# gear_crit_rating=1879
# gear_haste_rating=4983
# gear_mastery_rating=6892
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Fire_T14H : 127219 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
127219.3 127219.3 106.52 / 0.08% 9004 / 7.1% 22.6 5524.2 4952.3 Mana 0.00% 40.4 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
Glyphs
  • evocation
  • fire_blast
  • counterspell
  • mirror_image

Charts

http://6.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:331871|297518|136842|65816|52814&chds=0,663743&chco=69CCF0,C41F3B,69CCF0,C41F3B,C41F3B&chm=t++331871++mirror_image,69CCF0,0,0,15|t++297518++pyroblast,C41F3B,1,0,15|t++136842++nether_tempest,69CCF0,2,0,15|t++65816++fireball,C41F3B,3,0,15|t++52814++inferno_blast,C41F3B,4,0,15&chtt=Mage_Fire_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:31,29,15,13,10,3,2&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,C41F3B,C41F3B,69CCF0,C41F3B,C41F3B&chl=pyroblast|fireball|combustion|ignite|nether_tempest|inferno_blast|mirror_image: fireball&chtt=Mage_Fire_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:RUXaegjlnoqtwy13468776521yxusqolkigedcbaaaaZZYZYYXXWWWWWWWWWVVVVVVVVVWWXXXXYYZZZaaaabbbaZZYYXXWWVVUTTSSRRRQQQRRSSTTUVVWWXXXXXXYYYYYYYXWVUUTSSSRRRRRRRSSSSTUVWWXXYYYYYYYYYYYXXWWWVUTSRQQQQQQQRRSTUVWXYZabcdeffggggggfeedccbaZZYXXXWWWVVUUTTSSSSSSSSSSSSSSRRRSSSTTTUUVVVWWWXXYYZaabbbbbbaaaZZZZYYXXWVVUUTTTUTUUUUVVVVVVVVVWWWWWXWVVVUUUUUUUVVVVVVVVVWXYZZaaabbbbbaaZZZZZYYYYXXWV&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=127219|max=310485&chxp=1,1,41,100&chtt=Mage_Fire_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,2,3,0,5,2,10,13,9,23,42,60,78,106,126,163,203,242,288,361,391,460,509,551,586,590,600,588,576,557,494,411,374,345,262,225,193,144,118,71,61,60,32,27,17,6,7,3,0,1&chds=0,600&chbh=5&chxt=x&chxl=0:|min=105893|avg=127219|max=146486&chxp=0,1,53,100&chtt=Mage_Fire_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:55.7,12.9,9.4,8.8,7.0,0.7&chds=0,100&chdls=ffffff&chco=C41F3B,C41F3B,69CCF0,69CCF0,C41F3B,69CCF0&chl=fireball 204.0s|pyroblast 47.2s|evocation 34.4s|nether_tempest 32.3s|inferno_blast 25.6s|mirror_image 2.6s&chtt=Mage_Fire_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Fire_T14H 127219
alter_time_activate 0 0.0% 2.0 187.45sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
berserking 0 0.0% 2.0 187.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
combustion 18158 14.3% 9.9 37.67sec 670682 0 46733 97055 61292 29.0% 0.0% 0.0% 0.0% 135.1 33819 70738 44686 29.4% 0.0% 27.1%

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.91 9.91 135.13 135.13 0.0000 0.7352 6645826.33 6645826.33 0.00 66895.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.04 71.02% 46732.69 34298 60186 46716.55 39111 53975 328887 328887 0.00
crit 2.87 28.95% 97055.11 70654 123983 93644.11 0 123983 278456 278456 0.00
miss 0.00 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.4 70.57% 33819.35 0 84316 33820.87 25625 44584 3224917 3224917 0.00
crit 39.8 29.43% 70738.30 0 173692 70782.83 50374 101197 2813567 2813567 0.00
DPS Timeline Chart

Action details: combustion

Static Values
  • id:11129
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:36.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die<12
Spelldata
  • id:11129
  • name:Combustion
  • school:fire
  • tooltip:(null)
  • description:Instantly deals $s2 Fire damage and stuns the target for $118271d. Burns the target for additional damage over $83853d based on the Pyroblast and Ignite effects already on the target. When cast, resets the cooldown of your Inferno Blast ability.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:952.31
  • base_dd_max:1129.24
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:16851.59
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
evocation 0 0.0% 8.0 46.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 29.8 0 0 0 28.6% 0.0% 8.9%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 29.78 29.78 4.3055 1.0980 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.3 71.43% 0.00 0 0 0.00 0 0 0 0 0.00
crit 8.5 28.57% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
fireball 36688 28.8% 118.4 3.05sec 113381 65816 77158 160420 113585 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.43 118.22 0.00 0.00 1.7227 0.0000 13427696.41 13427696.41 0.00 65816.23 65816.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.44 56.20% 77157.94 56592 99306 77157.24 73228 80829 5126179 5126179 0.00
crit 51.75 43.77% 160419.52 116579 204571 160426.25 153452 168644 8301518 8301518 0.00
miss 0.03 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
ignite 15876 12.5% 178.2 2.02sec 32610 0 0 0 0 0.0% 0.0% 0.0% 0.0% 173.2 33558 0 33558 0.0% 0.0% 94.6%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 178.19 178.19 173.15 173.15 0.0000 2.0000 5810573.98 5810573.98 0.00 16778.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.2 100.00% 33557.79 0 151967 33558.28 27427 40673 5810574 5810574 0.00
DPS Timeline Chart

Action details: ignite

Static Values
  • id:12654
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12654
  • name:Ignite
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:$@spelldesc12846
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:33505.92
  • num_ticks:2
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
inferno_blast 3696 2.9% 21.1 17.10sec 64178 52814 0 64199 64178 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inferno_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.08 21.08 0.00 0.00 1.2152 0.0000 1352607.96 1352607.96 0.00 52813.56 52813.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 21.07 99.97% 64198.57 52989 81827 64216.24 60661 69092 1352608 1352608 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inferno_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.react&buff.pyroblast.down
Spelldata
  • id:108853
  • name:Inferno Blast
  • school:fire
  • tooltip:(null)
  • description:Blasts the enemy for $s1 Fire damage, and is guaranteed to critical strike. Upon impact, it spreads any $?s89926&s44457[Living Bomb, ][]Pyroblast, Ignite, and Combustion effects to up to 2 nearby enemy targets within $118280A1 yards. $?s89926&s114923[Also causes your Nether Tempest effect to instantly fire its secondary damage at all nearby enemy targets within $114924A2 yards. ][]$?s89926&s112948[Also instantly triggers your Frost Bomb effect. ][]Replaces Fire Blast.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.600000
  • base_dd_min:571.39
  • base_dd_max:677.55
mirror_image 0 (2371) 0.0% (1.9%) 3.0 181.68sec 292037 331871 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 2.97 0.00 0.00 0.8800 0.0000 0.00 0.00 0.00 331871.43 331871.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
nether_tempest 12084 9.5% 26.6 13.89sec 166288 136842 0 0 0 0.0% 0.0% 0.0% 0.0% 409.6 8225 17051 10798 29.2% 0.0% 84.5%

Stats details: nether_tempest

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.60 26.60 409.56 409.56 1.2152 0.7551 4422606.83 4422606.83 0.00 12947.58 136842.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.59 99.97% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 290.1 70.84% 8224.87 7527 10539 8225.02 8038 8451 2386416 2386416 0.00
crit 119.4 29.16% 17051.39 15505 21711 17051.73 16434 17688 2036191 2036191 0.00
DPS Timeline Chart

Action details: nether_tempest

Static Values
  • id:114923
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:114923
  • name:Nether Tempest
  • school:arcane
  • tooltip:Deals $114923s1 Arcane damage every $114923t sec. Deals $114954s1 Arcane damage to a random target within $114924A2 yards every $114923t sec.
  • description:Places a Nether Tempest on the target which deals $114923o1 Arcane damage over $114923d. Each time Nether Tempest deals damage, an additional 50% of that damage is also dealt to a random target within $114924A2 yards.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.174000
  • base_td:232.09
  • num_ticks:12
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP
presence_of_mind 0 0.0% 4.0 93.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.01 4.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pyroblast 38347 30.1% 39.1 9.07sec 358685 297518 151685 315730 223413 43.7% 0.0% 0.0% 0.0% 145.4 24790 51587 36531 43.8% 0.0% 89.6%

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.13 39.04 145.43 145.43 1.2056 2.2551 14035106.65 14035106.65 0.00 37413.48 297517.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.95 56.23% 151685.34 101866 196627 151680.35 140105 164148 3329794 3329794 0.00
crit 17.08 43.75% 315730.27 209843 405052 315841.40 276983 360281 5392525 5392525 0.00
miss 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.7 56.18% 24789.79 16669 32176 24789.59 23062 26378 2025529 2025529 0.00
crit 63.7 43.82% 51587.35 34339 66282 51584.84 48190 55430 3287259 3287259 0.00
DPS Timeline Chart

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:0.00
  • base_execute_time:3.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:$w2 Fire damage every $t2 seconds.
  • description:Hurls an immense fiery boulder that causes $s1 Fire damage and an additional $o2 Fire damage over $d. Getting two single-target direct-damage Fire critical strikes in a row will make your next Pyroblast instant cast, cost no mana, and deal $s3% additional damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.200000
  • base_dd_min:2017.24
  • base_dd_max:2562.19
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.360000
  • base_td:374.68
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
pet - mirror_image 13842 / 2371
fireball 13842 1.9% 111.4 3.00sec 7793 4804 6083 12279 7952 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.36 109.13 0.00 0.00 1.6223 0.0000 867843.80 867843.80 0.00 4803.79 4803.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.16 69.78% 6083.33 4988 6868 6083.30 5810 6288 463285 463285 0.00
crit 32.95 30.19% 12278.67 9977 13737 12279.49 11346 13121 404559 404559 0.00
miss 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fireball

Static Values
  • id:88082
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:88082
  • name:Fireball
  • school:fire
  • tooltip:(null)
  • description:Hurls a fiery ball that causes $s1 Fire damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.812000
  • base_dd_min:1657.70
  • base_dd_max:2114.08

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.0 0.0 187.3sec 187.3sec 3.28% 3.28%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.3%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
berserking 3.2 0.5 87.0sec 73.2sec 7.40% 14.41%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:7.4%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 11.2sec 12.57% 19.29%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:12.6%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 6.1 1.3 62.2sec 49.2sec 35.02% 35.02%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:35.0%
heating_up 56.9 0.1 6.3sec 6.3sec 24.79% 39.04%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • heating_up_1:24.8%
  • heating_up_2:0.0%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
invocation 8.0 2.0 46.8sec 36.4sec 89.35% 92.72%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:89.3%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.1 0.9 303.1sec 312.8sec 13.88% 13.88%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:13.9%
jade_spirit 7.2 0.6 52.4sec 47.8sec 24.08% 25.58%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:24.1%
lightweave_embroidery_3 6.1 1.0 64.5sec 53.6sec 26.38% 26.38%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:26.4%
molten_armor 1.0 2.0 0.0sec 187.3sec 100.00% 99.71%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_armor_1:100.0%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by $s1%. Reduces all physical damage taken by $s2%. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
presence_of_mind 4.1 0.0 92.7sec 92.7sec 0.42% 1.24%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:0.4%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
pyroblast 37.0 1.2 9.7sec 9.4sec 16.47% 94.30%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyroblast
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • pyroblast_1:16.5%

Spelldata details

  • id:48108
  • name:Pyroblast!
  • tooltip:Your next Pyroblast spell is instant cast, costs no mana, and deals $11366s3% additional damage.
  • description:Getting two direct-damage critical strikes in a row will make your next Pyroblast spell instant cast, cost no mana, and deal $11366s3% additional damage.
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
relic_of_yulon 7.3 0.9 51.4sec 45.1sec 30.29% 30.29%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:30.3%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Fire_T14H
alter_time_activate Mana 2.0 6000.0 3000.0 3000.0 0.0
combustion Mana 9.9 297271.9 30000.0 30000.0 22.4
fireball Mana 118.4 1421156.1 12000.0 12000.0 9.4
inferno_blast Mana 21.1 126454.4 6000.0 6000.0 10.7
mirror_image Mana 3.0 17830.1 6000.0 6000.0 48.7
nether_tempest Mana 26.6 119682.2 4500.0 4500.0 37.0
pyroblast Mana 39.1 33460.4 855.1 855.1 419.5
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 682069.37 466.21 39921.81 5.53%
evocation Mana 29.78 967221.54 32481.50 700720.62 42.01%
mana_gem Mana 3.00 163240.54 54413.51 36941.84 18.45%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 4952.27 5524.19
Combat End Resource Mean Min Max
Health -6218082.12 -6263157.00 -6173447.00
Mana 176063.79 125494.33 246067.05
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.9%
dpm_rotation 99.1%
water_elemental-dps_rotation 0.9%
water_elemental-dpm_rotation 99.1%
mirror_image-dps_rotation 0.9%
mirror_image-dpm_rotation 99.1%
Uptimes %
Mana Cap 5.6%
water_elemental-Mana Cap 5.6%
mirror_image-Mana Cap 5.6%

Procs

Count Interval
hat_donor 222.9 1.6sec
mana_gem 3.0 125.8sec
test_for_crit_hotstreak 188.2 1.9sec
crit_test_hotstreak 92.8 3.8sec
hotstreak 36.2 9.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 127219.29
Minimum 105892.61
Maximum 146485.67
Spread ( max - min ) 40593.06
Range [ ( max - min ) / 2 * 100% ] 15.95%
Standard Deviation 5433.7920
5th Percentile 118183.97
95th Percentile 136192.02
( 95th Percentile - 5th Percentile ) 18008.05
Mean Distribution
Standard Deviation 54.3488
95.00% Confidence Intervall ( 127112.77 - 127325.82 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 70
0.1% Error 7008
0.1 Scale Factor Error with Delta=300 252051
0.05 Scale Factor Error with Delta=300 1008206
0.01 Scale Factor Error with Delta=300 25205173
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 127219.29

Damage

Sample Data
Count 9996
Mean 45694418.16

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 246.61
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 molten_armor
4 0.00 snapshot_stats
5 0.00 evocation
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 counterspell,if=target.debuff.casting.react
8 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
9 0.00 time_warp,if=target.health.pct<25|time>5
A 2.00 berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
B 0.29 combustion,if=target.time_to_die<12
C 9.62 combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
D 0.00 combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
E 7.00 evocation,if=buff.invocation.down&buff.alter_time.down
F 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
G 0.00 berserking,if=target.time_to_die<18
H 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
I 2.00 alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
J 0.00 evocation,if=mana.pct<10&target.time_to_die>=30
K 36.69 pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
L 2.44 pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
M 21.08 inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
N 2.97 mirror_image
O 4.01 presence_of_mind,if=buff.alter_time.down
P 26.60 nether_tempest,if=!ticking
Q 127.92 fireball
R 0.00 inferno_blast,moving=1
S 0.00 ice_lance,moving=1

Sample Sequence

NAOPQQQQQMHIKQCQQPQKQQQQMKQQPQKQQQQQQPQQQMKQCEMKPQQQKQQPMKQQQQQPQQQCQQKQEKOLPQQQQQQKPMKQQCQQQPQHQQQKQEKPQQQQQQKPCQQQQQMKPQQQMKNEAPOQQQQQCQQQPQMIKQQQQKPKQMKQQQPQQQCQEMKPQQQKQKQPQHMKQQQQKPCQKQMKQOLEPQQMKQQQMKPQQQCQQQPQQQQQEFMKPQQKQKQQPCQKQQMKQPQKQMK

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 126 120 80
Agility 137 130 80
Stamina 22275 20250 20183
Intellect 20852 18494 17403
Spirit 558 558 350
Health 458253 429903 0
Mana 300000 300000 0
Spell Power 31623 26391 7907
Spell Hit 14.97% 14.97% 5091
Spell Crit 31.05% 20.12% 7144
Spell Haste 17.82% 12.21% 5190
Mana Per 5 8837 8416 0
Attack Power 117 100 0
Melee Hit 14.97% 14.97% 5091
Melee Crit 20.53% 15.52% 7144
Melee Haste 12.21% 12.21% 5190
Swing Speed 23.43% 12.21% 5190
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 24.95% 17.45% 2175

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
Neck worldwaker_cachabon,id=87076
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Chest robes_of_the_burning_scroll,id=87010,gems=320crit_320crit_180haste,enchant=80all,reforge=haste_hit
Waist belt_of_malleable_amber,id=86981,gems=320crit_160crit_160hit_120haste,reforge=haste_crit
Legs dreadwoven_leggings_of_failure,id=87174,gems=80int_160crit_80int_160hit_120int,enchant=285int_165crit,reforge=haste_crit
Feet sandals_of_the_blackest_night,id=87162,gems=320crit_60mastery,enchant=175hit,reforge=haste_hit
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_crit
Hands gloves_of_the_burning_scroll,id=87007,enchant=170mastery,reforge=hit_crit
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=haste_crit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Fire_T14H"
origin="unknown"
level=90
race=troll
spec=fire
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eZ!011100
glyphs=evocation/fire_blast/counterspell/mirror_image

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/molten_armor
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/berserking,if=buff.invocation.remains>10&buff.alter_time.down&mana.pct>28
actions+=/combustion,if=target.time_to_die<12
actions+=/combustion,if=set_bonus.tier14_4pc_caster&dot.ignite.ticking&dot.pyroblast.ticking
actions+=/combustion,if=!set_bonus.tier14_4pc_caster&dot.ignite.tick_dmg>=12000&dot.pyroblast.ticking
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/berserking,if=target.time_to_die<18
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/alter_time,if=buff.alter_time.down&buff.pyroblast.react&buff.invocation.remains>6
actions+=/evocation,if=mana.pct<10&target.time_to_die>=30
actions+=/pyroblast,if=buff.pyroblast.react&(cooldown.alter_time_activate.remains>4|buff.heating_up.react)
actions+=/pyroblast,if=buff.presence_of_mind.up&cooldown.alter_time_activate.remains>4
actions+=/inferno_blast,if=buff.heating_up.react&buff.pyroblast.down
actions+=/mirror_image
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/nether_tempest,if=!ticking
actions+=/fireball
actions+=/inferno_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=haste_crit
chest=robes_of_the_burning_scroll,id=87010,gems=320crit_320crit_180haste,enchant=80all,reforge=haste_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_crit
hands=gloves_of_the_burning_scroll,id=87007,enchant=170mastery,reforge=hit_crit
waist=belt_of_malleable_amber,id=86981,gems=320crit_160crit_160hit_120haste,reforge=haste_crit
legs=dreadwoven_leggings_of_failure,id=87174,gems=80int_160crit_80int_160hit_120int,enchant=285int_165crit,reforge=haste_crit
feet=sandals_of_the_blackest_night,id=87162,gems=320crit_60mastery,enchant=175hit,reforge=haste_hit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=17403
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5091
# gear_crit_rating=7144
# gear_haste_rating=5190
# gear_mastery_rating=2175
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Mage_Frost_T14H : 121126 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
121125.7 121125.7 49.05 / 0.04% 4090 / 3.4% 19.6 5013.3 4675.0 Mana 0.00% 48.5 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
Glyphs
  • evocation
  • icy_veins
  • ice_lance

Charts

http://0.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:364076|255849|183360|182371|123769|66640&chds=0,728151&chco=69CCF0,0070DE,0070DE,0070DE,0070DE,0070DE&chm=t++364076++mirror_image,69CCF0,0,0,15|t++255849++frozen_orb,0070DE,1,0,15|t++183360++frostfire_bolt,0070DE,2,0,15|t++182371++ice_lance,0070DE,3,0,15|t++123769++frost_bomb,0070DE,4,0,15|t++66640++frostbolt,0070DE,5,0,15&chtt=Mage_Frost_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,19,16,16,15,7,7,7,5,5,2,0,0&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,0070DE,C41F3B,0070DE&chl=frostbolt|ice_lance|water_elemental: waterbolt|frostfire_bolt|frost_bomb|mini_ice_lance|mini_frostbolt|mini_frostfire_bolt|frozen_orb|water_elemental: mini_waterbolt|mirror_image: frostbolt|mirror_image: fire_blast|water_elemental: freeze&chtt=Mage_Frost_T14H Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:QTVZchjiklmqux023576686631xwwtsqoljhgedbbZWVUTUTTSRSRRQQQRSTTVWXYZZZaabcccdddedddcaYYYXWVUTSSSSTTUUUUUVWXYYYabbbbcbcbcbaaaabbbbbcbaaZZYYXXWVWWWWWVUUTTUVWWXXXXXXXXWWVVUUUUUUUTTSSRRQQPOQQSTUVWXXYYZabcefgijkkkjjiihhhggfedcbaYXXWWVUTSRQQPPPPPQRRRSTSTTUVWXYYZZaaaaaaaaZZZZZYYXXWWVUUUTTTTTUVVVWWWWXXYZZabbbbbbbbaaZZZZZZZZZYXXWWVVVVUUUUUUUTTSRRSSTUUVVVVVVVVVVUUUVVWVVVVVVVU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=121126|max=287951&chxp=1,1,42,100&chtt=Mage_Frost_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,1,1,0,5,3,5,18,6,18,32,41,55,82,98,179,227,227,314,363,456,539,612,689,706,685,700,644,640,597,498,385,312,242,206,144,85,65,45,20,19,16,4,9,1,0,0,1&chds=0,706&chbh=5&chxt=x&chxl=0:|min=109132|avg=121126|max=131050&chxp=0,1,55,100&chtt=Mage_Frost_T14H DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.7,14.4,12.1,12.0,9.1,2.0,0.6&chds=0,100&chdls=ffffff&chco=0070DE,0070DE,0070DE,0070DE,69CCF0,0070DE,69CCF0&chl=frostbolt 163.5s|ice_lance 52.7s|frostfire_bolt 44.3s|frost_bomb 43.8s|evocation 33.4s|frozen_orb 7.2s|mirror_image 2.2s&chtt=Mage_Frost_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Mage_Frost_T14H 121126
alter_time_activate 0 0.0% 2.0 184.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: alter_time_activate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: alter_time_activate

Static Values
  • id:108978
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
Spelldata
  • id:108978
  • name:Alter Time
  • school:arcane
  • tooltip:(null)
  • description:Alter the fabric of time, causing the caster to return to their current location, health, mana, buffs, and debuffs, when cast a second time, or after $110909d. Effect negated if the caster dies within the $110909d before the effect occurs or moves too far away.
blood_fury 0 0.0% 3.0 132.04sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<12
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cold_snap 0 0.0% 2.0 181.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cold_snap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cold_snap

Static Values
  • id:11958
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:health.pct<30
Spelldata
  • id:11958
  • name:Cold Snap
  • school:physical
  • tooltip:(null)
  • description:When activated, this spell finishes the cooldown of your Ice Block, Frost Nova, and Cone of Cold spells. Instantly restores $s2% of your health. This spell is usable while stunned, frozen, incapacitated, feared or asleep, and is not on the global cooldown.
evocation 0 0.0% 8.0 46.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 30.7 0 0 0 18.4% 0.0% 8.7%

Stats details: evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 8.00 30.73 30.73 4.1805 1.0312 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 8.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.1 81.59% 0.00 0 0 0.00 0 0 0 0 0.00
crit 5.7 18.41% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: evocation

Static Values
  • id:12051
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Gain $w1% of total mana $?$w2=0[][and $w2% of total health ]every $t1 sec.
  • description:Gain $m1% of your total mana $?s56380&!s114003[and $m2% of your total health ][]instantly and another ${3*$m1}% of your total mana $?s56380&!s114003[and ${3*$m2}% of your total health ][]over $d$?s56380&s114003[, and $125440m1% of your total health upon completion][].
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
frost_bomb 14805 12.2% 38.5 9.46sec 140664 123769 0 0 0 0.0% 0.0% 0.0% 0.0% 38.2 118087 245434 142008 18.8% 0.0% 37.3%

Stats details: frost_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.52 38.52 38.16 38.16 1.1365 3.5733 5418604.71 5418604.71 0.00 30082.47 123768.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.52 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.0 81.22% 118086.86 88466 161232 118087.78 111964 124120 3659464 3659464 0.00
crit 7.2 18.78% 245434.08 182241 332137 245386.97 0 332137 1759141 1759141 0.00
DPS Timeline Chart

Action details: frost_bomb

Static Values
  • id:112948
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:7.79
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:112948
  • name:Frost Bomb
  • school:frost
  • tooltip:After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d.
  • description:Places a Frost Bomb on the target. After $112948d, the bomb explodes, dealing $113092s1 Frost damage to the primary target, and $113092s2 Frost damage to all other targets within $113092A2 yds. All affected targets are slowed by $113092s3% for $113092d. Frost Bomb's countdown and cooldown are reduced by haste.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:1
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_CLIP

Action details: frost_bomb_explosion

Static Values
  • id:113092
  • school:frost
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113092
  • name:Frost Bomb
  • school:frost
  • tooltip:Slowed by $113092s3%.
  • description:$@spelldesc112948
Direct Damage
  • may_crit:true
  • direct_power_mod:2.462000
  • base_dd_min:3285.74
  • base_dd_max:3285.74
frostbolt 22759 (29767) 18.8% (24.6%) 112.8 3.19sec 96615 66640 61942 126748 74197 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.76 112.27 0.00 0.00 1.4498 0.0000 8329765.76 8329765.76 0.00 66639.87 66639.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.04 81.09% 61942.15 22265 91040 61939.26 57179 66750 5638942 5638942 0.00
crit 21.23 18.91% 126747.55 45866 187542 126725.80 90957 159268 2690824 2690824 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:116
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.presence_of_mind.up
Spelldata
  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.250000
  • base_dd_min:1144.86
  • base_dd_max:1457.09
frostfire_bolt 15752 (22179) 13.0% (18.3%) 39.1 9.12sec 207728 183360 78053 157473 147843 87.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.08 39.00 0.00 0.00 1.1329 0.0000 5765199.28 5765199.28 0.00 183360.44 183360.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.73 12.12% 78053.04 35177 115997 77554.65 0 109561 369042 369042 0.00
crit 34.27 87.88% 157472.93 72465 238953 157516.00 141359 183680 5396157 5396157 0.00
DPS Timeline Chart

Action details: frostfire_bolt

Static Values
  • id:44614
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.brain_freeze.up
Spelldata
  • id:44614
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:Movement slowed by $s1%.
  • description:Launches a bolt of frostfire at the enemy, causing $?a57761[${$m2*1.25} to ${$M2*1.25}][$s2] Frostfire damage and slowing the target by $s1% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1373.83
  • base_dd_max:1748.51
frozen_orb 5035 4.2% 6.0 62.21sec 307147 255849 0 0 0 0.0% 0.0% 0.0% 0.0% 60.0 25444 52948 30715 19.2% 0.0% 16.4%

Stats details: frozen_orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 60.00 60.00 1.2005 1.0000 1842882.05 1842882.05 0.00 27422.62 255849.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.5 80.84% 25443.99 18358 33460 25444.56 23643 27625 1234082 1234082 0.00
crit 11.5 19.16% 52947.90 37818 68929 52930.71 45854 61327 608800 608800 0.00
DPS Timeline Chart

Action details: frozen_orb

Static Values
  • id:84714
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30000.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains20&buff.alter_time.down
Spelldata
  • id:84714
  • name:Frozen Orb
  • school:frost
  • tooltip:(null)
  • description:Launches a Frozen Orb forward from the Mage's position, releasing Frostbolts that deal $84721s2 Frost damage to all nearby enemy targets for $d. Grants the Mage 1 charge of Fingers of Frost when it first reaches a target. Targets damaged by the Frost Orb are slowed by $84721s1% for $84721d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: frozen_orb_bolt

Static Values
  • id:84721
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:84721
  • name:Frozen Orb
  • school:frost
  • tooltip:Movement slowed by $s1%.
  • description:$@spelldesc84714
Direct Damage
  • may_crit:true
  • direct_power_mod:0.511000
  • base_dd_min:593.76
  • base_dd_max:763.41
ice_lance 19080 (26261) 15.8% (21.7%) 46.4 7.57sec 207099 182371 79596 160855 150979 87.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.41 46.25 0.00 0.00 1.1356 0.0000 6983411.57 6983411.57 0.00 182370.92 182370.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.62 12.15% 79596.29 29155 119211 79435.49 0 113878 447462 447462 0.00
crit 40.63 87.85% 160854.60 60059 245575 160777.17 135498 185775 6535949 6535949 0.00
DPS Timeline Chart

Action details: ice_lance

Static Values
  • id:30455
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.alter_time.up&buff.fingers_of_frost.up
Spelldata
  • id:30455
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:Deals $?a44544[${$m1*1.25} to ${$M1*1.25}][$s1] Frost damage to an enemy target$?s56377&!a44544[, and ${$m1*$56377m2/100} to ${$M1*$56377m2/100} Frost damage to a second nearby target][]$?s56377&a44544[, and ${$m1*1.25*$56377m2/100} to ${$M1*1.25*$56377m2/100} Frost damage to a second nearby target][]. Ice Lance damage is quadrupled against frozen targets.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
icy_veins 0 0.0% 4.0 93.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: icy_veins

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: icy_veins

Static Values
  • id:12472
  • school:frost
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:target.time_to_die<22
Spelldata
  • id:12472
  • name:Icy Veins
  • school:frost
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
mini_frostbolt 7008 5.8% 0.0 1.#Rsec 0 0 34395 71657 41796 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 61.37 0.00 0.00 0.0000 0.0000 2564986.40 2564986.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.18 80.14% 34395.37 24046 43592 34389.57 32058 37130 1691577 1691577 0.00
crit 12.19 19.86% 71657.43 49535 89801 71643.59 60245 85938 873409 873409 0.00
DPS Timeline Chart

Action details: mini_frostbolt

Static Values
  • id:131079
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131079
  • name:Frostbolt
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc116
Direct Damage
  • may_crit:true
  • direct_power_mod:1.350000
  • base_dd_min:1236.44
  • base_dd_max:1573.66
mini_frostfire_bolt 6427 5.3% 0.0 1.#Rsec 0 0 44678 96847 91429 89.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_frostfire_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 25.73 0.00 0.00 0.0000 0.0000 2352350.94 2352350.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.67 10.39% 44677.98 39258 57394 41861.41 0 57394 119378 119378 0.00
crit 23.06 89.61% 96846.51 80871 118232 96821.01 84891 108244 2232973 2232973 0.00
DPS Timeline Chart

Action details: mini_frostfire_bolt

Static Values
  • id:131081
  • school:frostfire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.75
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131081
  • name:Frostfire Bolt
  • school:frostfire
  • tooltip:(null)
  • description:$@spelldesc44614
Direct Damage
  • may_crit:true
  • direct_power_mod:1.674000
  • base_dd_min:1533.19
  • base_dd_max:1951.33
mini_ice_lance 7181 5.9% 0.0 1.#Rsec 0 0 40710 88927 83883 89.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_ice_lance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.33 0.00 0.00 0.0000 0.0000 2628265.30 2628265.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.28 10.46% 40710.18 29155 52853 39327.09 0 52853 133436 133436 0.00
crit 28.05 89.54% 88926.61 60059 108878 89033.58 81675 98219 2494829 2494829 0.00
DPS Timeline Chart

Action details: mini_ice_lance

Static Values
  • id:131080
  • school:frost
  • resource:none
  • range:40.0
  • travel_speed:38.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131080
  • name:Ice Lance
  • school:frost
  • tooltip:(null)
  • description:$@spelldesc30455
Direct Damage
  • may_crit:true
  • direct_power_mod:0.222000
  • base_dd_min:202.17
  • base_dd_max:259.93
mirror_image 0 (2223) 0.0% (1.8%) 2.0 184.07sec 406692 364076 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mirror_image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.1171 0.0000 0.00 0.00 0.00 364075.64 364075.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mirror_image

Static Values
  • id:55342
  • school:arcane
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Copies of the caster that attack on their own.
  • description:Creates $<images> copies of the caster nearby, which cast spells and attack the Mage's enemies. Lasts $55342d.
presence_of_mind 0 0.0% 5.0 91.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: presence_of_mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: presence_of_mind

Static Values
  • id:12043
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:90.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.alter_time.down
Spelldata
  • id:12043
  • name:Presence of Mind
  • school:physical
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
pet - water_elemental 20855 / 20855
freeze 99 0.1% 14.0 26.65sec 2584 0 2178 4368 2584 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: freeze

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 0.00 0.00 0.0000 0.0000 36210.20 36210.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.41 81.44% 2178.04 1669 2539 2178.10 2041 2278 24852 24852 0.00
crit 2.60 18.56% 4367.87 3337 5079 4119.33 0 5049 11358 11358 0.00
DPS Timeline Chart

Action details: freeze

Static Values
  • id:33395
  • school:frost
  • resource:mana
  • range:45.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:25.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:owner.buff.fingers_of_frost.stack=0
Spelldata
  • id:33395
  • name:Freeze
  • school:frost
  • tooltip:Frozen in place.
  • description:Blasts enemies in a $a1 yard radius for ${($m1+$M1)/2} Frost damage and freezes them in place for up to $d. Damage caused may interrupt the effect. $?s112965[Grants the Mage a charge of Fingers of Frost for each target hit by Freeze.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.023000
  • base_dd_min:394.72
  • base_dd_max:458.72
mini_waterbolt 4986 4.1% 0.0 1.#Rsec 0 0 14781 29982 17801 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mini_waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 102.52 0.00 0.00 0.0000 0.0000 1824938.89 1824938.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.15 80.13% 14780.54 10108 18473 14779.99 13898 15502 1214249 1214249 0.00
crit 20.37 19.87% 29982.44 20217 36946 29982.43 26286 33971 610690 610690 0.00
DPS Timeline Chart

Action details: mini_waterbolt

Static Values
  • id:131581
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:131581
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.426000
  • base_dd_min:387.95
  • base_dd_max:498.79
waterbolt 15770 (20756) 13.0% (17.1%) 187.5 1.95sec 40524 22307 26101 51885 30954 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: waterbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 187.46 186.46 0.00 0.00 1.8167 0.0000 5771687.14 5771687.14 0.00 22306.93 22306.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.37 81.18% 26101.18 9491 41193 26101.22 24754 27667 3950817 3950817 0.00
crit 35.09 18.82% 51885.32 19136 78246 51882.65 39099 60972 1820870 1820870 0.00
DPS Timeline Chart

Action details: waterbolt

Static Values
  • id:31707
  • school:frost
  • resource:none
  • range:45.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31707
  • name:Waterbolt
  • school:frost
  • tooltip:(null)
  • description:Deals $s1 Frost damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.400000
  • base_dd_min:364.27
  • base_dd_max:468.35
pet - mirror_image 13562 / 2223
fire_blast 1939 0.3% 30.0 23.41sec 3878 0 3225 6532 3878 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 0.00 0.00 0.0000 0.0000 116359.01 116359.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.07 80.24% 3224.89 2889 3733 3224.77 3032 3398 77638 77638 0.00
crit 5.93 19.76% 6532.18 5777 7465 6520.29 0 7465 38721 38721 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:59637
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59637
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.005000
  • base_dd_min:984.34
  • base_dd_max:1105.55
frostbolt 11622 1.6% 145.0 4.48sec 4808 3949 3993 8083 4808 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.05 145.05 0.00 0.00 1.2174 0.0000 697350.05 697350.05 0.00 3949.16 3949.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.17 80.09% 3993.29 2923 4683 3993.19 3768 4164 463882 463882 0.00
crit 28.88 19.91% 8083.00 5845 9366 8082.22 7322 8690 233468 233468 0.00
DPS Timeline Chart

Action details: frostbolt

Static Values
  • id:59638
  • school:frost
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.017000
  • base_dd_min:1004.56
  • base_dd_max:1110.30

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
alter_time 2.0 0.0 184.5sec 184.5sec 3.28% 3.28%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_alter_time
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • alter_time_1:3.3%

Spelldata details

  • id:110909
  • name:Alter Time
  • tooltip:Altering Time. Returning to past location, health, mana, and conditions when duration expires.
  • description:$@spelldesc108978
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 3.0 0.9 130.5sec 88.9sec 13.86% 13.86%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.9%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 1.0 0.0sec 14.1sec 12.57% 16.21%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:12.6%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
brain_freeze 39.2 1.0 9.2sec 9.0sec 19.55% 19.55%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_brain_freeze
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • brain_freeze_1:19.6%

Spelldata details

  • id:44549
  • name:Brain Freeze
  • tooltip:(null)
  • description:Your most recently applied Nether Tempest, Living Bomb, or Frost Bomb spell has a chance when it deals damage to grant you the Brain Freeze effect. The Brain Freeze effect causes your next Frostfire Bolt to be instant cast, cost no mana, and act as if your target were frozen for $57761d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 5.9 1.3 65.3sec 52.1sec 33.73% 33.73%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:33.7%
fingers_of_frost 37.0 12.0 9.8sec 7.4sec 29.59% 100.00%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_fingers_of_frost
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:12.00%
  • default_value:-1.00

Stack Uptimes

  • fingers_of_frost_1:22.6%
  • fingers_of_frost_2:7.0%

Spelldata details

  • id:112965
  • name:Fingers of Frost
  • tooltip:(null)
  • description:Your successful Frostbolts, Frostfire Bolts and Frozen Orb hits have a $s1% chance, your Blizzard ticks have a $s2% chance, and your successful Scorches have a $s3% chance to grant you the Fingers of Frost effect. The Fingers of Frost effect causes your next Ice Lance or Deep Freeze to act as if your target were frozen, and increases Ice Lance damage by $44544s2% for $44544d. Limit $44544s1 charges.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
frost_armor 1.0 2.0 0.0sec 184.5sec 100.00% 100.00%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frost_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • frost_armor_1:100.0%

Spelldata details

  • id:7302
  • name:Frost Armor
  • tooltip:Spell haste increased by $7302w1%. Attackers are slowed.
  • description:Increases your spell haste by $7302s1%. If an enemy strikes the caster, their movement is slowed by $7321s2% for $7321d. $@spellname119716 $@spelldesc119716
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
icy_veins 4.1 1.8 91.5sec 57.4sec 24.93% 30.05%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_icy_veins
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • icy_veins_1:24.9%

Spelldata details

  • id:12472
  • name:Icy Veins
  • tooltip:Spell haste increased by $s1% and pushback suffered by damaging attacks while casting reduced by $s2%.
  • description:Accelerates your spellcasting, granting $s1% spell haste and reducing the pushback suffered from damaging attacks while casting by $s2%.$?s56374[ Casting Icy Veins removes all movement slowing and cast time slowing effects.][] Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
invocation 8.0 2.0 46.8sec 36.4sec 89.46% 91.68%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_invocation
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • invocation_1:89.5%

Spelldata details

  • id:116257
  • name:Invoker's Energy
  • tooltip:Spell damage increased by $s1%.
  • description:$@spelldesc114003
  • max_stacks:
  • duration:40.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.9 97.8sec 80.6sec 13.85% 13.85%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:13.9%
jade_spirit 6.8 0.8 56.0sec 49.5sec 22.11% 30.04%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.1%
lightweave_embroidery_3 6.0 0.9 66.8sec 56.4sec 25.46% 25.46%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_lightweave_embroidery_3
  • max_stacks:1
  • duration:15.00
  • cooldown:64.00
  • default_chance:25.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:2200.00

    Stack Uptimes

    • lightweave_embroidery_3_1:25.5%
presence_of_mind 5.0 0.0 91.0sec 91.0sec 1.44% 1.36%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_presence_of_mind
  • max_stacks:1
  • duration:0.00
  • cooldown:90.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • presence_of_mind_1:1.4%

Spelldata details

  • id:12043
  • name:Presence of Mind
  • tooltip:Your next Mage spell with a casting time less than 10 sec will be an instant cast spell.
  • description:When activated, your next Mage spell with a casting time less than 10 sec becomes an instant cast spell. This spell is not on the global cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:90.00
  • default_chance:1.00%
relic_of_yulon 7.1 1.0 54.3sec 46.9sec 29.75% 29.75%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.8%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
water_elemental-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Mage_Frost_T14H_water_elemental
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Mage_Frost_T14H
alter_time_activate Mana 2.0 6000.0 3000.0 3000.0 0.0
frost_bomb Mana 38.5 144456.4 3750.0 3750.0 37.5
frostbolt Mana 112.8 1353178.9 12000.0 12000.0 8.1
frozen_orb Mana 6.0 180000.0 30000.0 30000.0 10.2
ice_lance Mana 46.4 139233.2 3000.0 3000.0 69.0
mirror_image Mana 2.0 12004.8 6000.0 6000.0 67.8
time_warp Mana 0.0 3.6 12000.0 12000.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 701083.73 479.21 69300.64 9.00%
evocation Mana 30.73 815432.38 26534.79 1049619.58 56.28%
mana_gem Mana 3.00 194525.07 64841.69 15729.41 7.48%
Resource RPS-Gain RPS-Loss
Health 240.43 18607.28
Mana 4674.98 5013.32
Combat End Resource Mean Min Max
Health -6130258.79 -6130290.20 -6085435.20
Mana 190634.29 149570.91 245185.86
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
dps_rotation 0.6%
dpm_rotation 99.4%
water_elemental 100.0%
water_elemental-dps_rotation 0.6%
water_elemental-dpm_rotation 99.4%
water_elemental-water_elemental 100.0%
Uptimes %
Mana Cap 9.3%
water_elemental-Mana Cap 9.3%
mirror_image-Mana Cap 9.3%

Procs

Count Interval
mana_gem 3.0 129.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 121125.71
Minimum 109132.26
Maximum 131049.83
Spread ( max - min ) 21917.57
Range [ ( max - min ) / 2 * 100% ] 9.05%
Standard Deviation 2502.2224
5th Percentile 116946.48
95th Percentile 125126.94
( 95th Percentile - 5th Percentile ) 8180.46
Mean Distribution
Standard Deviation 25.0272
95.00% Confidence Intervall ( 121076.66 - 121174.77 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1639
0.1 Scale Factor Error with Delta=300 53448
0.05 Scale Factor Error with Delta=300 213793
0.01 Scale Factor Error with Delta=300 5344849
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 121125.71

Damage

Sample Data
Count 9996
Mean 35885466.01

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 295.60
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 arcane_brilliance
3 0.00 frost_armor
4 0.00 water_elemental
5 0.00 snapshot_stats
6 0.00 evocation
7 0.00 jade_serpent_potion
Default action list
# count action,conditions
8 0.00 counterspell,if=target.debuff.casting.react
9 2.00 cold_snap,if=health.pct<30
A 0.00 conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
B 0.00 time_warp,if=target.health.pct<25|time>5
C 5.00 presence_of_mind,if=buff.alter_time.down
D 14.01 water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
E 0.00 icy_veins,if=target.time_to_die<22
F 0.00 blood_fury,if=target.time_to_die<12
G 2.97 frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
H 4.28 ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
I 0.00 frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
J 0.50 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
K 1.93 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
L 4.00 icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
M 0.00 icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
N 40.13 frost_bomb,if=!ticking
O 0.00 icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
P 2.00 mirror_image
Q 7.00 evocation,if=buff.invocation.down&buff.alter_time.down
R 0.00 ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
S 1.00 jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
T 3.00 blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
U 7.03 frostbolt,if=debuff.frostbolt.stack<3
V 2.00 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
W 0.00 alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
X 36.11 frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Y 0.00 ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
Z 41.63 ice_lance,if=buff.fingers_of_frost.react
a 4.07 frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
b 3.00 mana_gem,if=mana.pct<84&buff.alter_time.down
c 113.93 frostbolt
d 0.00 fire_blast,moving=1
e 0.00 ice_lance,moving=1

Sample Sequence

CDKLNPTUUUUUNVGHHGcNbcXZXZNccDcZXNcccXcNccZXZcNccQDN9XZccXcNZaZcXcNZccXZZDNZccXccNcCccQLNSXZccXZNZDcZZXcNcccXcaNZccZXDcNQTXZZNccccXcNcbccXDcZNcccXccNZccXCcQKLNPZZZDVGHcNUUUUXZNZccccXNZccZXZDNZccXZQ9NccZcXcNaZZDcXZcNcZTcXZcNcCcZcccNDQLXZNccccXcNcbccXcDcNZcaZXZNcZccQNXZDcXZZcNZccXccNccccXcNDcZcCXc

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 128 122 80
Agility 131 125 80
Stamina 22276 20251 20183
Intellect 22000 19587 18443
Spirit 559 559 350
Health 458267 429917 0
Mana 300000 300000 0
Spell Power 32886 27484 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 20.77% 14.82% 3706
Spell Haste 28.33% 16.40% 6969
Mana Per 5 9625 8730 0
Attack Power 119 102 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.79% 9.79% 3706
Melee Haste 16.40% 16.40% 6969
Swing Speed 28.04% 16.40% 6969
Expertise 0.00% 0.00% 0
Armor 14857 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.66% 21.66% 1700

Gear

Average Item Level: 506.50
Head hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
Neck worldwaker_cachabon,id=87076
Shoulders mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest robes_of_the_burning_scroll,id=87010,gems=160int_160int,enchant=80all,reforge=crit_hit
Waist belt_of_malleable_amber,id=86981,gems=160int_160int_160int
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=160int,enchant=175hit,reforge=mastery_crit
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands gloves_of_the_burning_scroll,id=87007,enchant=170haste
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=mastery_crit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Presence of Mind Scorch Ice Floes
30 Temporal Shield Blazing Speed Ice Barrier
45 Ring of Frost Ice Ward Frostjaw
60 Greater Invisibility Cauterize Cold Snap
75 Nether Tempest Living Bomb Frost Bomb
90 Invocation Rune of Power Incanter's Ward

Profile

#!./simc

mage="Mage_Frost_T14H"
origin="unknown"
level=90
race=orc
spec=frost
role=spell
position=back
professions=tailoring=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#eb!022220
glyphs=evocation/icy_veins/ice_lance

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/arcane_brilliance
actions.precombat+=/frost_armor
actions.precombat+=/water_elemental
actions.precombat+=/snapshot_stats
actions.precombat+=/evocation
actions.precombat+=/jade_serpent_potion

actions=counterspell,if=target.debuff.casting.react
actions+=/cold_snap,if=health.pct<30
actions+=/conjure_mana_gem,if=mana_gem_charges<3&target.debuff.invulnerable.react
actions+=/time_warp,if=target.health.pct<25|time>5
actions+=/presence_of_mind,if=buff.alter_time.down
actions+=/water_elemental:freeze,if=buff.alter_time.down&buff.fingers_of_frost.stack<2
actions+=/icy_veins,if=target.time_to_die<22
actions+=/blood_fury,if=target.time_to_die<12
actions+=/frostfire_bolt,if=buff.alter_time.up&buff.brain_freeze.up
actions+=/ice_lance,if=buff.alter_time.up&buff.fingers_of_frost.up
actions+=/frostbolt,if=buff.alter_time.up&buff.presence_of_mind.up
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<5
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2&cooldown.icy_veins.remains<gcd&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=set_bonus.tier14_4pc_caster&buff.invocation.remains>20&buff.alter_time.down
actions+=/icy_veins,if=!set_bonus.tier14_4pc_caster&dot.frozen_orb.ticking
actions+=/frost_bomb,if=!ticking
actions+=/icy_veins,if=dot.frozen_orb.ticking&buff.alter_time.down
actions+=/mirror_image
actions+=/evocation,if=buff.invocation.down&buff.alter_time.down
actions+=/ice_lance,if=buff.fingers_of_frost.up&buff.fingers_of_frost.remains<2
actions+=/jade_serpent_potion,if=buff.bloodlust.react|buff.icy_veins.up|target.time_to_die<=40
actions+=/blood_fury,if=buff.invocation.remains>15&buff.alter_time.down&mana.pct>28
actions+=/frostbolt,if=debuff.frostbolt.stack<3
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react&buff.invocation.remains>6
actions+=/alter_time,if=buff.alter_time.down&buff.brain_freeze.react&buff.fingers_of_frost.react
actions+=/frostfire_bolt,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.brain_freeze.react&(buff.alter_time.up|cooldown.alter_time_activate.remains>4)
actions+=/ice_lance,if=buff.fingers_of_frost.react
actions+=/frozen_orb,if=target.time_to_die>=4&buff.fingers_of_frost.stack<2
actions+=/mana_gem,if=mana.pct<84&buff.alter_time.down
actions+=/frostbolt
actions+=/fire_blast,moving=1
actions+=/ice_lance,moving=1

head=hood_of_the_burning_scroll,id=87008,gems=burning_primal_80int_160hit_180int,reforge=mastery_hit
neck=worldwaker_cachabon,id=87076
shoulders=mantle_of_the_burning_scroll,id=87011,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=lightweave_embroidery_3,reforge=mastery_crit
chest=robes_of_the_burning_scroll,id=87010,gems=160int_160int,enchant=80all,reforge=crit_hit
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=gloves_of_the_burning_scroll,id=87007,enchant=170haste
waist=belt_of_malleable_amber,id=86981,gems=160int_160int_160int
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=160int,enchant=175hit,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18443
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3706
# gear_haste_rating=6969
# gear_mastery_rating=1700
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# back=cloak_of_overwhelming_corruption,heroic=1,enchant=lightweave_embroidery_3
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit

Monk_Windwalker_1h_T14H : 110142 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
110141.9 110141.9 63.55 / 0.06% 5319 / 4.8% 8031.1 12.9 12.8 Energy 5.95% 55.5 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:160648|108468|89657|37910|22221|18896|13275&chds=0,321297&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++160648++rising_sun_kick,C79C6E,0,0,15|t++108468++fists_of_fury,C79C6E,1,0,15|t++89657++blackout_kick,C79C6E,2,0,15|t++37910++tiger_palm,C79C6E,3,0,15|t++22221++melee_main_hand,C79C6E,4,0,15|t++18896++jab,C79C6E,5,0,15|t++13275++melee_off_hand,C79C6E,6,0,15&chtt=Monk_Windwalker_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,18,17,11,10,8,6,4,4,3,2&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473&chl=blackout_kick|melee_main_hand|rising_sun_kick|melee_off_hand|fists_of_fury|tiger_strikes_melee|jab|xuen_the_white_tiger: crackling_tiger_lightning|tiger_palm|blackout_kick_dot|xuen_the_white_tiger: melee&chtt=Monk_Windwalker_1h_T14H Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:0001123344478767776541100zzyxvvvuuussrqppppooonkjiihhhhgiiiijjkkkkkkmnnnnnnmmlmljiiihhghggggfffffffffgggfeeeeeefeffffgggghhhiiiiiijjjjjjjjjjjiiiiijjjjjiiiihhhhggfeeeeeeeedbcdeefgghijlmnoppqqrtvvvuvuuuuttssssrrrrqqppnnmkkjiiihhggggffeeeegggiiiijjjjjjjjkkkkkkkkkiihihihihihhhhhfeeeeefggffffffffffffhhiiiijjjhhhiijjjjkkllllmmmmmmnoonnmlkjjjiiihhhgggffffeddfghggggggggff&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=110142|max=178950&chxp=1,1,62,100&chtt=Monk_Windwalker_1h_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,1,6,7,11,14,32,43,52,75,112,150,192,251,272,329,377,454,481,571,543,566,596,565,569,544,486,445,433,369,302,288,211,161,132,109,69,52,44,20,23,13,5,3,7,3,3,0,1,2&chds=0,596&chbh=5&chxt=x&chxl=0:|min=99081|avg=110142|max=123288&chxp=0,1,46,100&chtt=Monk_Windwalker_1h_T14H DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:33.6,26.0,11.3,10.4,9.4,0.8,5.9&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ABD473,ffffff&chl=jab 122.8s|blackout_kick 95.2s|rising_sun_kick 41.3s|tiger_palm 38.2s|fists_of_fury 34.5s|invoke_xuen 3.1s|waiting 21.8s&chtt=Monk_Windwalker_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Monk_Windwalker_1h_T14H 110142
berserking 0 0.0% 3.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
blackout_kick 23332 21.2% 91.8 3.91sec 93053 89657 65209 135410 93053 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blackout_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.77 91.77 0.00 0.00 1.0379 0.0000 8539342.77 8539342.77 0.00 89656.60 89656.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.37 60.34% 65208.75 56287 75768 65207.41 63566 66569 3610618 3610618 0.00
crit 36.40 39.66% 135410.25 115950 156082 135413.34 131483 139309 4928725 4928725 0.00
DPS Timeline Chart

Action details: blackout_kick

Static Values
  • id:100784
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combo_breaker_bok.react
Spelldata
  • id:100784
  • name:Blackout Kick
  • school:physical
  • tooltip:(null)
  • description:Kick with a blast of Chi energy, dealing ${8*$<low>} to ${8*$<high>} Physical damage.$?s128595[ If behind the target, you deal an additional $m2% damage over $128531d. If in front of the target, you are instantly healed for $m2% of the damage done.][] $?s117967[ Also causes you to gain Shuffle, increasing your parry chance by $115307s1% and your Stagger amount by an additional $115307s2% for $115307d.][]$?s116645[ Also empowers you with Serpent's Zeal, causing you and your summoned Jade Serpent Statue to heal nearby injured targets equal to $127722m1% of your auto-attack damage. Stacks up to 2 times.][]
blackout_kick_dot 3481 3.2% 91.8 3.91sec 13883 0 0 0 0 0.0% 0.0% 0.0% 0.0% 277.0 4600 0 4600 0.0% 0.0% 75.7%

Stats details: blackout_kick_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.76 91.76 276.95 276.95 0.0000 1.0000 1273904.70 1273904.70 0.00 4599.75 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 277.0 100.00% 4599.73 1911 13826 4598.81 3809 5523 1273905 1273905 0.00
DPS Timeline Chart

Action details: blackout_kick_dot

Static Values
  • id:128531
  • school:physical
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:128531
  • name:Blackout Kick
  • school:physical
  • tooltip:$w1 damage every $t1 sec.
  • description:$@spelldesc100784
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:3645.93
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
energizing_brew 0 0.0% 5.6 62.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: energizing_brew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.57 5.57 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.57 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: energizing_brew

Static Values
  • id:115288
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<=35
Spelldata
  • id:115288
  • name:Energizing Brew
  • school:physical
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
fists_of_fury 10239 9.3% 11.7 26.80sec 320559 108468 0 0 0 0.0% 0.0% 0.0% 0.0% 43.3 60837 126011 86532 39.4% 0.0% 8.6%

Stats details: fists_of_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.69 11.69 43.31 43.31 2.9553 0.7300 3747354.80 3747354.80 0.00 108468.07 108468.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.2 60.57% 60837.08 58389 71032 60841.92 58817 63821 1595896 1595896 0.00
crit 17.1 39.43% 126011.37 120282 146327 126010.57 120732 132375 2151459 2151459 0.00
DPS Timeline Chart

Action details: fists_of_fury

Static Values
  • id:113656
  • school:physical
  • resource:chi
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
Spelldata
  • id:113656
  • name:Fists of Fury
  • school:physical
  • tooltip:$w2 damage every $t2 sec. $?s125671[Parrying all attacks.][]
  • description:Pummel all targets in front of you with rapid hand strikes, stunning them and dealing ${7.5*$<low>} to ${7.5*$<high>} damage immediately and every $113656t2 sec for $113656d. Damage is spread evenly over all targets.$?s125671[ Your parry chance is increased by 100% while channeling.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP

Action details: fists_of_fury_tick

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
invoke_xuen 0 0.0% 3.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: invoke_xuen

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: invoke_xuen

Static Values
  • id:123904
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.invoke_xuen.enabled
Spelldata
  • id:123904
  • name:Invoke Xuen, the White Tiger
  • school:nature
  • tooltip:(null)
  • description:Invokes the White Tiger Celestial, summoning an effigy at the command of the caster. The effigy will assist you, attacking your primary target and also inflicting tiger lightning every $123999t1 sec to 3 nearby enemies within $123996A1 yards dealing $123996o1 damage over $123996d. Lasts for $d. |CFFFFFFFFBrewmaster|R Xuen will also taunt the target, forcing it to attack him.
jab 6340 5.8% 118.3 3.10sec 19613 18896 13731 28519 19613 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: jab

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.31 118.31 0.00 0.00 1.0379 0.0000 2320437.24 2320437.24 0.00 18895.91 18895.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.25 60.22% 13730.53 11858 15962 13730.40 13470 13985 978319 978319 0.00
crit 47.06 39.78% 28519.40 23730 32882 28520.50 27834 29189 1342118 1342118 0.00
DPS Timeline Chart

Action details: jab

Static Values
  • id:100780
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
Spelldata
  • id:100780
  • name:Jab
  • school:physical
  • tooltip:(null)
  • description:You Jab the target, dealing ${1.5*$<low>} to ${1.5*$<high>} damage and generating $s2 Chi.
melee_main_hand 18544 16.8% 168.4 2.17sec 40293 22221 33635 70974 40293 40.0% 18.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.44 168.44 0.00 0.00 1.8133 0.0000 6787014.30 6787014.30 0.00 22220.52 22220.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.74 17.07% 33635.44 28839 41457 33635.02 32372 35489 966834 966834 0.00
crit 67.41 40.02% 70974.05 59409 85402 70975.34 69035 73099 4784010 4784010 0.00
glance 40.38 23.97% 25661.28 21011 31093 25661.14 24652 26618 1036170 1036170 0.00
miss 31.91 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 11092 10.1% 173.1 2.11sec 23446 13275 19539 41346 23446 40.0% 19.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.14 173.14 0.00 0.00 1.7663 0.0000 4059595.68 4059595.68 0.00 13274.59 13274.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.54 17.06% 19539.44 16662 24536 19538.63 18726 20544 577150 577150 0.00
crit 69.26 40.00% 41346.46 34324 50544 41347.41 40108 42699 2863594 2863594 0.00
glance 41.44 23.93% 14933.13 12140 18402 14932.92 14305 15596 618851 618851 0.00
miss 32.91 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
rising_sun_kick 18131 16.5% 39.8 9.27sec 166776 160648 116989 242672 166776 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: rising_sun_kick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.79 39.79 0.00 0.00 1.0381 0.0000 6636065.26 6636065.26 0.00 160648.43 160648.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.03 60.39% 116988.64 98421 136382 116980.15 113396 120836 2810993 2810993 0.00
crit 15.76 39.61% 242672.17 202748 280948 242698.84 232142 254914 3825073 3825073 0.00
DPS Timeline Chart

Action details: rising_sun_kick

Static Values
  • id:107428
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:2.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.rising_sun_kick.remains<=3
Spelldata
  • id:107428
  • name:Rising Sun Kick
  • school:physical
  • tooltip:(null)
  • description:You kick upwards, dealing ${14.4*$<low>} to ${14.4*$<high>} damage and applying Mortal Wounds to the target. Also causes all targets within $130320A1 yards to take an increased $130320m1% damage from your abilities for $130320d. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
tiger_palm 3953 3.6% 36.8 9.96sec 39342 37910 27471 57040 39342 40.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_palm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.78 36.78 0.00 0.00 1.0378 0.0000 1446827.69 1446827.69 0.00 37909.80 37909.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.01 59.85% 27470.84 23716 31925 27469.76 26534 28554 604658 604658 0.00
crit 14.76 40.15% 57039.77 48855 65765 57043.50 53755 60241 842170 842170 0.00
DPS Timeline Chart

Action details: tiger_palm

Static Values
  • id:100787
  • school:physical
  • resource:chi
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.tiger_power.stack<3|buff.tiger_power.remains<=3
Spelldata
  • id:100787
  • name:Tiger Palm
  • school:physical
  • tooltip:(null)
  • description:Attack with the palm of your hand, dealing ${3*$<low>} to ${3*$<high>} damage. Also grants you Tiger Power, causing your attacks to ignore $125359m1% of enemies' armor for $125359d. Stacks up to $m2 times.
tiger_strikes_melee 8733 7.9% 82.5 4.80sec 38742 0 26953 56302 38742 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tiger_strikes_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.50 82.50 0.00 0.00 0.0000 0.0000 3196282.41 3196282.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.36 59.83% 26952.50 16662 41457 26954.93 24040 30180 1330420 1330420 0.00
crit 33.14 40.17% 56301.66 34324 85402 56285.86 45886 65324 1865863 1865863 0.00
DPS Timeline Chart

Action details: tiger_strikes_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tigereye_brew_use 0 0.0% 6.0 58.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tigereye_brew_use

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tigereye_brew_use

Static Values
  • id:116740
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
Spelldata
  • id:116740
  • name:Tigereye Brew
  • school:physical
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
pet - xuen_the_white_tiger 24536 / 6298
crackling_tiger_lightning 17212 4.0% 17.0 23.73sec 95117 91551 0 0 0 0.0% 0.0% 0.0% 0.0% 83.1 13607 27921 19468 40.9% 0.0% 88.4%

Stats details: crackling_tiger_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.00 17.00 83.06 83.06 1.0390 1.0000 1616971.09 1616971.09 0.00 16054.28 91550.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.1 59.06% 13607.19 11910 18111 13606.28 12649 14440 667443 667443 0.00
crit 34.0 40.94% 27921.40 23821 36223 27924.60 25210 30838 949529 949529 0.00
DPS Timeline Chart

Action details: crackling_tiger_lightning

Static Values
  • id:123996
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:123996
  • name:Crackling Tiger Lightning
  • school:nature
  • tooltip:Taking $m1 damage every $t1 sec.
  • description:$@spelldesc123904
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.459500
  • base_td:291.20
  • num_ticks:5
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
melee 7325 1.7% 151.9 2.42sec 4530 7403 3282 6729 4530 41.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 151.90 151.90 0.00 0.00 0.6119 0.0000 688131.49 688131.49 0.00 7403.48 7403.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.08 34.28% 3281.85 3023 3988 3281.79 3125 3426 170910 170910 0.00
crit 63.33 41.69% 6729.22 6045 7976 6729.37 6445 7038 426138 426138 0.00
glance 36.50 24.03% 2495.66 2267 2991 2495.64 2332 2641 91084 91084 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.035771
  • base_dd_min:1158.00
  • base_dd_max:1158.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.0sec 180.9sec 6.57% 8.86%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 14.29%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
combo_breaker_bok 28.2 0.1 12.7sec 12.7sec 13.25% 30.53%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_bok
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_bok_1:13.3%

Spelldata details

  • id:116768
  • name:Combo Breaker: Blackout Kick
  • tooltip:Your next Blackout Kick costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
combo_breaker_tp 27.5 0.8 13.0sec 12.6sec 16.22% 74.20%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_combo_breaker_tp
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • combo_breaker_tp_1:16.2%

Spelldata details

  • id:118864
  • name:Combo Breaker: Tiger Palm
  • tooltip:Your next Tiger Palm costs no Chi.
  • description:$@spelldesc115636
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel_oh 11.2 12.8 32.6sec 14.7sec 54.70% 54.15%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:54.7%
energizing_brew 5.6 0.0 62.4sec 62.4sec 9.08% 9.09%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_energizing_brew
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • energizing_brew_1:9.1%

Spelldata details

  • id:115288
  • name:Energizing Brew
  • tooltip:Generating $m1 Energy every $t1 sec.
  • description:Regenerates $o1 Energy over $d. Can only be used while in combat.
  • max_stacks:3
  • duration:6.00
  • cooldown:60.00
  • default_chance:1.01%
relic_of_xuen 6.3 0.0 61.2sec 61.2sec 25.08% 25.08%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.1%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.9 0.0 60.6sec 60.7sec 17.01% 17.01%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.0%
terror_in_the_mists 6.0 0.0 63.5sec 63.5sec 32.78% 32.78%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tiger_power 1.2 35.6 205.7sec 9.9sec 99.10% 99.41%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_power
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_power_1:0.6%
  • tiger_power_2:0.5%
  • tiger_power_3:98.0%

Spelldata details

  • id:125359
  • name:Tiger Power
  • tooltip:Your attacks ignore $m1% armor.
  • description:$@spelldesc100787
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
tiger_stance 0.0 0.0 0.0sec 0.0sec 0.07% 0.07%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_stance_1:0.1%

Spelldata details

  • id:103985
  • name:Stance of the Fierce Tiger
  • tooltip:(null)
  • description:Increases damage done by $m3% and increases the amount of Chi generated by your Jab and Expel Harm abilities by $m4.
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
tiger_strikes 20.7 0.0 17.2sec 17.2sec 18.61% 23.70%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tiger_strikes
  • max_stacks:4
  • duration:15.00
  • cooldown:0.00
  • default_chance:8.00%
  • default_value:-1.00

Stack Uptimes

  • tiger_strikes_1:4.8%
  • tiger_strikes_2:3.8%
  • tiger_strikes_3:4.8%
  • tiger_strikes_4:5.1%

Spelldata details

  • id:120273
  • name:Tiger Strikes
  • tooltip:Attack speed increased by $s1%, and the next $n autoattacks cause an extra attack.
  • description:$@spelldesc120272
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
tigereye_brew 7.0 55.5 57.7sec 5.8sec 91.32% 100.00%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_1:11.6%
  • tigereye_brew_2:11.0%
  • tigereye_brew_3:9.2%
  • tigereye_brew_4:9.2%
  • tigereye_brew_5:9.5%
  • tigereye_brew_6:9.5%
  • tigereye_brew_7:9.5%
  • tigereye_brew_8:9.4%
  • tigereye_brew_9:9.9%
  • tigereye_brew_10:2.6%

Spelldata details

  • id:125195
  • name:Tigereye Brew
  • tooltip:Use Tigereye Brew to consume charges to gain 2% damage per charge.
  • description:$@spelldesc123980
  • max_stacks:10
  • duration:120.00
  • cooldown:0.00
  • default_chance:1.01%
tigereye_brew_use 6.0 0.0 58.9sec 58.9sec 24.51% 24.51%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_tigereye_brew_use
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tigereye_brew_use_1:24.5%

Spelldata details

  • id:116740
  • name:Tigereye Brew
  • tooltip:Increases damage done by $w1%.
  • description:Increases damage done by $m1% per stack of Tigereye Brew active, consuming your Tigereye Brew stacks. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 310.6sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
windsong_crit 6.1 1.7 53.3sec 40.6sec 22.56% 21.77%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_crit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_crit_1:22.6%
windsong_haste 6.1 1.7 53.7sec 40.6sec 22.50% 21.89%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_haste
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_haste_1:22.5%
windsong_mastery 6.1 1.7 53.7sec 40.7sec 22.39% 21.67%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_windsong_mastery
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:1500.00

    Stack Uptimes

    • windsong_mastery_1:22.4%
xuen_the_white_tiger-stunned 2.0 0.0 179.4sec 0.0sec 1.07% 1.07%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H_xuen_the_white_tiger
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Monk_Windwalker_1h_T14H
blackout_kick Chi 91.8 127.5 1.4 1.4 66972.1
fists_of_fury Chi 11.7 35.1 3.0 3.0 106852.9
jab Energy 118.3 4732.4 40.0 40.0 490.3
rising_sun_kick Chi 39.8 79.6 2.0 2.0 83388.2
tiger_palm Chi 36.8 9.5 0.3 0.3 152477.5
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1463.00 4353.34 2.98 67.04 1.52%
chi Chi 118.31 253.70 2.14 0.00 0.00%
combo_breaker_savings Chi 55.30 83.32 1.51 0.00 0.00%
energizing_brew Energy 132.93 328.85 2.47 3.47 1.04%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Energy 12.79 12.93
Chi 0.69 0.69
Combat End Resource Mean Min Max
Health -6355722.00 -6355722.00 -6355722.00
Mana 300000.00 300000.00 300000.00
Energy 49.05 1.31 100.00
Chi 2.08 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.2%
xuen_the_white_tiger-Energy Cap 0.2%

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 110141.88
Minimum 99081.09
Maximum 123287.70
Spread ( max - min ) 24206.60
Range [ ( max - min ) / 2 * 100% ] 10.99%
Standard Deviation 3241.5501
5th Percentile 104869.99
95th Percentile 115508.73
( 95th Percentile - 5th Percentile ) 10638.74
Mean Distribution
Standard Deviation 32.4220
95.00% Confidence Intervall ( 110078.33 - 110205.42 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3327
0.1 Scale Factor Error with Delta=300 89699
0.05 Scale Factor Error with Delta=300 358797
0.01 Scale Factor Error with Delta=300 8969931
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 110141.88

Damage

Sample Data
Count 9996
Mean 38006824.86

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 338.82
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 stance
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
Default action list
# count action,conditions
5 15.00 auto_attack
6 0.00 chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
7 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
8 6.92 use_item,name=bonebreaker_gauntlets
9 3.00 berserking
A 3.19 rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
B 11.99 tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
C 0.00 run_action_list,name=aoe,if=num_targets>5
D 0.00 run_action_list,name=st,if=num_targets<=5
actions.st
# count action,conditions
J 6.00 tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
K 5.57 energizing_brew,if=energy<=35
L 3.00 invoke_xuen,if=talent.invoke_xuen.enabled
M 36.60 rising_sun_kick
N 11.69 fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
O 0.00 zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
P 26.41 blackout_kick,if=buff.combo_breaker_bok.react
Q 21.61 tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
R 3.17 tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
S 118.31 jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
T 65.36 blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

Sample Sequence

589LSABSBBSSTMSQSPTSQMSPTTSTTSMSQTSTSTSMSTQSTST5SMQSNJSTSKM5ST8STSTSBMSPTSNSMPSPTSBTSMQST5SNSMSPQTSTSMSTJSPN5QSAPS8KPSQPTMSSTTSTSM5SNSBSMSQTSQTSMTSPTSMSPTSBTJSM5SNPSM589LSQSKTSQMSTTSPTTSMSTSNSBPSMSTSPTSMSTTSB5SM5JPQSNSMPQST8STSMKSTSPTSQMSTSNSMQSTSTS5MSTSNSBAS5TJSTSMSQTSQTSM8PSN7QSMPSKTS5TSTMSSTSQNSMSTSTSMPTS5BSNJPSAQSTSTSM59LS8TSN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 184 175 80
Agility 21699 19301 18268
Stamina 22010 20009 19896
Intellect 257 245 80
Spirit 271 271 80
Health 454543 426529 0
Mana 300000 300000 0
Energy 100 100 0
Chi 4 4 0
Spell Power 0 0 0
Spell Hit 15.02% 15.02% 2552
Spell Crit 12.89% 7.89% 3564
Spell Haste 20.43% 14.70% 6246
Mana Per 5 6000 6000 0
Attack Power 48105 38927 0
Melee Hit 7.51% 7.51% 2552
Melee Crit 35.65% 28.74% 3564
Melee Haste 14.70% 14.70% 6246
Swing Speed 26.17% 14.70% 6246
Expertise 7.51% / 7.51% 7.51% / 7.51% 2555
Armor 18523 18523 18523
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.16% 16.16% 2121

Gear

Average Item Level: 506.50
Head red_crane_headpiece,id=87086,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
Neck choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
Shoulders red_crane_spaulders,id=87088,gems=160agi,enchant=200agi_100crit,reforge=exp_hit
Shirt empty
Chest red_crane_tunic,id=87084,gems=160agi_160agi,enchant=80all,reforge=mastery_haste
Waist tomb_raiders_girdle,id=87022,gems=160agi_160agi_160agi
Legs red_crane_leggings,id=87087,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=160agi,enchant=140agi,reforge=crit_hit
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_hit
Hands bonebreaker_gauntlets,id=86964,gems=160agi,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503,enchant=160agi,reforge=crit_hit
Finger2 painful_thorned_ring,id=86974,enchant=160agi,reforge=exp_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back arrow_breaking_windcloak,id=87044,enchant=180hit
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=windsong,reforge=exp_hit
Off Hand claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=exp_haste
Unknown empty
Tabard empty

Talents

Level
15 Celerity Tiger's Lust Momentum
30 Chi Wave Zen Sphere Chi Burst
45 Power Strikes Ascension Chi Brew
60 Deadly Reach Charging Ox Wave Leg Sweep
75 Healing Elixirs Dampen Harm Diffuse Magic
90 Rushing Jade Wind Invoke Xuen, the White Tiger Chi Torpedo

Profile

#!./simc

monk="Monk_Windwalker_1h_T14H"
origin="unknown"
level=90
race=troll
spec=windwalker
role=hybrid
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#fb!020221

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/stance
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=auto_attack
actions+=/chi_sphere,if=talent.power_strikes.enabled&buff.chi_sphere.react&chi<4
actions+=/virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<=60
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/rising_sun_kick,if=target.debuff.rising_sun_kick.remains<=3
actions+=/tiger_palm,if=buff.tiger_power.stack<3|buff.tiger_power.remains<=3
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/run_action_list,name=st,if=num_targets<=5

actions.aoe=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.aoe+=/energizing_brew,if=energy<=35
actions.aoe+=/rushing_jade_wind,if=talent.rushing_jade_wind.enabled
actions.aoe+=/rising_sun_kick,if=chi=4&(!talent.chi_burst.enabled|num_targets<=7)
actions.aoe+=/spinning_crane_kick

actions.st=tigereye_brew_use,if=!buff.tigereye_brew_use.up&buff.tigereye_brew.react=10
actions.st+=/energizing_brew,if=energy<=35
actions.st+=/invoke_xuen,if=talent.invoke_xuen.enabled
actions.st+=/rising_sun_kick
actions.st+=/fists_of_fury,if=!buff.energizing_brew.up&energy.time_to_max>5&buff.tiger_power.remains>4&buff.tiger_power.stack=3
actions.st+=/zen_sphere,if=!buff.zen_sphere.up&talent.zen_sphere.enabled
actions.st+=/blackout_kick,if=buff.combo_breaker_bok.react
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<70|(buff.energizing_brew.up&energy<50))
actions.st+=/tiger_palm,if=buff.combo_breaker_tp.react&(energy<88|(buff.energizing_brew.up&energy<78))&((chi<=2&cooldown.power_strikes.remains>2)|(chi<=1&!cooldown.power_strikes.remains<=2))
actions.st+=/jab,if=(chi<=2&cooldown.power_strikes.remains)|(chi<=1&!cooldown.power_strikes.remains)
actions.st+=/blackout_kick,if=(buff.energizing_brew.up&energy>=18)|energy>=28

head=red_crane_headpiece,id=87086,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=mastery_haste
shoulders=red_crane_spaulders,id=87088,gems=160agi,enchant=200agi_100crit,reforge=exp_hit
back=arrow_breaking_windcloak,id=87044,enchant=180hit
chest=red_crane_tunic,id=87084,gems=160agi_160agi,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_hit
hands=bonebreaker_gauntlets,id=86964,gems=160agi,enchant=170haste,addon=synapse_springs_mark_ii
waist=tomb_raiders_girdle,id=87022,gems=160agi_160agi_160agi
legs=red_crane_leggings,id=87087,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=160agi,enchant=140agi,reforge=crit_hit
finger1=regails_band_of_the_endless,id=90503,enchant=160agi,reforge=crit_hit
finger2=painful_thorned_ring,id=86974,enchant=160agi,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=windsong,reforge=exp_hit
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=exp_haste

# Gear Summary
# gear_strength=80
# gear_agility=18268
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2555
# gear_hit_rating=2552
# gear_crit_rating=3564
# gear_haste_rating=6246
# gear_mastery_rating=2121
# gear_armor=18523
# meta_gem=agile_primal
# tier14_2pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=windsong
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Paladin_Retribution_T14H : 116258 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
116257.9 116257.9 43.85 / 0.04% 3701 / 3.2% 86.7 1272.3 1266.8 Mana 6.18% 55.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
Glyphs
  • templars_verdict
  • double_jeopardy
  • mass_exorcism

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:287064|88404|83830|64803|47590|31627|12404&chds=0,574128&chco=F58CBA,F58CBA,C79C6E,F58CBA,F58CBA,C79C6E,C79C6E&chm=t++287064++execution_sentence,F58CBA,0,0,15|t++88404++hammer_of_wrath,F58CBA,1,0,15|t++83830++templars_verdict,C79C6E,2,0,15|t++64803++exorcism,F58CBA,3,0,15|t++47590++judgment,F58CBA,4,0,15|t++31627++crusader_strike,C79C6E,5,0,15|t++12404++melee,C79C6E,6,0,15&chtt=Paladin_Retribution_T14H Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,15,14,10,10,8,6,6,5,5,5,1&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,C79C6E,C79C6E,F58CBA,F58CBA,C79C6E,F58CBA,C79C6E,F58CBA,F58CBA,F58CBA&chl=hand_of_light|hammer_of_wrath|templars_verdict|melee|censure|exorcism|crusader_strike|judgment|guardian_of_ancient_kings: melee|execution_sentence|seal_of_truth_proc|ancient_fury&chtt=Paladin_Retribution_T14H Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:gkoosvwwxyyz1357787764200xusrpnlljigeecbZYXWVUTRRRRRQQPOOOOOOPPPQQRRSSSSSTTTUUUUTTTTSRRQPPPQQRRSSTTUUWWXWXYZaabbbbaaaZZZZYYYYYYYYYYXWWWWVVWVVVUUTTTSRQQQQQQQQQQQQPPPPPPQQQPPPPPOPOONNNOOOPQRRSTVVWWXYZabcddeeeeedddccccbbaZYYYXWWWVVUUTTSSRQRQPQPPPPPPQQQRRRSSSSSSTTSTTTSSSRRQQQPPPOOOOOOQQQQRSTTUVVWXXYaabbddefgghjklmopppppqpqqqpponomkihfcbaaZZYYXWWWWVUUUUUUUVVVVVVVVUVVUU&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=116258|max=285230&chxp=1,1,41,100&chtt=Paladin_Retribution_T14H DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,4,7,7,18,39,53,70,124,174,211,271,323,397,429,500,595,635,646,666,683,667,581,534,471,400,351,277,213,176,137,99,66,53,40,31,23,7,3,3,5,2,1,0,1,0,1,0,0,1&chds=0,683&chbh=5&chxt=x&chxl=0:|min=108860|avg=116258|max=127538&chxp=0,1,40,100&chtt=Paladin_Retribution_T14H DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.6,18.7,18.4,13.8,12.9,3.9,2.0,6.2&chds=0,100&chdls=ffffff&chco=C79C6E,F58CBA,C79C6E,F58CBA,F58CBA,F58CBA,F58CBA,ffffff&chl=crusader_strike 82.7s|hammer_of_wrath 68.5s|templars_verdict 67.4s|judgment 50.7s|exorcism 47.1s|inquisition 14.4s|execution_sentence 7.3s|waiting 22.6s&chtt=Paladin_Retribution_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Paladin_Retribution_T14H 116258
ancient_fury 616 0.5% 2.0 300.85sec 112772 0 92928 191249 112772 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ancient_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 225543.50 225543.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.60 79.82% 92927.50 67595 107755 89090.22 0 107755 148344 148344 0.00
crit 0.40 20.18% 191248.74 150360 221974 69301.31 0 221974 77200 77200 0.00
DPS Timeline Chart

Action details: ancient_fury

Static Values
  • id:86704
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86704
  • name:Ancient Fury
  • school:holy
  • tooltip:(null)
  • description:Unleash the fury of ancient kings, causing $s1 Holy damage per application of Ancient Power, divided evenly among all targets within $a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.107000
  • base_dd_min:229.65
  • base_dd_max:310.71
avenging_wrath 0 0.0% 4.0 95.65sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: avenging_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: avenging_wrath

Static Values
  • id:31884
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:95.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.inquisition.up
Spelldata
  • id:31884
  • name:Avenging Wrath
  • school:holy
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
censure 10623 9.1% 252.8 1.44sec 15382 0 0 0 0 0.0% 0.0% 0.0% 0.0% 163.6 19257 39902 23761 21.8% 0.0% 99.3%

Stats details: censure

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 252.76 252.76 163.63 163.63 0.0000 2.2218 3887989.45 3887989.45 0.00 10694.22 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 252.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.9 78.19% 19257.23 5720 33965 19257.07 18384 20284 2463723 2463723 0.00
crit 35.7 21.81% 39902.03 11784 69968 39900.63 34734 47186 1424266 1424266 0.00
DPS Timeline Chart

Action details: censure

Static Values
  • id:31803
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31803
  • name:Censure
  • school:holy
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:107.34
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
crusader_strike 7142 6.1% 67.3 5.45sec 38860 31627 31546 65028 38860 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: crusader_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.27 67.27 0.00 0.00 1.2287 0.0000 2614095.07 2614095.07 0.00 31626.58 31626.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.57 78.14% 31545.61 28773 45511 31543.01 30151 32863 1658224 1658224 0.00
crit 14.70 21.85% 65027.98 59272 93752 65022.23 59930 73928 955871 955871 0.00
dodge 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: crusader_strike

Static Values
  • id:35395
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:3.79
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:35395
  • name:Crusader Strike
  • school:physical
  • tooltip:(null)
  • description:$?s85673[An instant strike that causes $m2% weapon damage plus $m1 and grants a charge of Holy Power.][An instant strike that causes $m2% weapon damage plus $m1.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:632.63
  • base_dd_max:632.63
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
execution_sentence 5735 4.9% 6.0 61.16sec 349836 287064 0 0 0 0.0% 0.0% 0.0% 0.0% 60.0 28784 59062 34984 20.5% 0.0% 16.4%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 60.00 60.00 1.2187 1.0000 2099013.39 2099013.39 0.00 31183.35 287064.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.7 79.53% 28784.35 8396 193728 28786.36 17893 36538 1373454 1373454 0.00
crit 12.3 20.47% 59062.00 17296 399080 59098.09 23842 185307 725560 725560 0.00
DPS Timeline Chart

Action details: execution_sentence

Static Values
  • id:114157
  • school:holy
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up
Spelldata
  • id:114157
  • name:Execution Sentence
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc114916 |CFFFFFFFFStay of Execution|R If used on friendly targets, the falling hammer heals the target for ${$SPH*$114917m2/1000+26.72716306*$114917m1} healing over $114917d. This healing is dealt slowly at first and increases over time, culminating in a final burst of healing.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.222096
  • base_td:486.46
  • num_ticks:10
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
exorcism 8344 7.2% 40.2 9.15sec 75959 64803 62502 129719 75959 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: exorcism

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.20 40.20 0.00 0.00 1.1721 0.0000 3053786.43 3053786.43 0.00 64803.21 64803.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.15 79.98% 62502.18 39991 106725 62499.71 56909 69377 2009724 2009724 0.00
crit 8.05 20.02% 129719.46 82382 219853 129764.22 82382 219853 1044063 1044063 0.00
DPS Timeline Chart

Action details: exorcism

Static Values
  • id:879
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:12.65
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:879
  • name:Exorcism
  • school:holy
  • tooltip:(null)
  • description:Forcefully attempt to expel the evil from the target with a blast of Holy Light. Causes $s1 Holy damage and generates a charge of Holy Power.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.677000
  • base_dd_min:6577.24
  • base_dd_max:7342.84
guardian_of_ancient_kings 0 0.0% 2.0 300.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: guardian_of_ancient_kings

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: guardian_of_ancient_kings

Static Values
  • id:86698
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.inquisition.up&buff.avenging_wrath.up
Spelldata
  • id:86698
  • name:Guardian of Ancient Kings
  • school:holy
  • tooltip:Protected by a Guardian of Ancient Kings. Attacks by you and your Guardian infuse you with Ancient Power and unleash Ancient Fury when your Guardian departs.
  • description:Summons a Guardian of Ancient Kings to help you deal damage for $d. The Guardian of Ancient Kings will attack your current enemy. Both your attacks and the attacks of the Guardian will infuse you with Ancient Power that is unleashed as Ancient Fury when the Guardian departs.
hammer_of_wrath 16550 14.2% 57.0 6.37sec 106175 88404 85991 177154 106177 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hammer_of_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.05 57.05 0.00 0.00 1.2010 0.0000 6057209.47 6057209.47 0.00 88404.48 88404.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.42 77.86% 85990.85 44873 127994 85993.73 79406 92763 3819393 3819393 0.00
crit 12.63 22.14% 177153.86 92439 263668 177187.72 140433 226112 2237817 2237817 0.00
DPS Timeline Chart

Action details: hammer_of_wrath

Static Values
  • id:24275
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1800.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:24275
  • name:Hammer of Wrath
  • school:holy
  • tooltip:(null)
  • description:Hurls a magical hammer that strikes an enemy for $s1 Holy damage$?s53503[ and generates a charge of Holy Power][]. Only usable on enemies that have 20% or less health$?s53503[ or during Avenging Wrath][].
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1746.58
  • base_dd_max:1930.43
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
hand_of_light 22882 19.7% 179.6 2.03sec 46618 0 46618 0 46618 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.65 179.65 0.00 0.00 0.0000 0.0000 8374935.57 8374935.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.65 100.00% 46618.49 12956 154338 46620.59 42197 52495 8374936 8374936 0.00
DPS Timeline Chart

Action details: hand_of_light

Static Values
  • id:0
  • school:holy
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:149933.02
  • base_dd_max:149933.02
inquisition 0 0.0% 12.2 30.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inquisition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.21 12.21 0.00 0.00 1.1800 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inquisition

Static Values
  • id:84963
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
Spelldata
  • id:84963
  • name:Inquisition
  • school:holy
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
judgment 6587 5.7% 41.1 8.94sec 58702 47590 47644 98715 58702 21.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.07 41.07 0.00 0.00 1.2335 0.0000 2410813.71 2410813.71 0.00 47589.99 47589.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.18 78.35% 47644.39 32635 113049 47630.88 43548 51947 1533066 1533066 0.00
crit 8.89 21.65% 98714.73 67229 232881 98701.98 85224 160139 877747 877747 0.00
DPS Timeline Chart

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:5.06
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:(null)
  • description:A magic attack that unleashes the energy of a Seal to cause $s1 Holy damage$?s105424[ and generates one charge of Holy Power.]?s111529[, generate one charge of Holy Power, and apply the Physical Vulnerability debuff to a target. |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.][.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:623.49
  • base_dd_max:623.49
melee 11208 9.6% 130.2 2.80sec 31514 12404 26875 55415 31514 21.9% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.17 130.17 0.00 0.00 2.5407 0.0000 4102139.77 4102139.77 0.00 12403.81 12403.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 70.49 54.16% 26875.15 23292 37536 26874.70 25569 28157 1894563 1894563 0.00
crit 28.50 21.89% 55414.75 47981 77324 55413.60 50735 61755 1579304 1579304 0.00
glance 31.16 23.94% 20160.10 17469 28152 20161.61 18545 22287 628273 628273 0.00
dodge 0.01 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
seal_of_truth_proc 5213 4.5% 252.8 1.44sec 7548 0 6120 12639 7548 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: seal_of_truth_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 252.76 252.76 0.00 0.00 0.0000 0.0000 1907856.29 1907856.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.40 78.10% 6120.26 4155 8705 6120.25 5954 6261 1208124 1208124 0.00
crit 55.36 21.90% 12639.39 8560 17932 12639.25 11915 13551 699732 699732 0.00
DPS Timeline Chart

Action details: seal_of_truth_proc

Static Values
  • id:31801
  • school:holy
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:9839.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:31801
  • name:Seal of Truth
  • school:holy
  • tooltip:Melee attacks cause Holy damage over $31803d.
  • description:Fills you with Holy Light, causing melee attacks to deal $42463s1% additional Holy damage and apply Censure to the target. Replaces Seal of Command. |CFFFFFFFFCensure|R $@spelldesc31803
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.12
templars_verdict 15441 13.3% 55.3 6.47sec 102128 83830 82811 170602 102128 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.34 55.34 0.00 0.00 1.2183 0.0000 5651492.46 5651492.46 0.00 83830.14 83830.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.16 77.99% 82811.29 72783 115128 82811.86 79090 86745 3573826 3573826 0.00
crit 12.18 22.01% 170601.60 149933 237163 170598.16 149933 206121 2077667 2077667 0.00
dodge 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: templars_verdict

Static Values
  • id:85256
  • school:physical
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power=5
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:physical
  • tooltip:(null)
  • description:A powerful weapon strike that consumes 3 charges of Holy Power to deal $s1% weapon damage plus $s2.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:628.06
  • base_dd_max:628.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.75
pet - guardian_of_ancient_kings 36092 / 5917
melee 36092 5.1% 48.5 6.95sec 44653 35471 47495 0 44653 0.0% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.50 48.50 0.00 0.00 1.2589 0.0000 2165534.16 2165534.16 0.00 35470.90 35470.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.89 76.07% 47495.26 33219 57828 47496.04 44215 50774 1752074 1752074 0.00
glance 11.61 23.93% 35620.24 24914 43371 35625.34 30681 41316 413460 413460 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ancient_power 2.0 242.9 300.9sec 1.4sec 16.39% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_ancient_power
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • ancient_power_1:0.1%
  • ancient_power_2:0.0%
  • ancient_power_3:0.2%
  • ancient_power_4:0.3%
  • ancient_power_5:0.1%
  • ancient_power_6:0.1%
  • ancient_power_7:0.3%
  • ancient_power_8:0.1%
  • ancient_power_9:0.0%
  • ancient_power_10:0.1%
  • ancient_power_11:0.2%
  • ancient_power_12:0.1%
  • ancient_power_13:0.1%
  • ancient_power_14:0.2%
  • ancient_power_15:0.2%
  • ancient_power_16:0.1%
  • ancient_power_17:0.2%
  • ancient_power_18:0.3%
  • ancient_power_19:0.1%
  • ancient_power_20:13.5%

Spelldata details

  • id:86700
  • name:Ancient Power
  • tooltip:Strength increased by $s1%. When Guardian of Ancient Kings departs, the Paladin releases Ancient Fury, causing Holy damage split among all enemies within $86704a1 yards.
  • description:Strength increased by $s1%. When your Guardian of Ancient Kings departs, you release Ancient Fury, causing $86704s1 Holy damage, split among all enemies within $86704a1 yards.
  • max_stacks:20
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
avenging_wrath 4.0 0.0 95.7sec 95.7sec 32.79% 39.04%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_avenging_wrath
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • avenging_wrath_1:32.8%

Spelldata details

  • id:31884
  • name:Avenging Wrath
  • tooltip:All damage and healing caused increased by $s1%.$?$w4>0[ Your falling speed is slowed.][]
  • description:Increases all damage and healing caused by $s1% for $d. $?s54927|s115931[ While Avenging Wrath is active, ][]$?s54927[you heal for $115547s1% of your maximum health every $115547t sec][]$?s54927&s115931[ and ][]$?s115931[your falling speed is slowed][]$?s54927|s115931[.][]
  • max_stacks:
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.03%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 10.7 10.2 33.9sec 16.8sec 49.71% 49.29%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:49.7%
darkmist_vortex 5.9 0.0 67.2sec 67.2sec 31.59% 31.59%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:31.6%
glyph_double_jeopardy 7.0 34.1 57.9sec 8.9sec 72.45% 100.00%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_glyph_double_jeopardy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • glyph_double_jeopardy_1:72.4%

Spelldata details

  • id:54922
  • name:Glyph of Double Jeopardy
  • tooltip:(null)
  • description:Judging a target increases the damage of your next Judgment by $121027s1%, but only if used on a different second target.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inquisition 4.4 7.8 72.9sec 30.4sec 97.43% 99.13%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_inquisition
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inquisition_1:97.4%

Spelldata details

  • id:84963
  • name:Inquisition
  • tooltip:Increases Holy damage done by $w1%. Increases critical strike chance by $w3%.
  • description:Consumes up to 3 Holy Power to increase your Holy Damage by $s1% and critical strike chance by $s3%. Lasts $d per charge of Holy Power consumed.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 305.9sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
relic_of_xuen 7.8 0.0 50.1sec 50.1sec 31.12% 31.12%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:31.1%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.0 0.0 61.2sec 61.2sec 16.39% 16.39%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.4%
guardian_of_ancient_kings-stunned 1.0 0.0 0.0sec 0.0sec 1.67% 1.67%

Buff details

  • buff initial source:Paladin_Retribution_T14H_guardian_of_ancient_kings
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Paladin_Retribution_T14H
crusader_strike Mana 67.3 121085.1 1800.0 1800.0 21.6
exorcism Mana 40.2 96487.4 2400.0 2400.0 31.6
hammer_of_wrath Mana 57.0 102689.0 1800.0 1800.0 59.0
inquisition Holy Power 12.2 36.6 3.0 3.0 0.0
judgment Mana 41.1 145384.4 3540.0 3540.0 16.6
templars_verdict Holy Power 55.3 166.0 3.0 3.0 34042.8
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 72508.09 49.56 37216.91 33.92%
sword_of_light Mana 182.00 391129.51 2149.06 264070.49 40.30%
holy_power_crusader_strike Holy Power 67.27 67.27 1.00 0.00 0.00%
holy_power_exorcism Holy Power 40.20 40.20 1.00 0.00 0.00%
holy_power_hammer_of_wrath Holy Power 57.05 57.05 1.00 0.00 0.00%
holy_power_judgments_of_the_bold Holy Power 41.07 41.07 1.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 1266.77 1272.26
Holy Power 0.56 0.55
Combat End Resource Mean Min Max
Health -6346468.00 -6346468.00 -6346468.00
Mana 58009.10 55035.00 60000.00
Holy Power 2.96 0.00 5.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 27.3%
guardian_of_ancient_kings-Mana Cap 27.3%

Procs

Count Interval
hat_donor 60.7 5.9sec
the_art_of_war 26.1 13.6sec
wasted_art_of_war 2.4 94.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 116257.95
Minimum 108860.23
Maximum 127538.12
Spread ( max - min ) 18677.89
Range [ ( max - min ) / 2 * 100% ] 8.03%
Standard Deviation 2236.6749
5th Percentile 112602.81
95th Percentile 120005.04
( 95th Percentile - 5th Percentile ) 7402.22
Mean Distribution
Standard Deviation 22.3712
95.00% Confidence Intervall ( 116214.10 - 116301.80 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1421
0.1 Scale Factor Error with Delta=300 42706
0.05 Scale Factor Error with Delta=300 170824
0.01 Scale Factor Error with Delta=300 4270604
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 116257.95

Damage

Sample Data
Count 9996
Mean 40384875.10

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 335.61
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 blessing_of_kings,if=!aura.str_agi_int.up
3 0.00 blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
4 0.00 seal_of_truth
5 0.00 snapshot_stats
6 0.00 mogu_power_potion
Default action list
# count action,conditions
7 0.00 rebuke
8 0.00 seal_of_truth,if=mana.pct>=90|seal.none
9 0.00 seal_of_insight,if=mana.pct<=20
A 1.00 mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
B 15.00 auto_attack
C 12.21 inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
D 2.00 guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
E 4.00 avenging_wrath,if=buff.inquisition.up
F 6.00 use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
G 6.00 execution_sentence,if=buff.inquisition.up
H 32.56 templars_verdict,if=holy_power=5
I 57.05 hammer_of_wrath
J 28.47 wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
K 40.20 exorcism
L 67.27 crusader_strike
M 41.07 judgment
N 22.78 templars_verdict,if=holy_power>=3

Sample Sequence

BKLMCEDFGILIMIHIKIHILIHILIHIKIHILICIKLHKLKHLMNLBMLNKKLMHLBNMLKCFGLMLNMLKNLMLNMLKNLBMLCMKLNEILJIMJIHJIKJIHIBLJIHJIKJICJILFGIHJKLMHBKLNKMLNLKMNLKCMLLMNLKMNLMNBLMKLNMBLNMLKCFGLMLEIMHIKJIHJILJIHJILJIHKCILJIMJIHJIBLKBHLMNLMLKHLMNLMCFGKLMNLMLNKLMNLBKMLNMLCMKLBNMLEILJIHJIKJIHILJIHDAJIKCIFGJILJBIHJILJIHJIKLHJILMHILMCJIKLBHJIMLHIMKHILMHILBMHIKL

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20774 18420 17360
Agility 190 181 80
Stamina 22671 20610 20440
Intellect 200 190 80
Spirit 205 205 80
Health 463797 434943 0
Mana 60000 60000 0
Holy Power 5 5 0
Spell Power 22988 18545 0
Spell Hit 15.16% 15.16% 2607
Spell Crit 13.45% 8.45% 3020
Spell Haste 24.50% 18.57% 7893
Mana Per 5 1500 1500 0
Attack Power 45978 37090 0
Melee Hit 7.67% 7.67% 2607
Melee Crit 15.05% 10.05% 3020
Melee Haste 18.57% 18.57% 7893
Swing Speed 30.43% 18.57% 7893
Expertise 7.49% 7.49% 2548
Armor 34302 34302 34302
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.37% 9.74% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 42.88% 32.38% 4453

Gear

Average Item Level: 507.73
Head white_tiger_helmet,id=87101,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
Neck shackle_of_eversparks,id=90508,reforge=hit_haste
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=crit_haste
Shirt empty
Chest white_tiger_battleplate,id=87099,gems=320haste_320haste_120crit,enchant=80all,reforge=crit_mastery
Waist waistplate_of_overwhelming_assault,id=86955,gems=320haste_80str_160hit_80str_160haste_120haste,reforge=mastery_exp
Legs white_tiger_legplates,id=87102,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
Feet impaling_treads,id=86979,gems=320haste_60hit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=320haste,enchant=180str,reforge=hit_haste
Hands white_tiger_gauntlets,id=87100,gems=320haste,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
Finger1 dread_shadow_ring,id=87158,reforge=hit_haste
Finger2 ring_of_the_bladed_tempest,id=86957
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel,reforge=crit_haste
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Speed of Light Long Arm of the Law Pursuit of Justice
30 Fist of Justice Repentance Burden of Guilt
45 Selfless Healer Eternal Flame Sacred Shield
60 Hand of Purity Unbreakable Spirit Clemency
75 Holy Avenger Sanctified Wrath Divine Purpose
90 Holy Prism Light's Hammer Execution Sentence

Profile

#!./simc

paladin="Paladin_Retribution_T14H"
origin="unknown"
level=90
race=tauren
spec=retribution
role=hybrid
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#bb!110112
glyphs=templars_verdict/double_jeopardy/mass_exorcism

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/blessing_of_kings,if=!aura.str_agi_int.up
actions.precombat+=/blessing_of_might,if=!aura.mastery.up&!aura.str_agi_int.up
actions.precombat+=/seal_of_truth
actions.precombat+=/snapshot_stats
actions.precombat+=/mogu_power_potion

actions=rebuke
actions+=/seal_of_truth,if=mana.pct>=90|seal.none
actions+=/seal_of_insight,if=mana.pct<=20
actions+=/mogu_power_potion,if=(buff.bloodlust.react|(buff.ancient_power.up&buff.avenging_wrath.up)|target.time_to_die<=40)
actions+=/auto_attack
actions+=/inquisition,if=(buff.inquisition.down|buff.inquisition.remains<=2)&(holy_power>=3)
actions+=/guardian_of_ancient_kings,if=buff.inquisition.up&buff.avenging_wrath.up
actions+=/avenging_wrath,if=buff.inquisition.up
actions+=/use_item,name=white_tiger_gauntlets,if=buff.inquisition.up
actions+=/execution_sentence,if=buff.inquisition.up
actions+=/templars_verdict,if=holy_power=5
actions+=/hammer_of_wrath
actions+=/wait,sec=cooldown.hammer_of_wrath.remains,if=cooldown.hammer_of_wrath.remains>0&cooldown.hammer_of_wrath.remains<=0.2
actions+=/exorcism
actions+=/crusader_strike
actions+=/judgment
actions+=/templars_verdict,if=holy_power>=3

head=white_tiger_helmet,id=87101,gems=reverberating_primal_80str_160hit_180str,reforge=hit_haste
neck=shackle_of_eversparks,id=90508,reforge=hit_haste
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160haste_60str,enchant=200str_100crit,reforge=crit_haste
back=hiseks_chrysanthemum_cape,id=86945,enchant=180crit,reforge=hit_mastery
chest=white_tiger_battleplate,id=87099,gems=320haste_320haste_120crit,enchant=80all,reforge=crit_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=320haste,enchant=180str,reforge=hit_haste
hands=white_tiger_gauntlets,id=87100,gems=320haste,enchant=170str,addon=synapse_springs_mark_ii,reforge=crit_haste
waist=waistplate_of_overwhelming_assault,id=86955,gems=320haste_80str_160hit_80str_160haste_120haste,reforge=mastery_exp
legs=white_tiger_legplates,id=87102,gems=80str_160haste_60str,enchant=285str_165crit,reforge=mastery_haste
feet=impaling_treads,id=86979,gems=320haste_60hit,enchant=140mastery
finger1=dread_shadow_ring,id=87158,reforge=hit_haste
finger2=ring_of_the_bladed_tempest,id=86957
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel,reforge=crit_haste

# Gear Summary
# gear_strength=17360
# gear_agility=80
# gear_stamina=20440
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2548
# gear_hit_rating=2607
# gear_crit_rating=3020
# gear_haste_rating=7893
# gear_mastery_rating=4453
# gear_armor=34302
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=white_tiger_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Priest_Disc_T14H : 69548 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
16475.8 16475.8 23.63 / 0.14% 1990 / 12.1% 2.1 69548.2 69548.2 32.65 / 0.05% 2757 / 4.0% 12.5 5561.7 4927.1 Mana 15.72% 31.5 100.0%
Origin http://mop.chardev.org/profile/383-Priest_Disc_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
Glyphs
  • power_word_shield
  • prayer_of_mending
  • renew

Charts

http://2.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:130359|92061|82300|75393&chds=0,260717&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++130359++power_word_shield,F58CBA,0,0,15|t++92061++greater_heal,F58CBA,1,0,15|t++82300++renew,F58CBA,2,0,15|t++75393++penance_heal,F58CBA,3,0,15&chtt=Priest_Disc_T14H Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:46,27,14,10,3&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=greater_heal|penance_heal|power_word_shield|renew|power_word_shield_glyph&chtt=Priest_Disc_T14H Healing Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:0w1y1yywzxzz558023402z3z4z01213z101yzyxttssssnppnlkjkkgehhjikomollnmnprpqqqppoonnmjjklljnljijhhfgfedcccbaXXXXUWWYYZZbbeeghjjllmlmmnnnmmlmkkjihgfecddecbaaZZYYXXXXWWVVVWWXXXXYYabcdefhiklnnppqppqrqqoonmkkhheecbZZYXXWVVUTSSRRRSSTTUUVWYYZaccefghjkklmlnnoopoppooooonnlkkjhhgfedbaZYXWUUTTSTTTTUUVVWXYZbbdeggiikklkkkllmlmmmmmllllllkkijjkihgfcbbaYXWVVUTTTTTUUUTUWZaaabbcdeefg&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=16476|max=123717&chxp=1,1,13,100&chtt=Priest_Disc_T14H DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,2,3,5,17,18,33,56,65,110,131,172,220,286,368,442,477,468,590,629,663,689,613,651,553,568,441,387,328,256,202,171,117,83,60,44,30,15,15,7,4,2,2,0,1,0,0,1&chds=0,689&chbh=5&chxt=x&chxl=0:|min=63103|avg=69548|max=76913&chxp=0,1,47,100&chtt=Priest_Disc_T14H HPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:34.5,25.2,9.0,8.5,2.2,15.7&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,9482C9,ffffff&chl=greater_heal 126.3s|penance_heal 92.4s|power_word_shield 33.0s|renew 31.1s|mindbender 7.9s|waiting 57.5s&chtt=Priest_Disc_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Disc_T14H 16476
berserking 0 0.0% 3.0 181.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
divine_aegis 11461 69.6% 0.0 1.#Rsec 0 0 33460 0 33460 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 125.36 0.00 0.00 0.0000 0.0000 4194741.38 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.36 100.00% 33460.38 0 59609 33438.70 27269 38927 4194741 0 0.00
DPS Timeline Chart
greater_heal 31760 45.7% 62.6 5.84sec 185816 92061 137808 275344 185816 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 62.56 62.56 0.00 0.00 2.0184 0.0000 11624129.55 11624129.55 0.00 92061.38 92061.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.72 65.09% 137808.05 136103 142682 137808.75 136402 139199 5611680 5611680 0.00
crit 21.84 34.91% 275344.04 272205 285364 275335.45 272205 279333 6012449 6012449 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.inner_focus.up
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
greater_heal_divine_aegis 0 0.0% 21.8 16.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 21.84 21.84 0.00 0.00 0.0000 0.0000 0.00 2791664.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.84 100.00% 0.00 0 0 0.00 0 0 0 2791664 100.00
HPS Timeline Chart

Action details: greater_heal_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:81661.57
  • base_dd_max:81661.57
inner_focus 0 0.0% 12.8 30.68sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: inner_focus

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.84 12.84 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: inner_focus

Static Values
  • id:89485
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:89485
  • name:Inner Focus
  • school:physical
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
mindbender 0 0.0% 6.0 60.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 1.3212 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=20
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:(null)
  • description:Creates a Mindbender to attack the target. Caster receives ${$123051m1/3}.1% mana when the Mindbender attacks. Lasts $d. Replaces Shadowfiend.
penance_heal 19027 27.4% 51.4 7.15sec 135473 75393 0 0 0 0.0% 0.0% 0.0% 0.0% 148.2 39730 79493 47058 18.4% 0.0% 21.7%

Stats details: penance_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 51.40 51.40 148.20 147.99 1.7969 0.5354 6963881.08 6963881.08 0.00 75392.79 75392.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.7 81.57% 39729.85 30374 41394 39729.74 39510 40005 4795949 4795949 0.00
crit 27.3 18.43% 79492.95 60748 82788 79491.76 77255 81261 2167932 2167932 0.00
HPS Timeline Chart

Action details: penance_heal

Static Values
  • id:47540
  • school:holy
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9300.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.grace.down
Spelldata
  • id:47540
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:Launches a volley of holy light at the target, causing $47666s1 Holy damage to an enemy, or healing to an ally instantly and every $47758t2 sec for $47758d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:2
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Action details: penance_heal_tick

Static Values
  • id:47666
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47666
  • name:Penance
  • school:holy
  • tooltip:(null)
  • description:$@spelldesc47540
Direct Damage
  • may_crit:true
  • direct_power_mod:0.635000
  • base_dd_min:6202.59
  • base_dd_max:7008.46
penance_heal_tick_divine_aegis 0 0.0% 27.3 12.95sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: penance_heal_tick_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 27.27 27.27 0.00 0.00 0.0000 0.0000 0.00 1006607.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.27 100.00% 0.00 0 0 0.00 0 0 0 1006608 100.00
HPS Timeline Chart

Action details: penance_heal_tick_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:23691.64
  • base_dd_max:23691.64
power_word_shield 9495 (11765) 13.7% (16.9%) 26.3 14.36sec 163571 130359 33282 0 33282 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 26.33 104.41 0.00 0.00 1.2548 0.0000 3475043.48 3508816.68 0.96 130358.57 130358.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.41 100.00% 33282.39 0 59609 33282.09 32771 33749 3475043 3508817 0.96
HPS Timeline Chart

Action details: power_word_shield

Static Values
  • id:17
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:18300.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!cooldown.rapture.remains
Spelldata
  • id:17
  • name:Power Word: Shield
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
Direct Damage
  • may_crit:false
  • direct_power_mod:1.870900
  • base_dd_min:19428.31
  • base_dd_max:19428.31
power_word_shield_glyph 2271 3.3% 26.3 14.36sec 31570 0 26655 53333 31570 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 26.33 26.33 0.00 0.00 0.0000 0.0000 831091.29 831091.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.48 81.58% 26654.84 26371 27646 26654.83 26371 26929 572436 572436 0.00
crit 4.85 18.42% 53332.65 52742 55292 53064.35 0 55292 258655 258655 0.00
HPS Timeline Chart

Action details: power_word_shield_glyph

Static Values
  • id:55672
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:55672
  • name:Glyph of Power Word: Shield
  • school:physical
  • tooltip:(null)
  • description:$55672s1% of the absorb from your Power Word: Shield spell is converted into healing.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:26371.06
  • base_dd_max:26371.06
power_word_shield_glyph_divine_aegis 0 0.0% 4.8 62.11sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_word_shield_glyph_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 4.85 4.85 0.00 0.00 0.0000 0.0000 0.00 120099.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.85 100.00% 0.00 0 0 0.00 0 0 0 120100 100.00
HPS Timeline Chart

Action details: power_word_shield_glyph_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:15822.60
  • base_dd_max:15822.60
renew 6996 10.1% 24.7 15.02sec 103759 82300 0 0 0 0.0% 0.0% 0.0% 0.0% 99.8 21659 43338 25645 18.4% 0.0% 66.1%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 24.68 24.68 99.84 99.84 1.2608 2.4234 2560509.74 2560509.74 0.00 9376.82 82299.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.5 81.61% 21658.76 21412 22447 21659.09 21450 21844 1764821 1764821 0.00
crit 18.4 18.39% 43337.84 42824 44894 43338.18 42824 44377 795689 795689 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!dot.renew.ticking&mana>20000
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
renew_divine_aegis 0 0.0% 18.4 18.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: renew_divine_aegis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 18.36 18.36 0.00 0.00 0.0000 0.0000 0.00 369441.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.36 100.00% 0.00 0 0 0.00 0 0 0 369442 100.00
HPS Timeline Chart

Action details: renew_divine_aegis

Static Values
  • id:47753
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:47753
  • name:Divine Aegis
  • school:holy
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:12847.25
  • base_dd_max:12847.25
pet - mindbender 21291 / 5015
melee 21291 30.4% 64.9 4.91sec 28300 24019 29965 59991 28300 15.4% 15.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.85 64.85 0.00 0.00 1.1782 0.0000 1835403.95 1835403.95 0.00 24019.21 24019.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.51 45.51% 29964.65 26088 31773 29965.47 28640 31542 884368 884368 0.00
crit 10.02 15.45% 59990.98 52175 63547 59988.82 53717 63547 600936 600936 0.00
glance 15.57 24.01% 22478.72 19566 23830 22478.79 20999 23830 350100 350100 0.00
dodge 4.89 7.54% 0.00 0 0 0.00 0 0 0 0 0.00
miss 4.86 7.49% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.667000
  • base_dd_min:1398.75
  • base_dd_max:1398.75
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 17.3 19.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.34 17.34 0.00 0.00 1.2976 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 17.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.3sec 181.4sec 6.40% 9.99%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.4%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 9.28%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
inner_focus 12.8 0.0 29.8sec 30.7sec 11.84% 20.23%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_inner_focus
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_focus_1:11.8%

Spelldata details

  • id:89485
  • name:Inner Focus
  • tooltip:Mana cost of your next Flash Heal, Greater Heal or Prayer of Healing reduced by $s1% and critical effect chance increased by $s2%.
  • description:Reduces the mana cost of your next Flash Heal, Greater Heal or Prayer of Healing by $s1% and increases its critical effect chance by $s2%.
  • max_stacks:
  • duration:-0.00
  • cooldown:45.00
  • default_chance:0.00%
jade_spirit 6.5 0.0 59.5sec 59.5sec 20.90% 21.91%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:20.9%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
mindbender-shadowcrawl 17.3 0.0 19.0sec 19.0sec 84.89% 86.13%

Buff details

  • buff initial source:Priest_Disc_T14H_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:20.0%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 4.1 0.0 96.9sec 0.0sec 4.76% 4.76%

Buff details

  • buff initial source:Priest_Disc_T14H_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.1%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Disc_T14H
greater_heal Mana 62.6 883282.4 14119.6 14119.6 13.2
penance_heal Mana 51.4 478060.6 9300.0 9300.0 14.6
power_word_shield Mana 26.3 481760.9 18300.0 18300.0 8.9
renew Mana 24.7 192483.5 7800.0 7800.0 13.3
Resource Gains Type Count Total Average Overflow
mana_potion Mana 1.00 30001.00 30001.00 0.00 0.00%
mp5_regen Mana 1463.00 789394.65 539.57 0.00 0.00%
mindbender Mana 55.11 661266.51 12000.00 0.00 0.00%
Rapture Mana 26.33 322652.69 12256.17 12582.00 3.75%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 4927.09 5561.71
Combat End Resource Mean Min Max
Health -6351844.00 -6351844.00 -6351844.00
Mana 67320.29 18069.73 125210.62
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 18.4 18.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 16475.81
Minimum 12397.80
Maximum 21309.30
Spread ( max - min ) 8911.50
Range [ ( max - min ) / 2 * 100% ] 27.04%
Standard Deviation 1205.6042
5th Percentile 14530.86
95th Percentile 18510.91
( 95th Percentile - 5th Percentile ) 3980.05
Mean Distribution
Standard Deviation 12.0585
95.00% Confidence Intervall ( 16452.17 - 16499.44 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 205
0.1% Error 20568
0.1 Scale Factor Error with Delta=300 12407
0.05 Scale Factor Error with Delta=300 49631
0.01 Scale Factor Error with Delta=300 1240775
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 16475.81

Damage

Sample Data
Count 9996
Mean 4194741.38

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 69548.24
Minimum 63102.90
Maximum 76913.45
Spread ( max - min ) 13810.55
Range [ ( max - min ) / 2 * 100% ] 9.93%
Standard Deviation 1665.3242
5th Percentile 66779.26
95th Percentile 72293.57
( 95th Percentile - 5th Percentile ) 5514.32
Mean Distribution
Standard Deviation 16.6566
95.00% Confidence Intervall ( 69515.59 - 69580.88 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2202
0.1 Scale Factor Error with Delta=300 23674
0.05 Scale Factor Error with Delta=300 94698
0.01 Scale Factor Error with Delta=300 2367452
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 69548.24

Heal

Sample Data
Count 9996
Mean 25454655.15

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 192.35
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=75
6 6.00 shadowfiend,if=mana.pct<=20
7 0.00 hymn_of_hope,if=pet.shadowfiend.active
8 3.00 berserking
9 12.84 inner_focus
A 0.00 power_infusion,if=talent.power_infusion.enabled
B 26.33 power_word_shield,if=!cooldown.rapture.remains
C 51.40 penance_heal,if=buff.grace.down
D 13.41 greater_heal,if=buff.inner_focus.up
E 0.00 penance_heal
F 24.68 renew,if=!dot.renew.ticking&mana>20000
G 53.69 greater_heal,if=mana>20000

Sample Sequence

89BCDFGGCBG5GFCGG9BDCFGGGBCGFGG9CBDGCFGG6BCGFGCG9BDCFGGBCGFGCBG9CDCBCFC6GCBFGCG9DBCFGGCGBCCFC9DBCC6F8CBGGCGFBG9CDFGBCGCCBCCF9D6BCGGCFGBCGG9CDBFCGGGCBCCFC69BCDFGCGBGCFGGC9BDFCGGCCBCC6FG8G9BCD

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.40% 34.90% 3577

Gear

Average Item Level: 508.13
Head guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
Neck korvens_ambersealed_beetle,id=86976,reforge=crit_haste
Shoulders guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
Shirt empty
Chest guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
Waist belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
Legs guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
Hands guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982
Finger2 watersoul_signet,id=87151
Trinket1 spirits_of_the_sun,id=87163
Trinket2 jade_courtesan_figurine,id=87081
Back drape_of_gathering_clouds,id=86961,enchant=180int
Main Hand unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Disc_T14H"
origin="http://mop.chardev.org/profile/383-Priest_Disc_T14H.html"
level=90
race=troll
spec=discipline
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xa!101022
glyphs=power_word_shield/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=75
actions+=/shadowfiend,if=mana.pct<=20
actions+=/hymn_of_hope,if=pet.shadowfiend.active
actions+=/berserking
actions+=/inner_focus
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/power_word_shield,if=!cooldown.rapture.remains
actions+=/penance_heal,if=buff.grace.down
actions+=/greater_heal,if=buff.inner_focus.up
actions+=/penance_heal
actions+=/renew,if=!dot.renew.ticking&mana>20000
actions+=/greater_heal,if=mana>20000

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Holy_T14H : 70509 hps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
2311.0 2311.0 7.55 / 0.33% 636 / 27.5% 0.0 70509.1 70509.1 55.07 / 0.08% 4602 / 6.5% 20.5 3439.2 2869.7 Mana 0.00% 36.8 100.0%
Origin http://mop.chardev.org/profile/326-Priest_Holy_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
Glyphs
  • circle_of_healing
  • prayer_of_mending
  • renew

Charts

http://1.chart.apis.google.com/chart?chs=550x150&cht=bhg&chf=bg,s,333333&chd=t:127767|92755|65914|34156&chds=0,255535&chco=F58CBA,F58CBA,F58CBA,F58CBA&chm=t++127767++greater_heal,F58CBA,0,0,15|t++92755++flash_heal,F58CBA,1,0,15|t++65914++holy_word_serenity,F58CBA,2,0,15|t++34156++heal,F58CBA,3,0,15&chtt=Priest_Holy_T14H Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:30,18,16,16,10,10&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,F58CBA&chl=heal|greater_heal|echo_of_light|renew|holy_word_serenity|flash_heal&chtt=Priest_Holy_T14H Healing Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:eiiijkkmmnnqrttvwy0012234456567777864342100zyxxusrrqponmoonmlmllkkkklllkkkkjjiiihhgggfffffffeeeededddeefddcdcccddddccdccccccccccccccbbbbbbbbbbbbabbcdcccccbccccccbbababbbbaaaaabbbbbbbcddddddccddcccbbaaZZYXXXWWWWWWWWWVVVUUUVWWWXYYYZZaabbbddefghghhhhhhiiiiiiiiiiihggggggfgffffffedcddceefdeddddddddddeeeeeeeeddcbcbcbbcbcbbbbbbbbbbccddddcbabbbcbbbbaababbbaZYabcbbbbbababb&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=2311|max=132123&chxp=1,1,2,100&chtt=Priest_Holy_T14H DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,0,1,1,2,0,0,4,9,16,10,16,22,26,37,55,74,95,98,153,196,252,291,379,465,529,593,612,687,692,712,620,652,568,512,381,322,254,197,154,117,69,43,31,16,16,7,6,2&chds=0,712&chbh=5&chxt=x&chxl=0:|min=56236|avg=70509|max=79773&chxp=0,1,61,100&chtt=Priest_Holy_T14H HPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:61.8,11.2,9.9,7.4,2.1,0.7,0.6&chds=0,100&chdls=ffffff&chco=F58CBA,F58CBA,F58CBA,F58CBA,F58CBA,9482C9,F58CBA&chl=heal 226.3s|holy_word_serenity 41.0s|greater_heal 36.3s|flash_heal 27.2s|hymn_of_hope 7.6s|shadowfiend 2.4s|renew 2.3s&chtt=Priest_Holy_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Holy_T14H 2311
berserking 0 0.0% 3.0 181.59sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
chakra 0 0.0% 12.0 31.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chakra

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.00 12.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: chakra

Static Values
  • id:81208
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:81208
  • name:Chakra: Serenity
  • school:holy
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
echo_of_light 11247 16.0% 192.2 1.90sec 21418 0 0 0 0 0.0% 0.0% 0.0% 0.0% 359.1 11463 0 11463 0.0% 0.0% 98.1%

Stats details: echo_of_light

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 192.19 192.19 359.10 359.10 0.0000 1.0000 4116366.79 4116366.79 0.00 11462.91 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 192.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 359.1 100.00% 11462.90 1934 46605 11464.01 8544 13181 4116367 4116367 0.00
HPS Timeline Chart

Action details: echo_of_light

Static Values
  • id:77489
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:77489
  • name:Echo of Light
  • school:holy
  • tooltip:Healing $w every sec.
  • description:Heals every sec for $d.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:8194.44
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
flash_heal 6889 9.8% 21.4 16.50sec 117956 92755 79358 158739 117956 48.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flash_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 21.37 21.37 0.00 0.00 1.2717 0.0000 2521259.50 2521259.50 0.00 92754.75 92754.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.98 51.38% 79358.22 78504 82299 79358.90 78504 82299 871464 871464 0.00
crit 10.39 48.62% 158738.64 157008 164597 158736.39 157008 164597 1649796 1649796 0.00
HPS Timeline Chart

Action details: flash_heal

Static Values
  • id:2061
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.surge_of_light.up
Spelldata
  • id:2061
  • name:Flash Heal
  • school:holy
  • tooltip:(null)
  • description:Heals a friendly target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.642000
  • base_dd_min:15767.86
  • base_dd_max:18324.82
greater_heal 12681 18.0% 30.2 8.20sec 153539 127767 105594 211218 153539 45.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: greater_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 30.23 30.23 0.00 0.00 1.2017 0.0000 4641403.10 4641403.10 0.00 127767.31 127767.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.51 54.61% 105594.34 104694 109756 105596.05 104694 109756 1743099 1743099 0.00
crit 13.72 45.39% 211217.58 209389 219511 211197.72 0 218386 2898304 2898304 0.00
HPS Timeline Chart

Action details: greater_heal

Static Values
  • id:2060
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:17700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.serendipity.react>=2&mana.pct>40
Spelldata
  • id:2060
  • name:Greater Heal
  • school:holy
  • tooltip:(null)
  • description:A slow casting spell that heals a single target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.190000
  • base_dd_min:21021.88
  • base_dd_max:24430.83
heal 21117 29.9% 108.5 3.35sec 71238 34156 49515 99053 71238 43.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 108.49 108.49 0.00 0.00 2.0857 0.0000 7728949.89 7728949.89 0.00 34156.12 34156.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.92 56.15% 49515.39 48973 51339 49515.54 49095 50024 3016387 3016387 0.00
crit 47.58 43.85% 99053.31 97945 102678 99053.31 98064 100575 4712563 4712563 0.00
HPS Timeline Chart

Action details: heal

Static Values
  • id:2050
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5700.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Spelldata
  • id:2050
  • name:Heal
  • school:holy
  • tooltip:(null)
  • description:Heal your target for $s1.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.024000
  • base_dd_min:9847.03
  • base_dd_max:11443.84
holy_word_serenity 7388 10.5% 32.3 11.47sec 83679 65914 62769 125566 83679 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: holy_word_serenity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 32.32 32.32 0.00 0.00 1.2695 0.0000 2704121.66 2704121.66 0.00 65914.00 65914.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.56 66.70% 62769.39 62097 65101 62769.52 62097 63599 1352996 1352996 0.00
crit 10.76 33.30% 125565.79 124193 130202 125566.95 124193 130202 1351126 1351126 0.00
HPS Timeline Chart

Action details: holy_word_serenity

Static Values
  • id:88684
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:6000.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:buff.chakra_serenity.up
Spelldata
  • id:88684
  • name:Holy Word: Serenity
  • school:holy
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.300000
  • base_dd_min:12366.55
  • base_dd_max:14517.25
renew 11186 15.9% 1.9 18.03sec 2153197 1790997 0 0 0 0.0% 0.0% 0.0% 0.0% 149.0 19147 38302 27485 43.5% 0.0% 99.3%

Stats details: renew

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.90 1.90 148.96 148.96 1.2022 2.4401 4094219.28 4094219.28 0.00 11193.61 1790997.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.1 56.47% 19147.08 18941 19857 19147.08 19039 19288 1610563 1610563 0.00
crit 64.8 43.53% 38301.59 37883 39714 38301.73 37995 38628 2483656 2483656 0.00
HPS Timeline Chart

Action details: renew

Static Values
  • id:139
  • school:holy
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:-0.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:139
  • name:Renew
  • school:holy
  • tooltip:Healing $w1 health every $t1 sec.
  • description:Heals the target for $m1 every $t1 sec for $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.259000
  • base_td:2690.48
  • num_ticks:3
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadowfiend 0 0.0% 2.0 181.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2055 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<=65
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
pet - shadowfiend 35213 / 2311
melee 35213 100.0% 20.4 9.93sec 41509 39783 44083 88224 41509 15.2% 15.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.38 20.38 0.00 0.00 1.0434 0.0000 845816.19 845816.19 0.00 39782.52 39782.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.30 45.62% 44083.47 38959 47436 44093.69 40104 47436 409765 409765 0.00
crit 3.11 15.25% 88224.04 77918 94873 85211.68 0 94873 274098 274098 0.00
glance 4.90 24.05% 33050.46 29219 35577 32927.19 0 35577 161953 161953 0.00
dodge 1.54 7.57% 0.00 0 0 0.00 0 0 0 0 0.00
miss 1.53 7.52% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 4.0 62.41sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.2110 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.3sec 181.5sec 6.38% 6.52%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.4%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 18.19%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
chakra_serenity 1.0 11.0 0.0sec 31.3sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_chakra_serenity
  • max_stacks:1
  • duration:0.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • chakra_serenity_1:100.0%

Spelldata details

  • id:81208
  • name:Chakra: Serenity
  • tooltip:Increasess the healing done by your single-target healing spells by $s1%, and causes them to refresh the duration of your Renew on the target.
  • description:Increases the healing done by your single-target healing spells by $s1%, causes them to refresh the duration of your Renew on the target, and transforms your Holy Word: Chastise spell into Holy Word: Serenity. |CFFFFFFFFHoly Word: Serenity|R Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $88684d. 15 sec cooldown.
  • max_stacks:
  • duration:-0.00
  • cooldown:30.00
  • default_chance:1.00%
hymn_of_hope 0.9 3.4 0.0sec 1.7sec 3.65% 3.65%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_hymn_of_hope
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • hymn_of_hope_1:3.6%

Spelldata details

  • id:64904
  • name:Hymn of Hope
  • tooltip:Maximum mana increased by $s2%.
  • description:Restores $64904s1% mana to $64901s2 nearby low mana friendly party or raid targets every $64901t1 sec for $64901d, and increases their total maximum mana by $64904s2% for $64904d. Maximum of $*4;s2 mana restores. The Priest must channel to maintain the spell.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_spirit 7.0 0.0 54.5sec 54.5sec 22.91% 22.62%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
serendipity 7.4 13.9 49.2sec 16.5sec 70.65% 70.65%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serendipity
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serendipity_1:22.7%
  • serendipity_2:48.0%

Spelldata details

  • id:63735
  • name:Serendipity
  • tooltip:Reduces the cast time of your next Greater Heal or Prayer of Healing by $s1% and mana cost by $s2%.
  • description:When you heal with Binding Heal or Flash Heal, the cast time of your next Greater Heal or Prayer of Healing spell is reduced by $63735s1% and mana cost reduced by $63735s2%. Stacks up to 2 times. Lasts $63735d.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.00%
serenity 32.3 0.0 11.5sec 11.5sec 52.52% 37.66%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_serenity
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • serenity_1:52.5%

Spelldata details

  • id:88684
  • name:Holy Word: Serenity
  • tooltip:Critical effect chance of heals from the Priest increased by $s2%.
  • description:Instantly heals the target for $88684s1, and increases the critical effect chance of your healing spells on the target by $88684s2% for $d.
  • max_stacks:
  • duration:6.00
  • cooldown:10.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
surge_of_light 21.4 2.5 16.4sec 14.6sec 9.80% 100.00%

Buff details

  • buff initial source:Priest_Holy_T14H
  • cooldown name:buff_surge_of_light
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_light_1:7.0%
  • surge_of_light_2:2.8%

Spelldata details

  • id:114255
  • name:Surge of Light
  • tooltip:Next Flash Heal is instant and costs no mana.
  • description:You have a $109186s1% chance when you Smite, Heal, Flash Heal, Binding Heal or Greater Heal to cause your next Flash Heal to be instant cast and have no mana cost. Limit 2 charges.
  • max_stacks:2
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
shadowfiend-shadowcrawl 4.0 0.0 62.4sec 62.4sec 83.26% 82.79%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:5.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 0.7 0.0 112.6sec 0.0sec 2.90% 2.90%

Buff details

  • buff initial source:Priest_Holy_T14H_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.2%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Holy_T14H
greater_heal Mana 30.2 431611.6 14277.9 14277.9 10.8
heal Mana 108.5 618416.9 5700.0 5700.0 12.5
holy_word_serenity Mana 32.3 193892.0 6000.0 6000.0 13.9
renew Mana 1.9 14831.4 7800.0 7800.0 276.1
Resource Gains Type Count Total Average Overflow
hymn_of_hope_max_mana Mana 0.95 42695.08 45000.00 0.00 0.00%
mana_potion Mana 1.00 29995.00 30001.00 0.00 0.00%
mp5_regen Mana 1463.00 785713.93 537.06 0.95 0.00%
shadowfiend Mana 17.30 162911.61 9415.65 0.00 0.00%
hymn_of_hope Mana 4.33 28992.26 6702.59 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 2869.69 3439.21
Combat End Resource Mean Min Max
Health -6351844.00 -6351844.00 -6351844.00
Mana 92536.15 32000.62 260917.05
Shadow Orb 0.00 0.00 0.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%
shadowfiend-Mana Cap 0.0%
lightwell-Mana Cap 0.0%

Procs

Count Interval
hat_donor 64.8 5.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 2310.97
Minimum 1026.95
Maximum 3881.25
Spread ( max - min ) 2854.30
Range [ ( max - min ) / 2 * 100% ] 61.76%
Standard Deviation 384.9933
5th Percentile 1671.32
95th Percentile 2943.66
( 95th Percentile - 5th Percentile ) 1272.33
Mean Distribution
Standard Deviation 3.8507
95.00% Confidence Intervall ( 2303.43 - 2318.52 )
Normalized 95.00% Confidence Intervall ( 99.67% - 100.33% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1066
0.1% Error 106613
0.1 Scale Factor Error with Delta=300 1265
0.05 Scale Factor Error with Delta=300 5061
0.01 Scale Factor Error with Delta=300 126528
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 2310.97

Damage

Sample Data
Count 9996
Mean 0.00

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 70509.07
Minimum 56236.28
Maximum 79773.33
Spread ( max - min ) 23537.05
Range [ ( max - min ) / 2 * 100% ] 16.69%
Standard Deviation 2809.2914
5th Percentile 65743.00
95th Percentile 74946.15
( 95th Percentile - 5th Percentile ) 9203.15
Mean Distribution
Standard Deviation 28.0985
95.00% Confidence Intervall ( 70454.00 - 70564.14 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 6098
0.1 Scale Factor Error with Delta=300 67371
0.05 Scale Factor Error with Delta=300 269486
0.01 Scale Factor Error with Delta=300 6737166
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 70509.07

Heal

Sample Data
Count 9996
Mean 25806320.21

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 224.36
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 snapshot_stats
Default action list
# count action,conditions
5 1.00 mana_potion,if=mana.pct<=50
6 2.00 shadowfiend,if=mana.pct<=65
7 1.00 hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
8 3.00 berserking
9 12.00 chakra_serenity
A 1.90 renew,if=!ticking
B 32.32 holy_word,if=buff.chakra_serenity.up
C 31.43 greater_heal,if=buff.serendipity.react>=2&mana.pct>40
D 21.37 flash_heal,if=buff.surge_of_light.up
E 118.35 heal

Sample Sequence

89ABEEEEEEBEEEEEEBEEEE9EEBEEEEEEBEEEEEBEE9EEEBEDEEEBEDC6CCBC9CCCCCCBCDEDC5CCBCCCDEE9BEEDEEBEDEEEBDEEE9EBEEEEEBEEEE8BEEE9DEEBEEEEEBEEEEEB9EDEEEBEEEEEBEDE9EEBEEEEEBD67EEBE9EEEBEEDEEBEEEEE9BEDEEEBEEDEEBEDEE9EBEEEEEBEEE8EE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22287 20261 20184
Intellect 21154 18782 17685
Spirit 8388 8388 8171
Health 458421 430057 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35151 26679 7907
Spell Hit 0.00% 0.00% 0
Spell Crit 18.26% 12.32% 2203
Spell Haste 17.39% 11.80% 5013
Mana Per 5 10734 10734 0
Attack Power 138 119 0
Melee Hit 0.00% 0.00% 0
Melee Crit 12.04% 7.03% 2203
Melee Haste 11.80% 11.80% 5013
Swing Speed 22.97% 11.80% 5013
Expertise 0.00% 0.00% 0
Armor 23771 14857 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 23.70% 17.45% 3577

Gear

Average Item Level: 508.13
Head guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
Neck korvens_ambersealed_beetle,id=86976,reforge=crit_haste
Shoulders guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
Shirt empty
Chest guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
Waist belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
Legs guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
Hands guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982
Finger2 watersoul_signet,id=87151
Trinket1 spirits_of_the_sun,id=87163
Trinket2 jade_courtesan_figurine,id=87081
Back drape_of_gathering_clouds,id=86961,enchant=180int
Main Hand unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Holy_T14H"
origin="http://mop.chardev.org/profile/326-Priest_Holy_T14H.html"
level=90
race=troll
spec=holy
role=heal
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#XZ!100022
glyphs=circle_of_healing/prayer_of_mending/renew

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/snapshot_stats

actions=mana_potion,if=mana.pct<=50
actions+=/shadowfiend,if=mana.pct<=65
actions+=/hymn_of_hope,if=pet.shadowfiend.active&mana.pct<=40
actions+=/berserking
actions+=/chakra_serenity
actions+=/renew,if=!ticking
actions+=/holy_word,if=buff.chakra_serenity.up
actions+=/greater_heal,if=buff.serendipity.react>=2&mana.pct>40
actions+=/flash_heal,if=buff.surge_of_light.up
actions+=/heal

head=guardian_serpent_cowl,id=87115,gems=burning_primal_80int_160spi_180int,reforge=mastery_haste
neck=korvens_ambersealed_beetle,id=86976,reforge=crit_haste
shoulders=guardian_serpent_mantle,id=87118,gems=80int_160spi_60int,enchant=120int_80crit
back=drape_of_gathering_clouds,id=86961,enchant=180int
chest=guardian_serpent_robes,id=87117,gems=80int_160haste_80int_160haste_120spi,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=87149,gems=160int,enchant=180int
hands=guardian_serpent_handwraps,id=87114,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_embodied_terror,id=87161,gems=80int_160haste_80int_160spi_160int_120spi
legs=guardian_serpent_legwraps,id=87116,gems=160int_60int,enchant=285int_165spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=seal_of_the_profane,id=86982
finger2=watersoul_signet,id=87151
trinket1=spirits_of_the_sun,id=87163
trinket2=jade_courtesan_figurine,id=87081
main_hand=unsoks_amber_scalpel,id=86983,gems=80int_160spi_60haste,enchant=jade_spirit
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20184
# gear_intellect=17685
# gear_spirit=8171
# gear_spell_power=7907
# gear_crit_rating=2203
# gear_haste_rating=5013
# gear_mastery_rating=3577
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_heal=1
# tier14_4pc_heal=1
# hands=guardian_serpent_handwraps,heroic=1,addon=synapse_springs_mark_ii
# main_hand=unsoks_amber_scalpel,heroic=1,weapon=dagger_1.80speed_2356min_4376max,enchant=jade_spirit

Priest_Shadow_T14H : 108006 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
108006.2 108006.2 43.44 / 0.04% 3639 / 3.4% 24.0 4299.9 4048.2 Mana 0.00% 35.6 100.0%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum

Charts

http://8.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:359369|234346|197500|128164|111932|103190|102431|52740&chds=0,718738&chco=9482C9,9482C9,9482C9,9482C9,9482C9,000066,9482C9,9482C9&chm=t++359369++devouring_plague,9482C9,0,0,15|t++234346++shadow_word_pain,9482C9,1,0,15|t++197500++vampiric_touch,9482C9,2,0,15|t++128164++halo_damage,9482C9,3,0,15|t++111932++shadow_word_death,9482C9,4,0,15|t++103190++mind_spike,000066,5,0,15|t++102431++mind_blast,9482C9,6,0,15|t++52740++mind_flay,9482C9,7,0,15&chtt=Priest_Shadow_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,10,10,9,8,6,6,5,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mind_spike|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=Priest_Shadow_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:457777775433433441ywutromkjhggfgedcbbaaabbbbcccbbbbbbbbbccccbaaZZYYYZaaabbbccccccbbbbbbbaaZZYXXWWWWWWXYYYYYYYZZZZZaaaaaZZZZYYYYYZZZZZaaaabbbbaaaaaaaaaZZYYYYYYYYYYZZZZaaaaaaaaaaaaabbcddeffggghhiiiiijiihggfeedccbbbbbbaaaZZZZZZZZZZYYYYYYXXYYXYYYYYYYYYYYZZZaaaabbbbbbbbbbbaaaaaZZYYYYYXYYYZZZZaaabbbccdeeffghhhhhhhhiiiijjjkkkkklllmnoooppoopppppooooonnnnmmlkklkkkjjjjjiiih&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=108006|max=212540&chxp=1,1,51,100&chtt=Priest_Shadow_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,0,2,3,3,7,17,12,25,49,64,88,114,164,184,293,286,346,454,533,559,554,616,642,581,612,599,544,455,428,380,315,246,202,161,139,90,79,45,31,27,12,16,7,6,1,0,1,2&chds=0,642&chbh=5&chxt=x&chxl=0:|min=99256|avg=108006|max=116707&chxp=0,1,50,100&chtt=Priest_Shadow_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:50.5,11.6,9.9,6.0,5.6,4.8,4.0,2.9,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,000066,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay 184.9s|mind_blast 42.5s|mind_spike 36.3s|vampiric_touch 22.1s|shadow_word_pain 20.6s|devouring_plague 17.6s|shadow_word_death 14.6s|halo_damage 10.5s|shadowfiend 2.1s&chtt=Priest_Shadow_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Priest_Shadow_T14H 108006
berserking 0 0.0% 3.0 181.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
devouring_plague 6114 (17250) 5.7% (16.0%) 15.0 25.84sec 420910 359369 124654 258163 149198 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.00 15.00 0.00 0.00 1.1712 0.0000 2237880.73 2237880.73 0.00 359369.12 359369.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.24 81.62% 124653.50 112133 168354 124642.33 114771 133327 1525995 1525995 0.00
crit 2.76 18.38% 258163.06 230994 346809 245342.72 0 346809 711885 711885 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2679 2.5% 39.3 9.24sec 24937 0 20856 43294 24965 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.32 39.28 0.00 0.00 0.0000 0.0000 980547.15 980547.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.08 81.68% 20855.53 18622 27958 20857.42 19329 22652 669092 669092 0.00
crit 7.19 18.32% 43294.46 38362 57592 43257.08 0 55030 311455 311455 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:$@spelldesc2944
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8456 7.8% 15.0 25.84sec 206340 0 0 0 0 0.0% 0.0% 0.0% 0.0% 125.5 20633 42766 24652 18.2% 0.0% 25.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.00 15.00 125.54 125.54 0.0000 0.7416 3094968.86 3094968.86 0.00 33239.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.7 81.84% 20632.61 18622 27958 20633.42 19830 21541 2119887 2119887 0.00
crit 22.8 18.16% 42765.97 38362 57592 42764.57 39037 47844 975082 975082 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every $t1 seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal $s4 Shadow damage and an additional $s5 Shadow damage every $t2 sec for $d. Also heals the caster for ${$m3/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo_damage 3681 3.4% 9.0 42.74sec 149715 128164 124840 258794 149725 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 1.1682 0.0000 1347388.37 1347388.37 0.00 128164.02 128164.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.33 81.42% 124840.10 113411 163133 124827.36 113411 141570 914745 914745 0.00
crit 1.67 18.58% 258793.94 233627 336055 218253.54 0 336055 432644 432644 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:14.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:(null)
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to $s1 Shadow damage to enemies, and up to $120696s2 healing to allies, with the greatest effect at 25 yds.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
mind_blast 11908 11.0% 36.8 10.01sec 118429 102431 99000 205313 118429 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.80 36.80 0.00 0.00 1.1562 0.0000 4358247.85 4358247.85 0.00 102431.32 102431.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.08 81.72% 99000.25 89948 135596 98995.28 94585 103374 2977436 2977436 0.00
crit 6.73 18.28% 205313.33 185293 279327 205098.77 0 279327 1380812 1380812 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:(null)
  • description:Blasts the target for $s1 Shadow damage and generates $s2 Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20306 (26646) 18.8% (24.7%) 110.9 3.24sec 87911 52740 0 0 0 0.0% 0.0% 0.0% 0.0% 237.5 26134 54244 31290 18.3% 0.0% 46.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 110.94 110.94 237.52 237.52 1.6669 0.7141 7431931.48 7431931.48 0.00 52739.69 52739.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 110.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 193.9 81.66% 26133.55 23869 35836 26133.49 25519 26745 5068573 5068573 0.00
crit 43.6 18.34% 54243.63 49170 73822 54242.05 51140 57888 2363358 2363358 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over $d$?s120585[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by $s2%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6340 5.9% 74.3 4.77sec 31229 0 26077 54116 31248 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.31 74.26 0.00 0.00 0.0000 0.0000 2320534.25 2320534.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.57 81.56% 26076.74 23869 35836 26076.31 24875 27473 1579341 1579341 0.00
crit 13.70 18.44% 54116.00 49170 73822 54124.08 49170 62046 741193 741193 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:$@spelldesc15407
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 10238 9.5% 31.4 11.14sec 119324 103190 99790 206892 119324 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.40 31.40 0.00 0.00 1.1563 0.0000 3747154.98 3747154.98 0.00 103190.45 103190.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.68 81.76% 99790.40 90737 137156 99788.49 93393 109632 2562185 2562185 0.00
crit 5.73 18.24% 206891.57 186918 282542 206323.82 0 269692 1184970 1184970 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&buff.surge_of_darkness.react
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:(null)
  • description:Blasts the target for $73510s1 Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4473 4.1% 12.4 5.52sec 131856 111932 109935 227625 131856 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.42 12.42 0.00 0.00 1.1780 0.0000 1637236.21 1637236.21 0.00 111932.47 111932.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.10 81.37% 109935.27 87347 131916 109947.44 101644 117248 1110801 1110801 0.00
crit 2.31 18.63% 227625.29 179935 271748 209870.33 0 271748 526435 526435 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:(null)
  • description:A word of dark binding that inflicts $s2 Shadow damage to the target$?s15407[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.$?s15407[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a $95652d cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10053 (13191) 9.3% (12.2%) 17.9 21.19sec 270038 234346 0 0 0 0.0% 0.0% 0.0% 0.0% 183.4 15391 31870 20058 28.3% 0.0% 98.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.88 17.88 183.43 183.43 1.1523 1.9611 3679263.94 3679263.94 0.00 12693.57 234345.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.5 71.68% 15391.43 13998 21012 15391.55 14870 15959 2023833 2023833 0.00
crit 51.9 28.32% 31870.28 28835 43284 31870.46 30294 33975 1655431 1655431 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every $t1 seconds.
  • description:A word of darkness that causes $s1 Shadow damage instantly, and an additional ${$o1-$m1} Shadow damage over $d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3138 2.9% 57.4 6.24sec 20017 0 15389 31846 20039 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.38 57.31 0.00 0.00 0.0000 0.0000 1148495.02 1148495.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.12 71.75% 15389.43 13998 21012 15389.39 14588 16511 632846 632846 0.00
crit 16.19 28.25% 31846.32 28835 43284 31851.33 28835 35852 515649 515649 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:$@spelldesc589
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.33sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown_react
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:(null)
  • description:Creates a shadowy fiend to attack the target. Caster receives $34650s1% mana when the Shadowfiend attacks. Lasts $d.
shadowy_apparition 3765 3.5% 61.9 5.81sec 22254 0 19197 38666 22763 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.92 60.53 0.00 0.00 0.0000 0.0000 1377935.24 1377935.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.44 81.68% 19196.67 17405 26306 19196.81 18281 20199 949148 949148 0.00
crit 11.09 18.32% 38665.90 34811 52613 38672.33 34811 46960 428787 428787 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:(null)
  • description:$@spelldesc78203
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 9063 (11900) 8.4% (11.0%) 19.1 19.28sec 227992 197500 0 0 0 0.0% 0.0% 0.0% 0.0% 160.9 17223 35751 20613 18.3% 0.0% 95.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.10 19.10 160.93 160.93 1.1544 2.1708 3317183.77 3317183.77 0.00 11726.91 197500.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.5 81.70% 17223.22 15681 23836 17222.45 16536 17806 2264589 2264589 0.00
crit 29.4 18.30% 35750.52 32302 49103 35748.21 32945 39154 1052594 1052594 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<=4&(!ticking|remains
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec., granting the Priest $s1% mana.
  • description:Causes $34914o2 Shadow damage over $34914d. Each time Vampiric Touch deals damage the caster gains $s1% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2836 2.6% 50.4 7.07sec 20613 0 17262 35793 20637 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.36 50.30 0.00 0.00 0.0000 0.0000 1038086.66 1038086.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.14 81.79% 17261.52 15681 23836 17261.29 16396 18356 710157 710157 0.00
crit 9.16 18.21% 35793.26 32302 49103 35786.55 0 44998 327929 327929 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:$@spelldesc34914
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 75493 / 4955
melee 75493 4.6% 29.8 6.70sec 60952 78475 53182 107814 60952 20.0% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.75 29.75 0.00 0.00 0.7767 0.0000 1813397.05 1813397.05 0.00 78474.86 78474.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.70 56.15% 53181.70 39622 62482 53180.51 47927 58702 888389 888389 0.00
crit 5.94 19.97% 107814.46 79243 124963 107683.35 0 124963 640502 640502 0.00
glance 7.11 23.88% 40040.11 29716 46861 40054.09 0 46861 284507 284507 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.991000
  • base_dd_min:2268.12
  • base_dd_max:2268.12
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 4.0 62.58sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.0503 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 181.2sec 181.2sec 6.11% 11.25%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.1%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 16.27%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 63.5sec 63.5sec 32.78% 32.78%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
glyph_mind_spike 22.7 8.7 15.6sec 11.2sec 33.62% 36.52%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • glyph_mind_spike_1:25.6%
  • glyph_mind_spike_2:8.1%

Spelldata details

  • id:33371
  • name:Glyph of Mind Spike
  • tooltip:(null)
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by $s1% lasting 6 sec. This effect can stack up to 2 times.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
inner_fire 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_inner_fire
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • inner_fire_1:100.0%

Spelldata details

  • id:588
  • name:Inner Fire
  • tooltip:Increases armor from items by $w1% and spell power by $s2%.
  • description:A burst of Holy energy fills the caster, increasing the armor value from items by $<innerfire>% and spell power by $s2%. $?s73413[ You can only have Inner Will or Inner Fire active at a time.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 327.3sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 54.8sec 54.8sec 22.85% 22.49%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.8%
relic_of_yulon 7.3 0.0 52.4sec 52.4sec 28.94% 28.94%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.9%
shadow_word_death_reset_cooldown 6.4 0.0 11.4sec 11.4sec 9.97% 48.77%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.0%
shadowform 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:1.50
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowform_1:100.0%

Spelldata details

  • id:15473
  • name:Shadowform
  • tooltip:Shadow damage you deal increased by $s2%. All damage you take reduced by $s3%.
  • description:Assume a Shadowform, increasing your Shadow damage by $s2%, reducing all damage done to you by $15473s3%, and increasing all party and raid members spell haste by $49868s1%. However, you may not cast Holy spells while in this form.
  • max_stacks:
  • duration:-0.00
  • cooldown:1.50
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
surge_of_darkness 28.6 3.1 12.3sec 11.1sec 14.86% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-1.00

Stack Uptimes

  • surge_of_darkness_1:14.0%
  • surge_of_darkness_2:0.9%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals $s4% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal $s4% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.01%
synapse_springs_2 6.8 0.0 60.9sec 60.9sec 16.65% 16.65%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.7%
twist_of_fate 1.0 104.1 0.0sec 0.7sec 18.69% 100.00%

Buff details

  • buff initial source:Priest_Shadow_T14H
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.7%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:(null)
  • description:After damaging or healing a target below $s1% health, you deal $123254s1% increased damage and healing for $123254d.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:1.00%
shadowfiend-shadowcrawl 4.0 0.0 62.6sec 62.6sec 83.26% 79.94%

Buff details

  • buff initial source:Priest_Shadow_T14H_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadowcrawl_1:5.5%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by $s2%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by $s2% for $d.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Priest_Shadow_T14H
devouring_plague Shadow Orb 15.0 45.0 3.0 3.0 140303.3
halo_damage Mana 9.0 404986.5 45000.0 45000.0 3.3
mind_blast Mana 36.8 331203.8 9000.0 9000.0 13.2
mind_flay Mana 110.9 332807.3 3000.0 3000.0 29.3
shadow_word_death Mana 12.4 96851.6 7800.0 7800.0 16.9
shadow_word_pain Mana 17.9 235990.3 13200.0 13200.0 20.5
vampiric_touch Mana 19.1 171924.7 9000.0 9000.0 25.3
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 389924.73 266.52 48975.27 11.16%
shadowfiend Mana 29.75 128897.60 4332.53 138862.30 51.86%
Shadow Orbs from Mind Blast Shadow Orb 36.80 36.80 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 6.36 6.36 1.00 0.00 0.00%
Devouring Plague Health Health 164.82 2088415.32 12670.81 200390.02 8.76%
Vampiric Touch Mana Mana 211.23 962814.92 4558.13 153658.37 13.76%
Resource RPS-Gain RPS-Loss
Health 5706.05 14867.22
Mana 4048.19 4299.90
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health -2889474.54 -3171497.54 -2602146.53
Mana 208246.22 138900.00 265200.00
Shadow Orb 1.15 0.00 3.00
Resource Gains Chart Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 11.3%
shadowfiend-Mana Cap 11.3%
lightwell-Mana Cap 11.3%

Procs

Count Interval
hat_donor 147.8 2.5sec
Shadowy Recall Extra Tick 221.2 1.6sec
Shadowy Apparition Procced 61.9 5.8sec
FDCL Mind Spike proc 31.7 11.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 108006.15
Minimum 99256.39
Maximum 116706.59
Spread ( max - min ) 17450.19
Range [ ( max - min ) / 2 * 100% ] 8.08%
Standard Deviation 2215.7430
5th Percentile 104406.83
95th Percentile 111684.10
( 95th Percentile - 5th Percentile ) 7277.27
Mean Distribution
Standard Deviation 22.1619
95.00% Confidence Intervall ( 107962.72 - 108049.59 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1616
0.1 Scale Factor Error with Delta=300 41910
0.05 Scale Factor Error with Delta=300 167641
0.01 Scale Factor Error with Delta=300 4191046
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 108006.15

Damage

Sample Data
Count 9996
Mean 37716854.51

DTPS

Sample Data
Count 9996
Mean 14867.22

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 217.41
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
Default action list
# count action,conditions
7 0.00 shadowform
8 6.76 use_item,name=guardian_serpent_gloves
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 15.00 devouring_plague,if=shadow_orb=3
B 3.00 berserking
C 37.93 mind_blast,if=num_targets<=4&cooldown_react
D 31.40 mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
E 17.88 shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
F 12.42 shadow_word_death,if=num_targets<=4
G 20.16 vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
H 9.00 halo_damage
I 2.00 shadowfiend,if=cooldown_react
J 0.00 mind_sear,chain=1,interrupt=1,if=num_targets>=2
K 60.87 mind_flay,chain=1,interrupt=1
L 0.00 shadow_word_death,moving=1
M 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
N 0.00 shadow_word_pain,moving=1
O 0.00 dispersion

Sample Sequence

8ABCEGHIKCKGCAEKDDKCKGKCDDEKHKCADGKK8CDDEKCKGKCADEDKHKCDGKCDEDKDCAGGKC8KDKEKHCKGKKCAKDECGKCKCADEGHKCK8KBKICDKGEKCADKDKCGKDECDDDHKCAGGKCEKD8KCKGKDKCAKEDKDCHKGKCKEKCAGGKCKFFKDEC8AGFFHKCDKFAFKCEGDK9FFKCAKDKFFCDEGKFACDDFFHKCA8BEFF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 21147 18775 17679
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 35789 27206 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 20.39% 14.45% 3482
Spell Haste 25.55% 19.57% 8317
Mana Per 5 6000 6000 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 14.17% 9.16% 3482
Melee Haste 19.57% 19.57% 8317
Swing Speed 31.53% 19.57% 8317
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 3.01% 3.01% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Average Item Level: 508.25
Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160spi_160int_120haste
Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Feet boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Finger1 watersoul_signet,id=90511
Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="Priest_Shadow_T14H"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Xb!120102
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=shadowform
actions+=/use_item,name=guardian_serpent_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/devouring_plague,if=shadow_orb=3
actions+=/berserking
actions+=/mind_blast,if=num_targets<=4&cooldown_react
actions+=/mind_spike,if=num_targets<=4&buff.surge_of_darkness.react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<tick_time)&miss_react
actions+=/shadow_word_death,if=num_targets<=4
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=4,if=num_targets<=4&(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/halo_damage
actions+=/shadowfiend,if=cooldown_react
actions+=/mind_sear,chain=1,interrupt=1,if=num_targets>=2
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160spi_160int_120haste
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160haste_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=17679
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=3482
# gear_haste_rating=8317
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Rogue_Assassination_T14H : 112050 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
112050.1 112050.1 54.16 / 0.05% 4565 / 4.1% 5996.2 18.7 18.4 Energy 41.00% 40.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
Glyphs
  • vendetta

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:96013|67142|58647|50802|32521|16215|13266|6646&chds=0,192026&chco=ABD473,C79C6E,C55D54,C79C6E,9482C9,9482C9,C79C6E,C79C6E&chm=t++96013++envenom,ABD473,0,0,15|t++67142++dispatch,C79C6E,1,0,15|t++58647++rupture,C55D54,2,0,15|t++50802++mutilate,C79C6E,3,0,15|t++32521++shadow_blade,9482C9,4,0,15|t++16215++shadow_blade_offhand,9482C9,5,0,15|t++13266++melee_main_hand,C79C6E,6,0,15|t++6646++melee_off_hand,C79C6E,7,0,15&chtt=Rogue_Assassination_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,13,12,12,10,10,5,5,4,3,3,2,0&chds=0,100&chdls=ffffff&chco=ABD473,C79C6E,ABD473,ABD473,ABD473,C79C6E,C79C6E,C79C6E,9482C9,C55D54,C79C6E,9482C9,C79C6E&chl=deadly_poison_instant|dispatch|venomous_wound|deadly_poison_dot|envenom|melee_main_hand|mutilate_mh|melee_off_hand|shadow_blade|rupture|mutilate_oh|shadow_blade_offhand|ambush&chtt=Rogue_Assassination_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wxz0121123235568765310zxwutsrqonmmljihgfedcbaaaZYXXXWWWWXXXXXYYYYZZZabbaaaaaaaaaZYYYXXWWWWWWVWVVVVVVVWWWVVVVVVVVVWWWWXXYYZaabbccdeeffffgggffffeeddddcbbaaaZZYYYYXWWWVVVVVVVVVVVWWWWXXYZaabccdeeffffgggghhhggffeeedccbcbaZZYXXXWWWWWWWWVWWWWWXYZabbbccddeffghhhhiiiiihhhhhhggffeecccaaaZZYZZYYXXXXXXXXXXYZZZYYZZZZYYYZZZaaaaaaaabbbccccdeeeeedddddddddddccccbbaZZZaaaZZZZZZYYYY&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=112050|max=233101&chxp=1,1,48,100&chtt=Rogue_Assassination_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:4,5,8,9,23,26,44,44,66,86,119,178,203,244,281,348,420,430,488,522,593,560,587,563,578,509,497,439,380,339,281,242,203,153,148,102,86,62,41,25,17,13,11,8,6,2,2,0,0,1&chds=0,593&chbh=5&chxt=x&chxl=0:|min=102983|avg=112050|max=123064&chxp=0,1,45,100&chtt=Rogue_Assassination_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:21.2,16.9,11.2,5.5,1.0,0.6,0.3,41.0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,ABD473,C55D54,C79C6E,C79C6E,C79C6E,ffffff&chl=dispatch 77.5s|mutilate 61.8s|envenom 41.0s|rupture 20.2s|vendetta 3.6s|preparation 2.1s|slice_and_dice 1.0s|waiting 150.1s&chtt=Rogue_Assassination_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Assassination_T14H 112050
ambush 0 0.0% 0.0 1.#Rsec 59441 0 59441 0 59441 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 41.63 41.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 100.00% 59441.22 59441 59441 41.63 0 59441 42 42 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
berserking 0 0.0% 3.0 180.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 13568 12.1% 440.9 1.05sec 11264 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.0 29767 63407 41043 33.5% 0.0% 99.2%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 440.86 440.86 121.00 121.00 0.0000 3.0000 4966044.84 4966044.84 0.00 13680.87 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 440.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.4 66.48% 29766.64 24256 55024 29764.32 28101 31387 2394436 2394436 0.00
crit 40.6 33.52% 63406.76 49967 113348 63414.45 58215 69684 2571608 2571608 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 25779 23.0% 439.9 1.05sec 21450 0 15476 33136 21450 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 439.86 439.86 0.00 0.00 0.0000 0.0000 9435133.87 9435133.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 291.04 66.17% 15476.14 12428 28181 15476.18 14741 16276 4504138 4504138 0.00
crit 148.81 33.83% 33136.27 25603 58052 33135.47 31083 35322 4930996 4930996 0.00
miss 0.01 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
dispatch 14211 12.7% 74.6 4.86sec 69689 67142 50949 106993 69689 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dispatch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.64 74.64 0.00 0.00 1.0379 0.0000 5201393.63 5201393.63 0.00 67142.48 67142.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.68 66.56% 50949.49 44183 81091 50948.98 47631 54060 2530960 2530960 0.00
crit 24.96 33.44% 106992.88 91016 167048 107000.91 96665 119500 2670434 2670434 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispatch

Static Values
  • id:111240
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:111240
  • name:Dispatch
  • school:physical
  • tooltip:(null)
  • description:A vicious strike that exploits the vulnerability of foes with less than 35% health remaining, causing $m2% weapon damage plus $m1 to the target. Requires a dagger in the main hand. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:486.06
  • base_dd_max:486.06
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.00
envenom 10758 9.6% 39.5 9.11sec 99639 96013 71679 154296 99639 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: envenom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.52 39.52 0.00 0.00 1.0378 0.0000 3937293.85 3937293.85 0.00 96012.82 96012.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.14 66.15% 71679.32 48416 139672 71661.16 62514 82105 1873795 1873795 0.00
crit 13.37 33.84% 154295.89 99738 287725 154394.09 113703 203334 2063499 2063499 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: envenom

Static Values
  • id:32645
  • school:nature
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points>=4&action.envenom_hot.ticks_remain<2
Spelldata
  • id:32645
  • name:Envenom
  • school:nature
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.448000
  • base_dd_min:400.06
  • base_dd_max:400.06
melee_main_hand 10669 9.5% 279.0 1.32sec 13998 13266 12380 26505 13998 33.0% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 278.95 278.95 0.00 0.00 1.0552 0.0000 3904769.35 3904769.35 0.00 13266.32 13266.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.01 24.02% 12379.97 10924 20356 12379.99 11696 13122 829635 829635 0.00
crit 92.02 32.99% 26505.10 22503 41933 26505.60 25095 27874 2438931 2438931 0.00
glance 66.97 24.01% 9499.55 8193 15267 9499.21 8967 10139 636203 636203 0.00
miss 52.95 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 5348 4.8% 278.4 1.32sec 7030 6646 6212 13309 7030 33.1% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 278.42 278.42 0.00 0.00 1.0579 0.0000 1957438.45 1957438.45 0.00 6645.88 6645.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.60 23.92% 6211.93 5462 10178 6211.89 5853 6656 413744 413744 0.00
crit 92.03 33.06% 13308.71 11251 20967 13308.84 12643 14063 1224845 1224845 0.00
glance 66.88 24.02% 4767.60 4096 7633 4767.61 4476 5133 318850 318850 0.00
miss 52.91 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mutilate 0 (8579) 0.0% (7.7%) 59.6 4.01sec 52722 50802 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.56 59.56 0.00 0.00 1.0378 0.0000 0.00 0.00 0.00 50802.36 50802.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mutilate

Static Values
  • id:1329
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:55.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rupture.ticks_remain<2&energy>90
Spelldata
  • id:1329
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards $s1 combo $lpoint:points;.
mutilate_mh 5687 5.1% 59.6 4.01sec 34949 0 25339 53947 34949 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.56 59.56 0.00 0.00 0.0000 0.0000 2081453.96 2081453.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.55 66.41% 25338.51 21645 39905 25335.57 23610 27071 1002134 1002134 0.00
crit 20.01 33.59% 53947.13 44590 82204 53967.01 48403 61924 1079320 1079320 0.00
DPS Timeline Chart

Action details: mutilate_mh

Static Values
  • id:5374
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5374
  • name:Mutilate
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
mutilate_oh 2892 2.6% 59.6 4.01sec 17774 0 12873 27424 17774 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mutilate_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.56 59.56 0.00 0.00 0.0000 0.0000 1058538.23 1058538.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.50 66.32% 12872.77 11012 20224 12871.26 11948 13627 508460 508460 0.00
crit 20.06 33.68% 27424.47 22684 41662 27436.01 24331 32158 550078 550078 0.00
DPS Timeline Chart

Action details: mutilate_oh

Static Values
  • id:27576
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:27576
  • name:Mutilate Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly attacks with both weapons for $5374m2% weapon damage plus an additional $5374s1 with each weapon. Awards 2 combo points.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:223.09
  • base_dd_max:223.09
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.00
preparation 0 0.0% 2.0 300.54sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 3239 2.9% 19.5 19.06sec 60860 58647 0 0 0 0.0% 0.0% 0.0% 0.0% 180.1 4751 10113 6581 34.1% 0.0% 98.4%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.48 19.48 180.14 180.14 1.0377 2.0000 1185431.60 1185431.60 0.00 3115.51 58646.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.7 65.88% 4751.14 1822 8816 4751.26 4122 5421 563840 563840 0.00
crit 61.5 34.12% 10112.80 3753 18161 10111.49 8525 11513 621592 621592 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2|(combo_points=5&ticks_remain<3)
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.025000
  • base_td:262.97
  • num_ticks:4
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 4073 3.6% 50.7 4.10sec 29413 32521 20674 43526 29413 38.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.68 50.68 0.00 0.00 0.9044 0.0000 1490560.01 1490560.01 0.00 32520.84 32520.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.29 61.75% 20673.51 16239 30261 20674.85 18698 23061 646924 646924 0.00
crit 19.38 38.25% 43525.53 33453 62338 43521.66 37795 50235 843636 843636 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 2031 1.8% 50.6 4.10sec 14687 16215 10336 21753 14687 38.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.62 50.62 0.00 0.00 0.9058 0.0000 743418.80 743418.80 0.00 16214.86 16214.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.32 61.88% 10335.83 8120 15131 10335.95 9377 11615 323709 323709 0.00
crit 19.29 38.12% 21752.79 16726 31169 21747.21 18943 25573 419710 419710 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 2.0 180.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
slice_and_dice 0 0.0% 1.0 306.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0359 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.down
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 12.0 31.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.00 12.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Assassination_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.0 100.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
vendetta 0 0.0% 3.5 120.52sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vendetta

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.48 3.48 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vendetta

Static Values
  • id:79140
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:79140
  • name:Vendetta
  • school:physical
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
venomous_wound 13795 12.3% 135.1 2.67sec 37376 0 27131 57767 37376 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: venomous_wound

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.08 135.08 0.00 0.00 0.0000 0.0000 5048822.59 5048822.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.90 66.55% 27130.62 22192 50069 27129.95 25523 28740 2439015 2439015 0.00
crit 45.18 33.45% 57766.63 45715 103143 57771.54 52012 64597 2609808 2609808 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: venomous_wound

Static Values
  • id:79136
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:79136
  • name:Venomous Wound
  • school:nature
  • tooltip:(null)
  • description:Venom seeps into your enemies bleeding wounds, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.160000
  • base_dd_min:685.46
  • base_dd_max:685.46

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 3.0 0.0 180.9sec 180.8sec 6.60% 7.25%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
blindside 17.9 0.0 12.9sec 13.0sec 9.36% 9.36%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_blindside
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:30.00%
  • default_value:-1.00

Stack Uptimes

  • blindside_1:9.4%

Spelldata details

  • id:121153
  • name:Blindside
  • tooltip:You may use Dispatch with no cost, regardless of your enemy target's health.
  • description:$@spelldesc121152
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 11.82%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 9.5 6.1 37.7sec 22.1sec 40.05% 40.11%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:40.1%
dancing_steel_oh 8.6 4.8 40.4sec 24.9sec 35.39% 36.88%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:35.4%
envenom 27.0 12.6 13.5sec 9.1sec 57.83% 60.25%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_envenom
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • envenom_1:57.8%

Spelldata details

  • id:32645
  • name:Envenom
  • tooltip:Poison application chance increased by $s2%.
  • description:Finishing move that deals instant poison damage proportional to the number of combo points on the target. Following the Envenom attack, your poison application chance is increased by $s2%, for 1 sec plus an additional 1 sec per combo point. 1 point : ${$AP*0.112+($m1*1)} damage 2 points: ${$AP*0.224+($m1*2)} damage 3 points: ${$AP*0.336+($m1*3)} damage 4 points: ${$AP*0.448+($m1*4)} damage 5 points: ${$AP*0.56+($m1*5)} damage Replaces Eviscerate.
  • max_stacks:
  • duration:1.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 6.3 0.0 61.6sec 61.6sec 25.03% 25.03%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.0%
shadow_blades 2.0 0.0 180.6sec 180.6sec 13.11% 12.55%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:13.1%
slice_and_dice 1.0 39.5 306.2sec 9.1sec 99.72% 99.82%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.7%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 7.0 0.0 60.5sec 60.5sec 17.20% 17.20%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.2%
terror_in_the_mists 6.0 0.0 63.2sec 63.2sec 32.79% 32.79%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tricks_of_the_trade 12.0 0.0 31.2sec 31.2sec 19.67% 100.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.7%
tricks_of_the_trade_trigger 12.0 0.0 31.2sec 31.2sec 1.34% 1.34%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.3%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.0 0.0 100.9sec 100.9sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
virmens_bite_potion 2.0 0.0 327.1sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Assassination_T14H
dispatch Energy 74.6 1684.3 22.6 22.6 3088.1
envenom Energy 39.5 1344.2 34.0 34.0 2929.1
mutilate Energy 59.6 3126.7 52.5 52.5 1004.3
rupture Energy 19.5 480.9 24.7 24.7 2465.0
slice_and_dice Energy 1.0 25.0 25.0 25.0 0.0
tricks_of_the_trade Energy 12.0 178.4 14.9 14.9 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1463.00 4066.07 2.78 26.65 0.65%
energy_refund Energy 0.00 0.13 29.67 0.00 0.00%
relentless_strikes Energy 53.20 1329.78 25.00 0.22 0.02%
venomous_vim Energy 135.08 1349.57 9.99 1.24 0.09%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Energy 18.43 18.69
Combat End Resource Mean Min Max
Health -6352922.00 -6352922.00 -6352922.00
Energy 26.27 0.04 68.86
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.5%

Procs

Count Interval
hat_donor 139.9 2.7sec
seal_fate 57.9 6.3sec
venomous_wounds 135.1 2.7sec
no_revealing_strike 439.8 1.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 112050.11
Minimum 102983.33
Maximum 123064.47
Spread ( max - min ) 20081.14
Range [ ( max - min ) / 2 * 100% ] 8.96%
Standard Deviation 2762.5713
5th Percentile 107561.92
95th Percentile 116691.79
( 95th Percentile - 5th Percentile ) 9129.87
Mean Distribution
Standard Deviation 27.6312
95.00% Confidence Intervall ( 111995.96 - 112104.27 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2335
0.1 Scale Factor Error with Delta=300 65149
0.05 Scale Factor Error with Delta=300 260597
0.01 Scale Factor Error with Delta=300 6514943
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 112050.11

Damage

Sample Data
Count 9996
Mean 41010340.80

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 247.66
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 19.00 auto_attack
9 0.00 kick
A 7.00 use_item,name=gloves_of_the_thousandfold_blades
B 3.00 berserking
C 4.00 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 0.00 ambush
E 2.00 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
F 1.00 slice_and_dice,if=buff.slice_and_dice.down
G 0.32 dispatch,if=dot.rupture.ticks_remain<2&energy>90
H 2.09 mutilate,if=dot.rupture.ticks_remain<2&energy>90
I 19.48 rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
J 3.48 vendetta
K 32.34 envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
L 7.18 envenom,if=combo_points>4
M 0.00 envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
N 74.32 dispatch,if=combo_points<5
O 12.00 tricks_of_the_trade
P 57.47 mutilate

Sample Sequence

8ABDFHIJOPPKENPLPLPIPKPPKNLPPC8L7C8NOPLPIP8PKPPI8PNAKPPOKPPIPNKPPK8PPKOPIPNPK8PNIPAPKJPKOP8PIPPKNPLNPLPKOPIPPN8KPNPI8ABPNKPPEKOPKPPIPKPLPNC8PKPOP8I8PNKPPKNANNJNINNONNKNNNNKNN8INNNNOKN8NINNNKNNNNAINNKNNN8NOKNNINN6NNIN7C8NKNNNN8NKNONNNKNI8NBNANN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 120 120 0
Spell Power 0 0 0
Spell Hit 15.03% 15.03% 2549
Spell Crit 12.99% 7.99% 4786
Spell Haste 12.28% 6.93% 2945
Mana Per 5 0 0 0
Attack Power 47874 38727 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 29.81% 22.91% 4786
Melee Haste 6.93% 6.93% 2945
Swing Speed 17.62% 6.93% 2945
Expertise 7.53% / 7.53% 7.53% / 7.53% 2560
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 75.88% 58.38% 5208

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi
Neck choker_of_the_unleashed_storm,id=86953
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_exp
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi,reforge=haste_mastery
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_hit
Hands gloves_of_the_thousandfold_blades,id=87125,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=exp_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit
Main Hand spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=exp_hit
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_hit
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Assassination_T14H"
origin="unknown"
level=90
race=troll
spec=assassination
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ca!200002
glyphs=vendetta

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=gloves_of_the_thousandfold_blades
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/slice_and_dice,if=buff.slice_and_dice.down
actions+=/dispatch,if=dot.rupture.ticks_remain<2&energy>90
actions+=/mutilate,if=dot.rupture.ticks_remain<2&energy>90
actions+=/rupture,if=ticks_remain<2|(combo_points=5&ticks_remain<3)
actions+=/vendetta
actions+=/envenom,if=combo_points>=4&action.envenom_hot.ticks_remain<2
actions+=/envenom,if=combo_points>4
actions+=/envenom,if=combo_points>=2&buff.slice_and_dice.remains<3
actions+=/dispatch,if=combo_points<5
actions+=/tricks_of_the_trade
actions+=/mutilate

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi
neck=choker_of_the_unleashed_storm,id=86953
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=haste_hit
hands=gloves_of_the_thousandfold_blades,id=87125,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_exp
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit,reforge=hit_mastery
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi,reforge=haste_mastery
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=exp_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=exp_hit
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_hit

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2560
# gear_hit_rating=2549
# gear_crit_rating=4786
# gear_haste_rating=2945
# gear_mastery_rating=5208
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=gloves_of_the_thousandfold_blades,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Combat_T14H : 106005 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
106004.9 106004.9 52.84 / 0.05% 4447 / 4.2% 4503.1 23.5 23.3 Energy 31.27% 47.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
Glyphs
  • adrenaline_rush

Charts

http://3.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:163081|144871|126322|42755|34938|32344|29727|15845|13730&chds=0,326163&chco=C79C6E,C55D54,C79C6E,C79C6E,9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++163081++killing_spree,C79C6E,0,0,15|t++144871++rupture,C55D54,1,0,15|t++126322++eviscerate,C79C6E,2,0,15|t++42755++sinister_strike,C79C6E,3,0,15|t++34938++shadow_blade,9482C9,4,0,15|t++32344++revealing_strike,C79C6E,5,0,15|t++29727++shadow_blade_offhand,9482C9,6,0,15|t++15845++melee_main_hand,C79C6E,7,0,15|t++13730++melee_off_hand,C79C6E,8,0,15&chtt=Rogue_Combat_T14H Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,12,11,10,10,9,8,6,5,4,3,2,2,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,C79C6E,C79C6E,ABD473,9482C9,9482C9,C79C6E,C55D54,C79C6E,C79C6E,C79C6E&chl=sinister_strike|main_gauche|melee_main_hand|deadly_poison_instant|melee_off_hand|eviscerate|deadly_poison_dot|shadow_blade|shadow_blade_offhand|killing_spree_mh|rupture|killing_spree_oh|revealing_strike|ambush&chtt=Rogue_Combat_T14H Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:630zz000111356775200000100zxwvtsrpoljigfedcdddecccccccccdeeeedcbbaZYZZZYYXXXWWWVUUUVVVWXXYZZabccdeffgijjiihgggghhhhgggggggggggghhhggeedcccbaZYYXWWXWWVVVVUUUUUUUUTTTTTUUUUTUUVWXYZacdfhijjkllnnppqqqqqponmmlkkjjjiihhgfedcaZZYXXWWVVUUUTTUTUVVWYYZabccdeeffgggghgggfedccbaaZZYYYYXXWVWWWWXYYZZZaabbccddefgghhhhhigggggggggggggggffffffhhhhggfeeedddccbbaZZYXXWVVUWWWVVVUUUUUUT&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=106005|max=208308&chxp=1,1,51,100&chtt=Rogue_Combat_T14H DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,3,5,3,9,14,19,37,41,53,100,114,146,169,250,281,365,430,510,562,569,624,620,633,604,546,555,498,454,374,329,257,180,177,121,110,61,45,36,29,20,14,9,8,4,2,1,0,1&chds=0,633&chbh=5&chxt=x&chxl=0:|min=95799|avg=106005|max=116902&chxp=0,1,48,100&chtt=Rogue_Combat_T14H DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:42.3,7.3,5.8,4.2,3.5,2.4,0.6,31.3&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,ffffff&chl=sinister_strike 155.0s|eviscerate 26.9s|revealing_strike 21.1s|killing_spree 15.5s|slice_and_dice 12.9s|rupture 9.0s|preparation 2.1s|waiting 114.4s&chtt=Rogue_Combat_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Combat_T14H 106005
adrenaline_rush 0 0.0% 4.0 91.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.04 4.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy<35
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
ambush 0 0.0% 0.0 1.#Rsec 95528 0 54366 111993 95528 71.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 66.90 66.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 28.57% 54365.60 54366 54366 10.88 0 54366 11 11 0.00
crit 0.00 71.43% 111993.13 111993 111993 56.02 0 111993 56 56 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.25
berserking 0 0.0% 3.0 180.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 8995 8.5% 278.8 1.41sec 11806 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.9 20038 42258 27222 32.3% 0.0% 99.1%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 278.84 278.84 120.94 120.94 0.0000 3.0000 3292111.06 3292111.06 0.00 9073.85 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 278.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.8 67.67% 20037.76 14169 47478 20036.68 18692 21869 1639861 1639861 0.00
crit 39.1 32.33% 42257.97 29189 97805 42258.02 37584 47905 1652250 1652250 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 11122 10.5% 277.8 1.41sec 14652 0 10712 22740 14652 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 277.82 277.82 0.00 0.00 0.0000 0.0000 4070716.69 4070716.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.82 67.24% 10712.08 7259 24313 10711.92 10025 11603 2001189 2001189 0.00
crit 91.01 32.76% 22740.37 14953 50086 22736.88 20612 25549 2069528 2069528 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 9280 8.8% 28.1 12.45sec 120905 126322 89566 187354 120905 32.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.09 28.09 0.00 0.00 0.9571 0.0000 3396425.46 3396425.46 0.00 126322.22 126322.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.09 67.95% 89566.20 46249 193474 89558.73 78793 102298 1709732 1709732 0.00
crit 9.00 32.05% 187354.11 120519 398557 187391.09 0 253519 1686693 1686693 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&buff.deep_insight.up
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
killing_spree 0 (6897) 0.0% (6.5%) 6.0 63.02sec 421651 163081 0 0 0 0.0% 0.0% 0.0% 0.0% 40.0 0 0 0 33.5% 0.0% 3.8%

Stats details: killing_spree

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 40.02 40.02 2.5855 0.3491 0.00 0.00 0.00 163081.34 163081.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.6 66.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 13.4 33.48% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: killing_spree

Static Values
  • id:51690
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
Spelldata
  • id:51690
  • name:Killing Spree
  • school:physical
  • tooltip:Attacking an enemy every $t1 sec. Damage dealt increased by $61851s3%.
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every $t1 sec with both weapons until 7 assaults are made, and increasing all damage done by $61851s3% for the duration. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
killing_spree_mh 4296 4.1% 40.0 8.11sec 39298 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 28342 59784 39298 34.8% 0.0% 0.0%

Stats details: killing_spree_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.02 0.00 0.00 40.02 0.0000 0.0000 1572502.34 1572502.34 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.1 65.16% 28342.38 14718 42216 28339.30 22495 34010 738952 738952 0.00
crit 13.9 34.84% 59784.10 30320 86965 59685.33 44382 74544 833550 833550 0.00
DPS Timeline Chart

Action details: killing_spree_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
killing_spree_oh 2601 2.5% 40.0 8.11sec 23787 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 17177 36220 23787 34.7% 0.0% 0.0%

Stats details: killing_spree_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.02 0.00 0.00 40.02 0.0000 0.0000 951833.72 951833.72 0.00 0.00 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.1 65.29% 17176.95 8916 25574 17175.26 13831 21510 448754 448754 0.00
crit 13.9 34.71% 36219.76 18367 52682 36154.86 26726 43990 503080 503080 0.00
DPS Timeline Chart

Action details: killing_spree_oh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
main_gauche 13045 12.3% 152.4 2.40sec 31318 0 23521 49371 31318 32.1% 2.1% 0.0% 0.9% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.45 152.45 0.00 0.00 0.0000 0.0000 4774380.44 4774380.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.99 64.93% 23520.82 16937 48184 23519.85 21615 25668 2328222 2328222 0.00
crit 48.90 32.08% 49370.87 34891 99260 49367.48 44041 57211 2414476 2414476 0.00
block 1.35 0.89% 23473.20 16937 46129 6631.25 0 44499 31683 31683 0.00
parry 3.21 2.10% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:(null)
  • description:A vicious attack that deals damage equal to $86392s2% of a main-hand attack.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
melee_main_hand 11389 10.7% 192.5 1.91sec 21653 15845 19405 41051 21653 32.5% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 192.51 192.51 0.00 0.00 1.3666 0.0000 4168552.65 4168552.65 0.00 15844.83 15844.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.24 24.54% 19405.41 14718 40744 19403.46 17819 21866 916661 916661 0.00
crit 62.60 32.52% 41051.05 30320 86965 41049.71 37581 44781 2569641 2569641 0.00
glance 46.15 23.97% 14783.38 11039 31662 14783.32 13532 16450 682251 682251 0.00
miss 36.53 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 10104 9.5% 282.4 1.30sec 13094 13730 11731 24820 13094 32.5% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 282.43 282.43 0.00 0.00 0.9536 0.0000 3698030.53 3698030.53 0.00 13730.07 13730.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.03 24.44% 11730.79 8916 24682 11729.92 10887 12829 809790 809790 0.00
crit 91.92 32.55% 24819.70 18367 52682 24818.77 23114 27051 2281493 2281493 0.00
glance 67.90 24.04% 8936.44 6687 18511 8936.24 8274 9805 606748 606748 0.00
miss 53.58 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
preparation 0 0.0% 2.0 300.53sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 1.98 0.00 0.00 1.0364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
revealing_strike 1865 1.8% 21.0 18.05sec 32508 32344 24128 50203 32508 32.1% 0.0% 0.0% 0.0% 121.0 0 0 0 32.4% 0.0% 99.2%

Stats details: revealing_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.00 21.00 120.99 120.99 1.0050 3.0000 682659.92 682659.92 0.00 1777.38 32344.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.25 67.86% 24127.80 18398 50930 24120.74 21020 28202 343848 343848 0.00
crit 6.75 32.14% 50202.59 37900 108706 50194.71 0 81050 338812 338812 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.7 67.57% 0.00 0 0 0.00 0 0 0 0 0.00
crit 39.2 32.43% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: revealing_strike

Static Values
  • id:84617
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:anticipation_charges<5&ticks_remain<2
Spelldata
  • id:84617
  • name:Revealing Strike
  • school:physical
  • tooltip:Reveals a weakness, increasing the effectiveness of the Rogue's offensive finishing moves by $w3%, and giving the Rogue's Sinister Strikes a $h% chance to generate an extra combo point.
  • description:An instant strike that deals $m1% weapon damage and exposes the target's vulnerabilities, increasing the effectiveness of your offensive finishing moves on that target by $s3%, and giving your Sinister Strikes a $h% chance to generate an extra combo point, for $d. Awards $s2 combo $lpoint:points;.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.25
rupture 3549 3.3% 9.0 39.54sec 144349 144871 0 0 0 0.0% 0.0% 0.0% 0.0% 107.5 8841 18637 12080 33.1% 0.0% 58.8%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 107.52 107.52 0.9964 2.0000 1298769.61 1298769.61 0.00 5798.21 144871.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.0 66.94% 8841.48 5548 17800 8842.55 7810 10645 636319 636319 0.00
crit 35.5 33.06% 18636.83 11428 36667 18630.89 16281 24429 662450 662450 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 6247 5.9% 56.3 5.40sec 40643 34938 30011 62566 40643 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.25 56.25 0.00 0.00 1.1633 0.0000 2286302.53 2286302.53 0.00 34937.92 34937.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.88 67.34% 30010.67 21881 60571 30001.22 26570 34831 1136878 1136878 0.00
crit 18.37 32.66% 62566.15 45074 124775 62539.07 54142 74517 1149425 1149425 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 5410 5.1% 80.8 3.74sec 24520 29727 18149 37824 24520 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.75 80.75 0.00 0.00 0.8249 0.0000 1980122.07 1980122.07 0.00 29726.65 29726.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.61 67.62% 18149.48 13255 36692 18144.17 16486 20601 991071 991071 0.00
crit 26.15 32.38% 37823.85 27305 75586 37807.29 33622 44239 989051 989051 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 4.0 92.64sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.04 4.04 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
sinister_strike 18102 17.1% 157.3 2.33sec 42116 42755 31099 64977 42116 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: sinister_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 157.31 157.31 0.00 0.00 0.9851 0.0000 6625309.55 6625309.55 0.00 42754.69 42754.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.15 67.48% 31098.74 23798 67542 31098.60 29713 33089 3301174 3301174 0.00
crit 51.16 32.52% 64977.11 49023 134469 64976.87 60125 71181 3324136 3324136 0.00
DPS Timeline Chart

Action details: sinister_strike

Static Values
  • id:1752
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5
Spelldata
  • id:1752
  • name:Sinister Strike
  • school:physical
  • tooltip:(null)
  • description:An instant strike that causes $m1 damage in addition to $m3% of your normal weapon damage.$?s79327[ Awards $s2 combo $lpoint:points;.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.45
slice_and_dice 0 0.0% 12.8 29.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.82 12.82 0.00 0.00 1.0075 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.slice_and_dice.remains<2
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 12.0 30.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.00 12.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Combat_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.0 101.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 3.98 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&!buff.stealthed.up&!buff.shadow_blades.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
adrenaline_rush 4.0 0.0 91.5sec 91.5sec 16.45% 23.18%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:16.4%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by $s1%. Melee attack speed increased by $s2%.$?$w3!=0[ Global cooldown of Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture reduced by 0.2 sec.][]
  • description:Increases your Energy regeneration rate by $s1% and your melee attack speed by $s2% for $d.$?s56821[ While Adrenaline Rush is active, your Sinister Strike, Revealing Strike, Eviscerate, Slice and Dice, and Rupture abilities incur a ${$m3/-1000}.1 sec shorter global cooldown.][]
  • max_stacks:
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
berserking 3.0 0.0 180.8sec 180.6sec 6.65% 6.76%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:6.6%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.05%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 10.5 9.8 34.5sec 17.3sec 48.17% 49.14%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:48.2%
dancing_steel_oh 8.0 3.7 43.7sec 28.8sec 31.38% 32.35%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:31.4%
deep_insight 9.2 0.0 39.3sec 39.3sec 37.08% 38.46%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_deep_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • deep_insight_1:37.1%

Spelldata details

  • id:84747
  • name:Deep Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
killing_spree 6.0 0.0 62.8sec 62.8sec 4.90% 11.41%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_killing_spree
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • killing_spree_1:4.9%

Spelldata details

  • id:61851
  • name:Killing Spree
  • tooltip:(null)
  • description:Step through the shadows from enemy to enemy within 10 yards, attacking an enemy every .5 secs with both weapons until 5 assaults are made. Can hit the same target multiple times. Cannot hit invisible or stealthed targets.
  • max_stacks:
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
moderate_insight 9.7 0.0 39.1sec 39.1sec 22.26% 21.05%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_moderate_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • moderate_insight_1:22.3%

Spelldata details

  • id:84746
  • name:Moderate Insight
  • tooltip:Damage dealt increased by $s2%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_xuen 6.3 0.0 61.7sec 61.7sec 24.94% 24.94%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.9%
shadow_blades 4.0 0.0 92.4sec 92.4sec 19.72% 22.45%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:19.7%
shallow_insight 9.9 0.0 38.8sec 38.8sec 21.84% 21.73%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_shallow_insight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • shallow_insight_1:21.8%

Spelldata details

  • id:84745
  • name:Shallow Insight
  • tooltip:Damage dealt increased by $s1%.
  • description:$@spelldesc84654
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
slice_and_dice 1.1 11.7 234.3sec 29.7sec 99.70% 99.80%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:99.7%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 7.0 0.0 60.6sec 60.6sec 17.11% 17.11%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:17.1%
terror_in_the_mists 6.0 0.0 63.3sec 63.3sec 32.78% 32.78%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tricks_of_the_trade 12.0 0.0 30.8sec 30.8sec 19.67% 100.00%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:19.7%
tricks_of_the_trade_trigger 12.0 0.0 30.8sec 30.8sec 1.08% 1.08%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.1%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.0 0.0 101.3sec 101.3sec 0.30% 0.30%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • vanish_1:0.3%
virmens_bite_potion 2.0 0.0 327.1sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Rogue_Combat_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Combat_T14H
eviscerate Energy 28.1 971.6 34.6 34.6 3495.8
revealing_strike Energy 21.0 798.9 38.0 38.0 854.5
rupture Energy 9.0 224.0 24.9 24.9 5797.4
sinister_strike Energy 157.3 6150.2 39.1 39.1 1077.3
slice_and_dice Energy 12.8 292.5 22.8 22.8 0.0
tricks_of_the_trade Energy 12.0 178.6 14.9 14.9 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1463.00 5175.26 3.54 80.61 1.53%
adrenaline_rush Energy 240.79 876.15 3.64 15.81 1.77%
combat_potency Energy 88.82 1311.67 14.77 20.63 1.55%
relentless_strikes Energy 47.86 1176.22 24.57 20.41 1.71%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Energy 23.33 23.54
Combat End Resource Mean Min Max
Health -6352936.00 -6352936.00 -6352936.00
Energy 22.91 0.03 74.14
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 1.3%

Procs

Count Interval
hat_donor 182.9 2.1sec
main_gauche 152.4 2.4sec
no_revealing_strike 0.4 80.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 106004.87
Minimum 95798.83
Maximum 116901.58
Spread ( max - min ) 21102.75
Range [ ( max - min ) / 2 * 100% ] 9.95%
Standard Deviation 2695.5804
5th Percentile 101569.60
95th Percentile 110464.34
( 95th Percentile - 5th Percentile ) 8894.74
Mean Distribution
Standard Deviation 26.9612
95.00% Confidence Intervall ( 105952.03 - 106057.72 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2483
0.1 Scale Factor Error with Delta=300 62028
0.05 Scale Factor Error with Delta=300 248112
0.01 Scale Factor Error with Delta=300 6202806
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 106004.87

Damage

Sample Data
Count 9996
Mean 38797783.45

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 290.21
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
Default action list
# count action,conditions
6 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
7 1.98 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
8 18.98 auto_attack
9 0.00 kick
A 6.97 use_item,name=bonebreaker_gauntlets
B 3.00 berserking
C 3.98 vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
D 0.00 ambush
E 12.82 slice_and_dice,if=buff.slice_and_dice.remains<2
F 4.04 shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
G 5.99 killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
H 4.04 adrenaline_rush,if=energy<35
I 9.00 rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
J 17.56 eviscerate,if=combo_points=5&buff.deep_insight.up
K 10.53 eviscerate,if=anticipation_charges=5
L 21.00 revealing_strike,if=anticipation_charges<5&ticks_remain<2
M 12.00 tricks_of_the_trade
N 157.31 sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

Sample Sequence

8ABDELMNGNNNNC8N7C8NNKNNEFLNINNHJNNNJNNJNNJMNNLNNKNNNNK8NGNNELINN8NANNMJNNLNNNNNNENL8NNIMNJFNNJNHNNJLNNN8NKNNNKAENNGLMNINN8NNJNLNNNNENMNLNNN8KNINNL8BAJNNNNMEFNNGLNNKNHNKC8NNNNKNILNNJMNNNNE8N8NNLNNNANNNMKLENGNNNINNNN8JLNNNMNN8KEFLNNNNKANHNLIJNNMNJ7C8NN8NNJNNENG6LNNNNNNENMN8LNINJNNNN8JABLN

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 21574 19182 18042
Stamina 22209 20190 20067
Intellect 130 124 80
Spirit 158 158 80
Health 457329 429063 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.09% 15.09% 2558
Spell Crit 11.78% 6.78% 4059
Spell Haste 20.14% 14.42% 6128
Mana Per 5 0 0 0
Attack Power 59843 48409 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 28.59% 21.69% 4059
Melee Haste 14.42% 14.42% 6128
Swing Speed 25.86% 14.42% 6128
Expertise 7.56% / 7.56% 7.56% / 7.56% 2572
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 35.42% 25.42% 2823

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
Hands bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=mastery_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=crit_haste
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Combat_T14H"
origin="unknown"
level=90
race=troll
spec=combat
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cZ!200002
glyphs=adrenaline_rush

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/use_item,name=bonebreaker_gauntlets
actions+=/berserking
actions+=/vanish,if=time>10&!buff.stealthed.up&!buff.shadow_blades.up
actions+=/ambush
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<2
actions+=/shadow_blades,if=(buff.bloodlust.react|time>60)&buff.slice_and_dice.remains>=buff.shadow_blades.duration
actions+=/killing_spree,if=energy<35&buff.slice_and_dice.remains>4&buff.adrenaline_rush.down
actions+=/adrenaline_rush,if=energy<35
actions+=/rupture,if=ticks_remain<2&combo_points=5&buff.deep_insight.up&target.time_to_die>10
actions+=/eviscerate,if=combo_points=5&buff.deep_insight.up
actions+=/eviscerate,if=anticipation_charges=5
actions+=/revealing_strike,if=anticipation_charges<5&ticks_remain<2
actions+=/tricks_of_the_trade
actions+=/sinister_strike,if=(!buff.shadow_blades.up&anticipation_charges<4)|anticipation_charges<5

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=crit_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20067
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2572
# gear_hit_rating=2558
# gear_crit_rating=4059
# gear_haste_rating=6128
# gear_mastery_rating=2823
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Rogue_Subtlety_T14H : 100337 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
100337.1 100337.1 36.15 / 0.04% 3017 / 3.0% 4734.9 21.2 21.0 Energy 21.66% 59.0 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:182446|142977|46958|40102|23503|17981|9023&chds=0,364891&chco=C55D54,C79C6E,9482C9,C79C6E,9482C9,C79C6E,C79C6E&chm=t++182446++rupture,C55D54,0,0,15|t++142977++eviscerate,C79C6E,1,0,15|t++46958++shadow_blade,9482C9,2,0,15|t++40102++hemorrhage,C79C6E,3,0,15|t++23503++shadow_blade_offhand,9482C9,4,0,15|t++17981++melee_main_hand,C79C6E,5,0,15|t++9023++melee_off_hand,C79C6E,6,0,15&chtt=Rogue_Subtlety_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,20,14,11,10,9,7,6,3,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,ABD473,ABD473,C55D54,C79C6E,9482C9,9482C9,C79C6E&chl=eviscerate|hemorrhage|melee_main_hand|deadly_poison_instant|deadly_poison_dot|rupture|melee_off_hand|shadow_blade|shadow_blade_offhand|ambush&chtt=Rogue_Subtlety_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:7777876444444542zzyvtrpomlljkjjhhgfeeecddcbaZZYWWWWVUUUUWWWXXXYZbbcbddeeeeffedddbaaZYWWWWWVVVVVUUUVVVWXXWWWWWWWWWWWWWVVVWWXXXXXYYYZZZaaaaabbbbbaaZaaZZZZYYXWWWWVWVVVVVVVVVUUVVWXYYZaabdeghiijklnnnonnnnnmmlkjihggfeedcbZZZYYYXXWWVVVVVUUUUVVVVVWWWWXXYZZaabbbbccccccbbbaaaZZYYYXXXWVVVVVVWWWXXXWWWWWWWWWXWWWWWWWWVVVVWWXXXYZZabccddeffggggggeeedccbbaaaZZYYYYYXXXZZaZaaaaaZaaa&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=100337|max=216427&chxp=1,1,46,100&chtt=Rogue_Subtlety_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:5,6,1,5,5,24,22,34,41,59,83,117,136,188,263,251,322,380,416,466,547,530,572,548,574,565,549,489,456,368,372,309,256,222,201,168,123,98,60,48,30,33,15,17,4,7,5,4,0,2&chds=0,574&chbh=5&chxt=x&chxl=0:|min=93990|avg=100337|max=107200&chxp=0,1,48,100&chtt=Rogue_Subtlety_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:50.1,14.3,4.7,3.6,2.8,0.6,21.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C55D54,FFFFFF,C79C6E,C79C6E,ffffff&chl=hemorrhage 183.5s|eviscerate 52.4s|rupture 17.2s|pool_resource 13.1s|slice_and_dice 10.4s|preparation 2.1s|waiting 79.3s&chtt=Rogue_Subtlety_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Rogue_Subtlety_T14H 100337
ambush 0 0.0% 0.0 1.#Rsec 69121 0 60030 123663 69121 14.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 0.0000 0.0000 48.40 48.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 85.71% 60030.49 60030 60030 36.03 0 60030 36 36 0.00
crit 0.00 14.29% 123662.81 123663 123663 12.37 0 123663 12 12 0.00
DPS Timeline Chart

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<=5&anticipation_charges=0
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:(null)
  • description:Ambush the target, causing $m2% weapon damage plus $m1 to the target (${$m2*1.447}% plus ${$m1*1.447} if a dagger is equipped). Must be stealthed and behind the target. Awards $s3 combo $lpoint:points;.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:623.15
  • base_dd_max:623.15
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:4.70
berserking 0 0.0% 2.0 189.42sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.shadow_dance.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
deadly_poison_dot 9624 9.6% 257.2 1.57sec 13693 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.0 20409 43240 29118 38.1% 0.0% 99.2%

Stats details: deadly_poison_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 257.24 257.24 120.97 120.97 0.0000 3.0000 3522362.55 3522362.55 0.00 9706.02 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 257.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.8 61.85% 20408.67 14677 35390 20407.89 19348 21413 1527057 1527057 0.00
crit 46.1 38.15% 43240.33 30235 72903 43244.87 39922 46262 1995306 1995306 0.00
DPS Timeline Chart

Action details: deadly_poison_dot

Static Values
  • id:2818
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2818
  • name:Deadly Poison
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 seconds.
  • description:$@spelldesc2823
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.213000
  • base_td:747.78
  • num_ticks:4
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
deadly_poison_instant 10616 10.6% 256.2 1.57sec 15164 0 10563 22461 15164 38.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_poison_instant

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 256.23 256.23 0.00 0.00 0.0000 0.0000 3885425.33 3885425.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.15 61.33% 10563.31 7519 18122 10563.44 10064 11137 1660058 1660058 0.00
crit 99.08 38.67% 22461.19 15488 37331 22461.24 21200 24085 2225367 2225367 0.00
DPS Timeline Chart

Action details: deadly_poison_instant

Static Values
  • id:113780
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113780
  • name:Deadly Poison
  • school:nature
  • tooltip:(null)
  • description:Poisoned weapons have a chance to deal $s1 Nature damage to a target already affected by Deadly Poison.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.109000
  • base_dd_min:335.48
  • base_dd_max:444.70
eviscerate 20471 20.4% 50.5 7.22sec 148333 142977 102664 218309 148333 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: eviscerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.51 50.51 0.00 0.00 1.0375 0.0000 7492419.51 7492419.51 0.00 142976.92 142976.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.56 60.51% 102663.63 88072 169842 102642.51 93904 110327 3137773 3137773 0.00
crit 19.95 39.49% 218308.90 181428 349874 218383.55 198021 238902 4354647 4354647 0.00
DPS Timeline Chart

Action details: eviscerate

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5
Spelldata
  • id:2098
  • name:Eviscerate
  • school:physical
  • tooltip:(null)
  • description:Finishing move that causes damage per combo point: 1 point : ${$m1+(($b1*1)+$AP*0.16)*$<mult>}-${$M1+(($b1*1)+$AP*0.16)*$<mult>} damage 2 points: ${$m1+(($b1*2)+$AP*0.32)*$<mult>}-${$M1+(($b1*2)+$AP*0.32)*$<mult>} damage 3 points: ${$m1+(($b1*3)+$AP*0.48)*$<mult>}-${$M1+(($b1*3)+$AP*0.48)*$<mult>} damage 4 points: ${$m1+(($b1*4)+$AP*0.64)*$<mult>}-${$M1+(($b1*4)+$AP*0.64)*$<mult>} damage 5 points: ${$m1+(($b1*5)+$AP*0.8)*$<mult>}-${$M1+(($b1*5)+$AP*0.8)*$<mult>} damage
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:5267.48
  • base_dd_max:6006.54
hemorrhage 20103 20.0% 176.8 2.08sec 41624 40102 27149 56971 38628 38.5% 0.0% 0.0% 0.0% 121.0 3050 6533 4376 38.1% 0.0% 99.2%

Stats details: hemorrhage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 176.76 176.76 121.00 121.00 1.0379 3.0000 7357571.82 7357571.82 0.00 13463.82 40102.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.72 61.51% 27148.88 20468 42952 27148.65 26145 27984 2951692 2951692 0.00
crit 68.04 38.49% 56970.56 42164 88482 56973.11 54507 59673 3876386 3876386 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.9 61.93% 3049.81 1331 8390 3049.65 2491 3578 228534 228534 0.00
crit 46.1 38.07% 6533.25 2741 17283 6534.22 5101 8314 300960 300960 0.00
DPS Timeline Chart

Action details: hemorrhage

Static Values
  • id:16511
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<4&(dot.hemorrhage.remains<4|position_front)
Spelldata
  • id:16511
  • name:Hemorrhage
  • school:physical
  • tooltip:(null)
  • description:An instant strike that deals $m2% weapon damage (${$m2*1.45}% if a dagger is equipped)$?s56807[. When used on a target that is bleeding, opens the wound further to deal][, causing profuse bleeding that deals] an additional $s4% of the direct strike's damage over $89775d. Awards $s3 combo $lpoint:points;. Replaces Sinister Strike.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:2360.39
  • num_ticks:8
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.03
melee_main_hand 14335 14.3% 335.2 1.01sec 15655 17981 13510 28389 15655 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 335.15 335.15 0.00 0.00 0.8706 0.0000 5246629.78 5246629.78 0.00 17981.40 17981.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.67 20.19% 13509.72 10396 20387 13510.49 12855 14131 914236 914236 0.00
crit 123.53 36.86% 28388.79 21416 43475 28388.32 27527 29396 3506998 3506998 0.00
glance 80.43 24.00% 10262.03 7797 15828 10262.11 9862 10697 825395 825395 0.00
miss 63.51 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 7194 7.2% 335.2 1.01sec 7856 9023 6777 14239 7856 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 335.16 335.16 0.00 0.00 0.8706 0.0000 2632901.71 2632901.71 0.00 9023.34 9023.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.39 20.11% 6776.65 5198 10194 6777.08 6475 7066 456684 456684 0.00
crit 123.76 36.92% 14239.34 10708 21737 14239.11 13755 14719 1762220 1762220 0.00
glance 80.40 23.99% 5149.28 3899 7914 5149.16 4945 5359 413998 413998 0.00
miss 63.61 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
premeditation 0 0.0% 6.8 57.16sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: premeditation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.76 6.76 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: premeditation

Static Values
  • id:14183
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:14183
  • name:Premeditation
  • school:physical
  • tooltip:(null)
  • description:When used, adds $s1 combo points to your target. You must add to or use those combo points within $d or the combo points are lost.
preparation 0 0.0% 2.0 300.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: preparation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0385 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: preparation

Static Values
  • id:14185
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
Spelldata
  • id:14185
  • name:Preparation
  • school:physical
  • tooltip:(null)
  • description:When activated, this ability immediately finishes the cooldown on your Sprint, Vanish, Cloak of Shadows, Evasion, and Dismantle abilities.
rupture 8590 8.6% 16.6 22.62sec 189458 182446 0 0 0 0.0% 0.0% 0.0% 0.0% 177.8 12431 26207 17688 38.2% 0.0% 97.1%

Stats details: rupture

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.60 16.60 177.75 177.75 1.0384 2.0000 3144083.89 3144083.89 0.00 8435.13 182445.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.9 61.84% 12431.08 10772 19002 12431.31 11583 13515 1366419 1366419 0.00
crit 67.8 38.16% 26206.63 22190 39145 26202.10 24018 28914 1777664 1777664 0.00
DPS Timeline Chart

Action details: rupture

Static Values
  • id:1943
  • school:bleed
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points=5&dot.rupture.remains<5
Spelldata
  • id:1943
  • name:Rupture
  • school:physical
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:Finishing move that causes damage over time, increased by your attack power. Lasts longer per combo point: 1 point : ${($m1+$b1*$<bonus>*1+0.025*$AP*$<bonus>)*0.5*8} over 8 sec 2 points: ${($m1+$b1*$<bonus>*2+0.04*$AP*$<bonus>)*0.5*12} over 12 sec 3 points: ${($m1+$b1*$<bonus>*3+0.05*$AP*$<bonus>)*0.5*16} over 16 sec 4 points: ${($m1+$b1*$<bonus>*4+0.056*$AP*$<bonus>)*0.5*20} over 20 sec 5 points: ${($m1+$b1*$<bonus>*5+0.062*$AP*$<bonus>)*0.5*24} over 24 sec
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.062000
  • base_td:392.58
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
shadow_blade 6271 6.3% 68.9 5.38sec 33315 46958 21999 46569 33315 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.90 68.90 0.00 0.00 0.7095 0.0000 2295296.85 2295296.85 0.00 46957.79 46957.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.17 53.95% 21998.72 15455 30133 21998.38 20425 23778 817634 817634 0.00
crit 31.73 46.05% 46569.46 31838 62075 46573.55 42246 51202 1477663 1477663 0.00
DPS Timeline Chart

Action details: shadow_blade

Static Values
  • id:121473
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121473
  • name:Shadow Blade
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blade_offhand 3133 3.1% 68.8 5.38sec 16663 23503 11013 23260 16663 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blade_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.81 68.81 0.00 0.00 0.7090 0.0000 1146641.48 1146641.48 0.00 23503.01 23503.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.07 53.86% 11012.64 7728 15067 11013.15 10174 11948 408195 408195 0.00
crit 31.75 46.14% 23260.21 15919 31037 23262.01 21359 25231 738447 738447 0.00
DPS Timeline Chart

Action details: shadow_blade_offhand

Static Values
  • id:121474
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.80
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:121474
  • name:Shadow Blade Off-hand
  • school:shadow
  • tooltip:(null)
  • description:Strike with dark energy, dealing Shadow damage equal to $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
shadow_blades 0 0.0% 3.0 180.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_blades

Static Values
  • id:121471
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:121471
  • name:Shadow Blades
  • school:physical
  • tooltip:Autoattacks deal pure Shadow damage. Combo-point-generating attacks generate $s2 additional combo point.
  • description:Draw upon the surrounding shadows to empower your weapons, causing your autoattacks to deal pure Shadow damage and your combo-point-generating abilities to generate an additional combo point when used. Lasts $?p123122&?s79096[${$123122m1*1.5}]?p123122[${$123122m1*2}][$123122m1] sec.
shadow_dance 0 0.0% 6.0 63.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_dance

Static Values
  • id:51713
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
Spelldata
  • id:51713
  • name:Shadow Dance
  • school:physical
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
slice_and_dice 0 0.0% 11.0 35.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slice_and_dice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 0.00 0.00 0.9438 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 11.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slice_and_dice

Static Values
  • id:5171
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:5171
  • name:Slice and Dice
  • school:physical
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
tricks_of_the_trade 0 0.0% 11.4 32.17sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tricks_of_the_trade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.40 11.40 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 11.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: tricks_of_the_trade

Static Values
  • id:57934
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rogue_Subtlety_T14H
  • harmful:false
  • if_expr:
Spelldata
  • id:57934
  • name:Tricks of the Trade
  • school:physical
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
vanish 0 0.0% 4.0 103.56sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering an improved stealth mode for $11327d. For the first $11327d after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
berserking 2.0 0.0 189.5sec 189.5sec 5.46% 6.24%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserking_1:5.5%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Melee, ranged, and spell haste increased by $s1%.
  • description:Increases your melee, ranged, and spell haste by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 12.16%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 10.0 7.4 36.3sec 20.1sec 43.26% 43.25%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:43.3%
dancing_steel_oh 8.3 3.9 42.8sec 28.1sec 32.58% 32.68%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:32.6%
master_of_subtlety 5.0 0.0 81.6sec 103.6sec 8.20% 8.20%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_master_of_subtlety
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • master_of_subtlety_1:8.2%

Spelldata details

  • id:31223
  • name:Master of Subtlety
  • tooltip:(null)
  • description:Attacks made while stealthed and for 6 seconds after breaking stealth cause an additional $s1% damage.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
relic_of_xuen 6.5 0.0 60.5sec 60.5sec 25.54% 25.54%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:25.5%
shadow_blades 3.0 0.0 180.9sec 180.8sec 14.25% 15.67%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_blades
  • max_stacks:1
  • duration:24.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_blades_1:14.2%
shadow_dance 6.0 0.0 63.2sec 63.2sec 13.11% 13.11%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_shadow_dance
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • shadow_dance_1:13.1%

Spelldata details

  • id:51713
  • name:Shadow Dance
  • tooltip:Can use opening abilities without being stealthed. Energy cost of Ambush reduced by $s2.
  • description:Enter the Shadow Dance for $d, allowing the use of abilities that ordinarily require Stealth. The Energy cost of Ambush is reduced by $s2 while Shadow Dance is active.
  • max_stacks:
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
slice_and_dice 5.7 5.4 63.3sec 35.9sec 98.41% 98.96%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_slice_and_dice
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • slice_and_dice_1:98.4%

Spelldata details

  • id:5171
  • name:Slice and Dice
  • tooltip:Melee attack speed increased by $w1%.$?$w2!=0[ Regaining $w2 Energy every $t2 sec.][]
  • description:Finishing move that consumes combo points on any nearby target to increase melee attack speed by $s1%. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
stealthed 1.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_stealthed
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.0 0.0 63.2sec 63.2sec 16.39% 16.39%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.4%
terror_in_the_mists 6.0 0.0 62.9sec 62.9sec 32.79% 32.79%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.8%
tricks_of_the_trade 11.4 0.0 32.2sec 32.2sec 18.37% 100.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_1:18.4%
tricks_of_the_trade_trigger 11.4 0.0 32.2sec 32.2sec 1.52% 1.52%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_tricks_of_the_trade_trigger
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • tricks_of_the_trade_trigger_1:1.5%

Spelldata details

  • id:57934
  • name:Tricks of the Trade
  • tooltip:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target. In addition, all damage caused by the target is increased during this time.
  • description:The threat caused by your next damaging attack and all actions taken for $57933d afterwards will be transferred to the target party or raid member$?s63256[][, and all damage caused by the target is increased by $57933s1% during this time]. Transferred threat is not permanent, and will fade after 30 sec.
  • max_stacks:
  • duration:20.00
  • cooldown:30.00
  • default_chance:1.00%
vanish 4.0 0.0 103.6sec 103.6sec 0.06% 0.06%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • vanish_1:0.1%
virmens_bite_potion 2.0 0.0 327.1sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Rogue_Subtlety_T14H
eviscerate Energy 50.5 1762.3 34.9 34.9 4251.4
hemorrhage Energy 176.8 5158.1 29.2 29.2 1426.4
rupture Energy 16.6 414.6 25.0 25.0 7584.2
slice_and_dice Energy 11.0 250.2 22.7 22.7 0.0
tricks_of_the_trade Energy 11.4 170.8 15.0 15.0 0.0
Resource Gains Type Count Total Average Overflow
energy_regen Energy 1463.00 4331.04 2.96 40.39 0.92%
energetic_recovery Energy 1438.90 1425.39 0.99 13.51 0.94%
relentless_strikes Energy 77.51 1927.75 24.87 10.12 0.52%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Energy 21.00 21.19
Combat End Resource Mean Min Max
Health -6352922.00 -6352922.00 -6352922.00
Energy 27.76 0.04 86.40
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.8%

Procs

Count Interval
hat_donor 403.8 1.8sec
honor_among_thieves 171.7 2.1sec
no_revealing_strike 450.2 1.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 100337.11
Minimum 93989.95
Maximum 107200.39
Spread ( max - min ) 13210.44
Range [ ( max - min ) / 2 * 100% ] 6.58%
Standard Deviation 1844.2387
5th Percentile 97368.73
95th Percentile 103402.33
( 95th Percentile - 5th Percentile ) 6033.61
Mean Distribution
Standard Deviation 18.4461
95.00% Confidence Intervall ( 100300.95 - 100373.26 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1297
0.1 Scale Factor Error with Delta=300 29034
0.05 Scale Factor Error with Delta=300 116138
0.01 Scale Factor Error with Delta=300 2903474
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 100337.11

Damage

Sample Data
Count 9996
Mean 36723381.33

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 359.64
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 apply_poison,lethal=deadly
3 0.00 snapshot_stats
4 0.00 virmens_bite_potion
5 0.00 stealth
6 0.00 premeditation
7 0.00 slice_and_dice
Default action list
# count action,conditions
8 1.00 virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
9 2.00 preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
A 19.00 auto_attack
B 0.00 kick
C 3.00 shadow_blades
D 43.77 pool_resource,for_next=1,extra_amount=75
E 6.00 shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
F 6.00 use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
G 2.00 berserking,if=buff.shadow_dance.up
H 1.83 pool_resource,for_next=1,extra_amount=30
I 4.00 vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
J 5.76 premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
K 0.00 ambush,if=combo_points<=5&anticipation_charges=0
L 10.01 slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
M 16.60 rupture,if=combo_points=5&dot.rupture.remains<5
N 0.00 ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
O 50.51 eviscerate,if=combo_points=5
P 167.26 hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
Q 9.50 hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
R 0.00 backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
S 11.40 tricks_of_the_trade
T 0.00 backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

Sample Sequence

ACKQMPOPPOPPDDDDEFGOPQOPLPPOPPMPQOPPIAP9OPPQOPIAJSOPPPOPPAPMPPPLPPAOPPPOPPSMPPPDDDDDDDDDDDDDEFOJQOPPOPPPLPPAPMPPSOPPOPPPOPPPAMPPOPPPLPPSOPPADDDDDDDDEFMJPQOPPOPPPOPPOPPSLPPPMPPPAOPPOPPACOPPMPPSOPOPPLPDDDDDDDDDDDEFGOJPOPPMPPPOPPPOHIAPPSOPAPPAMPPPLPPOPPPOPPMPPPSOPPOPPDDDDDDDDDDDDDEFLJPQAMPPOPPPOPPPSAOPPOPPMPPPLPPPOPPOPPSAMPPPOPP8DDDDDDDDDEFO9JPOPPPLIAPPPMAPPPOPSPOPPPOPAPCMPP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 224 213 80
Agility 28047 24937 18042
Stamina 22210 20191 20068
Intellect 130 124 80
Spirit 158 158 80
Health 457343 429077 0
Energy 100 100 0
Spell Power 0 0 0
Spell Hit 15.17% 15.17% 2558
Spell Crit 11.67% 6.67% 3997
Spell Haste 20.12% 14.40% 6122
Mana Per 5 0 0 0
Attack Power 62115 50237 0
Melee Hit 7.52% 7.52% 2558
Melee Crit 33.63% 26.16% 3997
Melee Haste 14.40% 14.40% 6122
Swing Speed 25.85% 14.40% 6122
Expertise 7.65% / 7.65% 7.65% / 7.65% 2600
Armor 18586 18586 18586
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 53.37% 38.37% 2876

Gear

Average Item Level: 507.38
Head helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
Shirt empty
Chest tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
Waist stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
Legs legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
Feet boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
Wrists bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
Hands bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 regails_band_of_the_endless,id=90503
Finger2 painful_thorned_ring,id=86974,reforge=mastery_haste
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_haste
Main Hand spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=mastery_haste
Off Hand spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste
Unknown empty
Tabard empty

Talents

Level
15 Nightstalker Subterfuge Shadow Focus
30 Deadly Throw Nerve Strike Combat Readiness
45 Cheat Death Leeching Poison Elusiveness
60 Preparation Shadowstep Burst of Speed
75 Prey on the Weak Paralytic Poison Dirty Tricks
90 Shuriken Toss Versatility Anticipation

Profile

#!./simc

rogue="Rogue_Subtlety_T14H"
origin="unknown"
level=90
race=troll
spec=subtlety
role=attack
position=back
professions=jewelcrafting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#cb!200002

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/apply_poison,lethal=deadly
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion
actions.precombat+=/stealth
actions.precombat+=/premeditation
actions.precombat+=/slice_and_dice

actions=virmens_bite_potion,if=buff.bloodlust.react|target.time_to_die<40
actions+=/preparation,if=talent.preparation.enabled&!buff.vanish.up&cooldown.vanish.remains>60
actions+=/auto_attack
actions+=/kick
actions+=/shadow_blades
actions+=/pool_resource,for_next=1,extra_amount=75
actions+=/shadow_dance,if=energy>=75&buff.stealthed.down&!target.debuff.find_weakness.up
actions+=/use_item,name=bonebreaker_gauntlets,if=buff.shadow_dance.up
actions+=/berserking,if=buff.shadow_dance.up
actions+=/pool_resource,for_next=1,extra_amount=30
actions+=/vanish,if=time>10&energy>=45&energy<=75&combo_points<=3&!buff.shadow_dance.up&!buff.master_of_subtlety.up&!target.debuff.find_weakness.up
actions+=/premeditation,if=(combo_points<=3&cooldown.honor_among_thieves.remains>1.75)|combo_points<=2
actions+=/ambush,if=combo_points<=5&anticipation_charges=0
actions+=/slice_and_dice,if=buff.slice_and_dice.remains<3&combo_points=5
actions+=/rupture,if=combo_points=5&dot.rupture.remains<5
actions+=/ambush,if=anticipation_charges<3&buff.shadow_dance.remains<=2
actions+=/eviscerate,if=combo_points=5
actions+=/hemorrhage,if=combo_points<4&(dot.hemorrhage.remains<4|position_front)
actions+=/hemorrhage,if=combo_points<5&energy>80&(dot.hemorrhage.remains<4|position_front)
actions+=/backstab,if=combo_points<4&(cooldown.shadow_dance.remains>7|(cooldown.shadow_dance.remains=0&time<=9))
actions+=/tricks_of_the_trade
actions+=/backstab,if=combo_points<5&energy>80&cooldown.shadow_dance.remains>=2

head=helmet_of_the_thousandfold_blades,id=87126,gems=agile_primal_80agi_160hit_180agi,reforge=mastery_hit
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=spaulders_of_the_thousandfold_blades,id=87128,gems=80agi_160hit_60agi,enchant=200agi_100crit
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=mastery_haste
chest=tunic_of_the_thousandfold_blades,id=87124,gems=80agi_160haste_80agi_160haste_120mastery,enchant=80all,reforge=mastery_haste
wrists=bracers_of_unseen_strikes,id=86954,enchant=180agi,reforge=crit_mastery
hands=bonebreaker_gauntlets,id=86964,gems=80agi_160hit_60haste,enchant=170haste,addon=synapse_springs_mark_ii
waist=stalkers_cord_of_eternal_autumn,id=87180,gems=320agi_160agi,reforge=crit_haste
legs=legguards_of_the_thousandfold_blades,id=87127,gems=160agi_60agi,enchant=285agi_165crit
feet=boots_of_the_still_breath,id=86943,gems=320agi,enchant=140agi
finger1=regails_band_of_the_endless,id=90503
finger2=painful_thorned_ring,id=86974,reforge=mastery_haste
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=spiritsever,id=87166,gems=500agi,enchant=dancing_steel,reforge=mastery_haste
off_hand=spiritsever,id=87166,enchant=dancing_steel,reforge=mastery_haste

# Gear Summary
# gear_strength=80
# gear_agility=18042
# gear_stamina=20068
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2600
# gear_hit_rating=2558
# gear_crit_rating=3997
# gear_haste_rating=6122
# gear_mastery_rating=2876
# gear_armor=18586
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=bonebreaker_gauntlets,heroic=1,addon=synapse_springs_mark_ii
# main_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel
# off_hand=spiritsever,heroic=1,weapon=dagger_1.80speed_4713min_8753max,enchant=dancing_steel

Shaman_Elemental_T14H : 102618 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
102618.1 102618.1 58.60 / 0.06% 4933 / 4.8% 33.9 2736.7 2714.7 Mana 0.00% 44.5 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://8.chart.apis.google.com/chart?chs=550x180&cht=bhg&chf=bg,s,333333&chd=t:182456|128629|112107|56028|30237&chds=0,364912&chco=C41F3B,C41F3B,00FF96,ABD473,ABD473&chm=t++182456++lava_burst,C41F3B,0,0,15|t++128629++flame_shock,C41F3B,1,0,15|t++112107++elemental_blast,00FF96,2,0,15|t++56028++lightning_bolt,ABD473,3,0,15|t++30237++earth_shock,ABD473,4,0,15&chtt=Shaman_Elemental_T14H Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:29,20,10,9,9,6,6,6,3,3,2,2,1,1,1,1,1,0,0,0,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,C41F3B,ABD473,00FF96,C41F3B,ABD473,C41F3B,00FF96,ABD473,C41F3B,C41F3B,C79C6E,ABD473,C41F3B,00FF96,C41F3B,ABD473,00FF96,ABD473,C41F3B&chl=lava_burst|lightning_bolt|lava_burst_overload|fulmination|elemental_blast|greater_fire_elemental: fire_melee|lightning_bolt_overload|flame_shock|elemental_blast_overload|earth_shock|searing_totem: searing_bolt|lava_burst_eoe|greater_earth_elemental: earth_melee|lightning_bolt_eoe|lava_burst_overload_eoe|elemental_blast_eoe|greater_fire_elemental: fire_blast|lightning_bolt_overload_eoe|elemental_blast_overload_eoe|earth_shock_eoe|flame_shock_eoe&chtt=Shaman_Elemental_T14H Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:lortvwyyz01367867530yxvtrpnljigedcccbbaaabbaaaaZYXVVUUTUUVWVWWVVVVVVVVWYYYYYYXWWWVUUUUUUUUTTSSSSSSSSTTUVVUTTSSSSSSSTTTTTTTTTTTTTTUUVVWWVVVUUUUUUUUUVVVVUUUUUUUUUVVVUUUTTTTTSSRSRRSSTTUWXYZabcdefhjkjjjiihgfedcbaZZYXWVUTTTTTSSTTUUUUUTSSSSRRRSTTUVVUUUUUUUUUVVWWWWWVVUTTTTTTUUUUUUUTTSSSSTUUVVVVVUUUTTSTTUVWWWWWWWWVWWWXYYZaaaZZZZYYYYZZaabbaZYYYYYYYYYZZZZZYYXWVVVVWVVVVUUTSS&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=102618|max=254167&chxp=1,1,40,100&chtt=Shaman_Elemental_T14H DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,0,2,0,8,9,19,28,33,59,94,143,171,229,276,346,499,504,532,586,642,601,671,660,602,542,551,437,407,310,272,192,169,124,84,66,36,31,25,10,14,3,3,0,1,1,0,0,2&chds=0,671&chbh=5&chxt=x&chxl=0:|min=90998|avg=102618|max=115872&chxp=0,1,47,100&chtt=Shaman_Elemental_T14H DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:45.5,21.2,10.6,8.5,4.2,1.4,0.6,0.6&chds=0,100&chdls=ffffff&chco=ABD473,C41F3B,00FF96,ABD473,C41F3B,C79C6E,C79C6E,C79C6E&chl=lightning_bolt 166.4s|lava_burst 77.4s|elemental_blast 38.8s|earth_shock 31.2s|flame_shock 15.4s|searing_totem 5.1s|earth_elemental_totem 2.1s|fire_elemental_totem 2.1s&chtt=Shaman_Elemental_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Elemental_T14H 102618
ascendance 0 0.0% 2.0 180.98sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 3.0 120.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 301.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 2439 (2580) 2.4% (2.5%) 25.8 13.05sec 36547 30237 26818 69788 34543 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.84 25.84 0.00 0.00 1.2087 0.0000 892679.52 892679.52 0.00 30237.04 30237.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.20 82.02% 26818.02 24039 35670 26819.86 25314 28228 568439 568439 0.00
crit 4.65 17.98% 69788.20 62260 92385 69380.63 0 87982 324240 324240 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 141 0.1% 1.5 95.95sec 33517 0 26063 67764 33517 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.54 1.54 0.00 0.00 0.0000 0.0000 51774.52 51774.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.27 82.13% 26063.39 24039 34233 18845.87 0 34233 33064 33064 0.00
crit 0.28 17.87% 67763.89 62260 92385 16546.73 0 92385 18710 18710 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lightning_shield.react=buff.lightning_shield.max_stack
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
elemental_blast 8224 (11892) 8.0% (11.6%) 24.0 15.29sec 181068 112107 96752 251981 125877 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.04 23.91 0.00 0.00 1.6151 0.0000 3010064.69 3010064.69 0.00 112107.12 112107.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.43 81.24% 96751.53 83944 125881 96752.36 91334 101920 1879502 1879502 0.00
crit 4.49 18.76% 251981.20 217415 326032 250317.57 0 326032 1130563 1130563 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_eoe 491 0.5% 1.4 101.16sec 126299 0 97029 253066 126709 19.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.42 1.42 0.00 0.00 0.0000 0.0000 179530.43 179530.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.15 80.98% 97029.15 83944 132362 66978.59 0 132362 111327 111327 0.00
crit 0.27 19.02% 253065.65 217415 342818 59699.98 0 342818 68203 68203 0.00
DPS Timeline Chart

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:12.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.elemental_blast.enabled&!buff.ascendance.up
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage and increasing the caster's Critical Strike, Haste, or Mastery by $118522s1 for $118522d.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.112000
  • base_dd_min:4371.08
  • base_dd_max:5079.90
elemental_blast_overload 2998 2.9% 11.6 29.90sec 94331 0 72859 189971 94685 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.63 11.59 0.00 0.00 0.0000 0.0000 1097085.95 1097085.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.43 81.36% 72859.03 62958 99272 72857.21 64532 83029 686869 686869 0.00
crit 2.16 18.64% 189971.17 163062 257114 170340.12 0 257114 410217 410217 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
elemental_blast_overload_eoe 179 0.2% 0.7 108.45sec 94387 0 72676 189709 94741 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: elemental_blast_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.70 0.69 0.00 0.00 0.0000 0.0000 65653.61 65653.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.56 81.15% 72676.35 62958 99272 31509.65 0 99272 40868 40868 0.00
crit 0.13 18.85% 189708.82 163062 257114 23101.78 0 257114 24786 24786 0.00
DPS Timeline Chart

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast
  • school:elemental
  • tooltip:(null)
  • description:Harness and direct the raw power of the elements towards an enemy target, dealing $s1 Elemental damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.584000
  • base_dd_min:3278.31
  • base_dd_max:3809.92
fire_elemental_totem 0 0.0% 2.0 1.#Rsec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 5382 (5421) 5.2% (5.3%) 12.6 30.34sec 157050 128629 14846 38568 18997 17.5% 0.0% 0.0% 0.0% 156.1 8662 22503 11085 17.5% 0.0% 98.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.63 12.63 156.05 156.05 1.2210 2.3120 1969876.64 1969876.64 0.00 5273.77 128629.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.42 82.50% 14845.93 13453 20147 14848.95 13722 16600 154739 154739 0.00
crit 2.21 17.50% 38567.89 34844 52180 35245.83 0 48223 85258 85258 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.7 82.49% 8661.82 8146 11178 8662.30 8288 9120 1115055 1115055 0.00
crit 27.3 17.51% 22503.02 21098 28951 22505.70 21297 24404 614826 614826 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 39 0.0% 0.8 129.49sec 18584 0 14452 37598 18584 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.77 0.77 0.00 0.00 0.0000 0.0000 14226.07 14226.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.63 82.15% 14452.02 13453 19161 6887.43 0 19161 9088 9088 0.00
crit 0.14 17.85% 37597.66 34844 49628 4823.30 0 49628 5138 5138 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:5.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking&num_targets<3
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
fulmination 8768 8.5% 25.8 13.05sec 124173 0 96325 250580 124173 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fulmination

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.84 25.84 0.00 0.00 0.0000 0.0000 3208906.42 3208906.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.18 81.95% 96324.76 60617 136990 96352.43 84123 103663 2039857 2039857 0.00
crit 4.67 18.05% 250580.44 156997 354805 248946.39 0 337450 1169050 1169050 0.00
DPS Timeline Chart

Action details: fulmination

Static Values
  • id:26364
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:26364
  • name:Lightning Shield
  • school:nature
  • tooltip:(null)
  • description:Discharges lightning at an attacker, dealing $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.388000
  • base_dd_min:629.69
  • base_dd_max:629.69
lava_burst 26739 (38605) 26.1% (37.6%) 66.9 5.41sec 211161 182456 0 146392 146392 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.91 66.85 0.00 0.00 1.1573 0.0000 9786378.76 9786378.76 0.00 182456.10 182456.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 66.85 100.00% 146392.14 121234 192255 146400.30 142477 151637 9786379 9786379 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_eoe 1574 1.5% 4.0 66.61sec 144057 0 50944 144390 144226 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 3.99 0.00 0.00 0.0000 0.0000 576096.68 576096.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.01 0.18% 50943.88 46808 59899 356.75 0 59899 357 357 0.00
crit 3.99 99.82% 144389.99 121234 192255 142165.30 0 192255 575740 575740 0.00
DPS Timeline Chart

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4620.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1657.82
  • base_dd_max:2131.48
lava_burst_overload 9695 9.4% 32.7 10.87sec 108351 0 38665 108697 108581 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.75 32.68 0.00 0.00 0.0000 0.0000 3548403.39 3548403.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.05 0.17% 38665.33 35106 50276 2006.26 0 50276 2089 2089 0.00
crit 32.63 99.83% 108696.80 90925 144191 108702.85 98952 120055 3546315 3546315 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lava_burst_overload_eoe 598 0.6% 2.0 89.93sec 111255 0 40809 111592 111476 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_burst_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.97 1.96 0.00 0.00 0.0000 0.0000 218704.04 218704.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.00 0.16% 40808.52 35106 50685 130.64 0 50685 131 131 0.00
crit 1.96 99.84% 111592.00 90925 144191 96385.94 0 144191 218573 218573 0.00
DPS Timeline Chart

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst
  • school:fire
  • tooltip:(null)
  • description:You hurl molten lava at the target, dealing $s1 Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:1243.37
  • base_dd_max:1598.61
lightning_bolt 18195 (25469) 17.7% (24.8%) 108.5 3.14sec 85936 56028 47935 124659 61455 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.47 108.36 0.00 0.00 1.5338 0.0000 6659240.25 6659240.25 0.00 56028.21 56028.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.26 82.38% 47934.64 42194 63523 47939.74 46889 49224 4278862 4278862 0.00
crit 19.10 17.62% 124658.86 109281 164523 124616.19 115648 136659 2380378 2380378 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 1062 1.0% 6.5 44.29sec 59604 0 46567 121237 59636 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.52 6.52 0.00 0.00 0.0000 0.0000 388873.78 388873.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.38 82.50% 46567.23 42194 63523 46356.29 0 60858 250511 250511 0.00
crit 1.14 17.50% 121237.40 109281 164523 83078.37 0 164523 138363 138363 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_overload 5861 5.7% 50.5 6.71sec 42494 0 33312 86655 42608 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.48 50.35 0.00 0.00 0.0000 0.0000 2145293.04 2145293.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.58 82.57% 33311.60 30139 45374 33311.77 31888 34919 1384934 1384934 0.00
crit 8.77 17.43% 86655.41 78059 117518 86665.28 78059 100731 760359 760359 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
lightning_bolt_overload_eoe 351 0.3% 3.0 72.68sec 42724 0 33355 86808 42778 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_overload_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.01 3.00 0.00 0.00 0.0000 0.0000 128397.99 128397.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.47 82.37% 33355.19 30139 45374 30601.78 0 43471 82467 82467 0.00
crit 0.53 17.63% 86807.73 78059 112589 35757.94 0 112589 45931 45931 0.00
DPS Timeline Chart

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.513000
  • base_dd_min:823.99
  • base_dd_max:941.38
searing_totem 0 0.0% 4.9 74.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 4.93 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=2&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
pet - greater_fire_elemental 19762 / 6479
fire_blast 1448 0.5% 20.0 18.75sec 8685 0 6799 17169 8685 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 0.0000 0.0000 173705.58 173705.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.36 81.81% 6798.79 6103 8922 6798.10 6253 7253 111239 111239 0.00
crit 3.64 18.19% 17168.53 15259 22304 16897.05 0 22304 62467 62467 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 18315 5.9% 105.3 3.40sec 20868 22147 17108 43290 20868 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.32 105.32 0.00 0.00 0.9423 0.0000 2197766.03 2197766.03 0.00 22146.64 22146.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.82 57.75% 17108.03 15391 21961 17107.42 16426 17714 1040535 1040535 0.00
crit 19.21 18.24% 43290.48 38478 54902 43292.11 38716 48522 831761 831761 0.00
glance 25.28 24.01% 12873.12 11544 16471 12872.93 11845 14050 325470 325470 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 3895 / 1109
earth_melee 3895 1.1% 63.5 5.48sec 6398 4533 5730 11508 6398 17.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.47 63.47 0.00 0.00 1.4114 0.0000 406070.13 406070.13 0.00 4533.25 4533.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.13 58.50% 5730.19 5478 7529 5724.72 5522 6152 212769 212769 0.00
crit 11.10 17.50% 11507.87 10955 15059 11493.76 10955 13364 127791 127791 0.00
glance 15.23 24.00% 4301.07 4108 5647 4296.12 4108 4962 65510 65510 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3683 / 2294
searing_bolt 3683 2.2% 140.2 2.09sec 5988 0 4701 12222 6022 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.19 139.40 0.00 0.00 0.0000 0.0000 839483.55 839483.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.91 82.43% 4700.94 4185 6029 4700.63 4562 4814 540187 540187 0.00
crit 24.49 17.57% 12222.02 10840 15615 12221.70 11362 13275 299296 299296 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.0 0.0 181.0sec 181.0sec 8.20% 8.20%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:8.2%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 3.0 0.0 120.8sec 120.8sec 12.30% 12.30%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:12.3%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 17.35%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
elemental_blast_crit 8.5 0.0 39.4sec 39.4sec 17.35% 17.35%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_crit
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_crit_1:17.4%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_haste 8.5 0.0 39.5sec 39.5sec 17.35% 17.35%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_haste_1:17.3%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_blast_mastery 8.5 0.0 39.3sec 39.3sec 17.47% 17.47%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:mastery_rating
    • amount:3500.37

    Stack Uptimes

    • elemental_blast_mastery_1:17.5%

Spelldata details

  • id:118522
  • name:Elemental Blast
  • tooltip:$?$w1!=0[Critical Strike increased by $w1.][]$?$w2!=0[Haste increased by $w2.][]$?$w3!=0[Mastery increased by $w3.][]
  • description:Increases Critical Strike, Haste, or Mastery.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
elemental_focus 53.0 47.8 6.9sec 3.6sec 57.93% 59.21%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • elemental_focus_1:29.8%
  • elemental_focus_2:28.2%

Spelldata details

  • id:16246
  • name:Clearcasting
  • tooltip:Your next $n spells have their mana cost reduced by $s1%. Spell damage increased by $s2%. Single-target healing done increased by $s4%.
  • description:After landing a critical strike with a Fire, Frost, or Nature damage spell, you enter a Clearcasting state. The Clearcasting state reduces the mana cost of your next $16246n spells by $16246s1%, increases your spell damage by $s2%, and increases single-target healing done by $s4%.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 6.0 0.0 64.8sec 64.8sec 32.59% 32.59%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.6%
jade_serpent_potion 2.0 0.0 301.9sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 6.8 0.0 57.1sec 57.1sec 21.95% 21.68%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.0%
lightning_shield 1.0 97.1 0.0sec 3.5sec 100.00% 100.00%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:7
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:33.3%
  • lightning_shield_3:23.5%
  • lightning_shield_5:21.0%
  • lightning_shield_7:22.1%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 7.0 0.0 53.7sec 53.7sec 28.68% 28.68%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.7%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.0 0.0 61.4sec 61.4sec 16.39% 16.39%

Buff details

  • buff initial source:Shaman_Elemental_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.4%
earth_elemental_totem-stunned 4.1 0.0 100.8sec 0.0sec 3.96% 3.96%

Buff details

  • buff initial source:Shaman_Elemental_T14H_earth_elemental_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.1%
fire_elemental_totem-stunned 5.0 0.0 78.8sec 0.0sec 3.91% 3.91%

Buff details

  • buff initial source:Shaman_Elemental_T14H_fire_elemental_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.3%
greater_earth_elemental-stunned 4.1 0.0 100.8sec 0.0sec 3.96% 3.96%

Buff details

  • buff initial source:Shaman_Elemental_T14H_greater_earth_elemental
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.1%
greater_fire_elemental-stunned 5.0 0.0 78.8sec 0.0sec 3.91% 3.91%

Buff details

  • buff initial source:Shaman_Elemental_T14H_greater_fire_elemental
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.3%
searing_totem-stunned 9.0 0.0 24.4sec 0.0sec 3.95% 3.95%

Buff details

  • buff initial source:Shaman_Elemental_T14H_searing_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:2.5%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Elemental_T14H
ascendance Mana 2.0 6270.0 3120.0 3120.0 0.0
bloodlust Mana 0.0 69.7 12900.0 12900.0 0.0
earth_elemental_totem Mana 2.0 33720.0 16860.0 16860.0 0.0
earth_shock Mana 25.8 195273.4 7556.4 7556.4 4.8
fire_elemental_totem Mana 2.0 32278.0 16139.0 16139.0 0.0
flame_shock Mana 12.6 81883.8 6481.5 6481.5 24.2
lava_burst Mana 66.9 256444.5 3832.5 3832.5 55.1
lightning_bolt Mana 108.5 378249.2 3487.0 3487.0 24.6
searing_totem Mana 4.9 17458.8 3540.0 3540.0 0.0
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 506583.94 346.26 42041.06 7.66%
rolling_thunder Mana 97.15 487007.96 5012.98 95888.20 16.45%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 2714.73 2736.74
Combat End Resource Mean Min Max
Health -6346566.00 -6346566.00 -6346566.00
Mana 291679.52 256097.00 300000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
spirit_wolf-Mana Cap 3.1%
primal_fire_elemental-Mana Cap 3.1%
primal_earth_elemental-Mana Cap 3.1%
earth_elemental_totem-Mana Cap 3.1%
magma_totem-Mana Cap 3.1%
stormlash_totem-Mana Cap 3.1%

Procs

Count Interval
hat_donor 27.3 12.9sec
lava_surge 31.2 11.3sec
lightning_shield_too_fast_fill 4.1 66.6sec
rolling_thunder 97.1 3.5sec
wasted_lightning_shield 32.3 19.7sec
wasted_lightning_shield_shock_cd 8.1 66.6sec
fulmination_4 2.0 89.2sec
fulmination_6 23.9 14.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 102618.06
Minimum 90998.48
Maximum 115871.88
Spread ( max - min ) 24873.40
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 2989.2189
5th Percentile 97739.97
95th Percentile 107606.37
( 95th Percentile - 5th Percentile ) 9866.41
Mean Distribution
Standard Deviation 29.8982
95.00% Confidence Intervall ( 102559.46 - 102676.66 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 32
0.1% Error 3259
0.1 Scale Factor Error with Delta=300 76277
0.05 Scale Factor Error with Delta=300 305111
0.01 Scale Factor Error with Delta=300 7627796
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 102618.06

Damage

Sample Data
Count 9996
Mean 33941185.78

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 271.19
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 flametongue_weapon,weapon=main
3 0.00 lightning_shield,if=!buff.lightning_shield.up
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 wind_shear
7 0.01 bloodlust,if=target.health.pct<25|time>5
8 1.00 jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
9 0.00 run_action_list,name=single,if=num_targets=1
A 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
L 6.00 use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
M 3.00 blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
N 0.00 elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
O 2.00 fire_elemental_totem,if=!active
P 2.01 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
Q 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
R 0.00 unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
S 12.63 flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
T 69.09 lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
U 24.57 elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
V 23.34 earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
W 2.51 earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
X 2.00 earth_elemental_totem,if=!active
Y 4.93 searing_totem,if=!totem.fire.active
Z 0.00 spiritwalkers_grace,moving=1
a 0.00 unleash_elements,moving=1
b 118.11 lightning_bolt

Sample Sequence

OLSTUMPTTTTTTTTTTTTTTTUTXbbSTbbTVbUbTbbbbbVbTUbWbbSTYLbTUVbbbbTVbbUbbTVbbbSbTUTbbVbbbTUVbTbbSTLYUbMbVbTbbbUVbTbbVbbTSUbbTbVbbbTUVbbbbTbSUYbPLTTTTTTTTTTTTUVbbbbSTbTbUVbTbbTVbUbTbWbbbSTULMYVTbbbbbTUVbbbTbSbbUVbTbbTbbTUVbbbbTVO8bUSbLTbVbbbTUbVXbbTWbbUSTbbbbVbTbUbbbbTbWYUbS

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 180 171 80
Stamina 22664 20604 20442
Intellect 22230 19806 18716
Spirit 5351 5351 5180
Health 463699 434859 0
Mana 300000 300000 0
Spell Power 33139 27703 7907
Spell Hit 15.24% 15.24% 0
Spell Crit 18.87% 12.91% 1735
Spell Haste 18.78% 13.13% 5579
Mana Per 5 7500 7500 0
Attack Power 788 687 0
Melee Hit 15.24% 15.24% 0
Melee Crit 10.95% 5.95% 1735
Melee Haste 13.13% 13.13% 5579
Swing Speed 24.44% 13.13% 5579
Expertise 0.00% 0.00% 0
Armor 43524 43524 43524
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.62% 34.62% 5585

Gear

Average Item Level: 507.81
Head firebirds_headpiece,id=87141,gems=burning_primal_80int_160spi_180int
Neck korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
Shoulders firebirds_shoulderwraps,id=87143,gems=160int,enchant=200int_100crit
Shirt empty
Chest mail_of_screaming_secrets,id=86951,gems=160int_80int_160mastery_120int,enchant=80all
Waist binders_chain_of_unending_summer,id=87183,gems=160int_160int
Legs firebirds_kilt,id=87142,gems=160int_60int,enchant=285int_165spi
Feet lightning_prisoners_boots,id=90515,gems=160int,enchant=170haste,reforge=spi_mastery
Wrists bracers_of_tempestuous_fury,id=86962,enchant=180int,reforge=spi_mastery
Hands firebirds_gloves,id=87140,enchant=170mastery,addon=synapse_springs_mark_ii
Finger1 seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
Finger2 watersoul_signet,id=90511,enchant=160int,reforge=spi_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=90512,enchant=180int
Main Hand kritak_imperial_scepter_of_the_swarm,id=86990,gems=500int,enchant=jade_spirit
Off Hand eye_of_the_ancient_spirit,id=87039,enchant=165int,reforge=spi_mastery
Unknown empty
Tabard empty

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Elemental_T14H"
origin="unknown"
level=90
race=orc
spec=elemental
role=spell
position=back
professions=enchanting=600/engineering=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Wa!...2.2
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/flametongue_weapon,weapon=main
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/jade_serpent_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=ascendance
actions.ae+=/lava_beam
actions.ae+=/magma_totem,if=num_targets>2&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=2&!totem.fire.active
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking&num_targets<3
actions.ae+=/lava_burst,if=num_targets<3&dot.flame_shock.remains>cast_time&cooldown_react
actions.ae+=/earthquake,if=num_targets>4
actions.ae+=/thunderstorm,if=mana.pct_nonproc<80
actions.ae+=/chain_lightning,if=mana.pct_nonproc>10
actions.ae+=/lightning_bolt

actions.single=use_item,name=firebirds_gloves,if=((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)|buff.ascendance.up|buff.bloodlust.up|totem.fire_elemental_totem.active
actions.single+=/blood_fury,if=buff.bloodlust.up|buff.ascendance.up|((cooldown.ascendance.remains>10|level<87)&cooldown.fire_elemental_totem.remains>10)
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled&time>15&((!buff.bloodlust.up&time<120)|(!buff.berserking.up&!buff.bloodlust.up&buff.ascendance.up)|(time>=200&(cooldown.ascendance.remains>30|level<87)))
actions.single+=/fire_elemental_totem,if=!active
actions.single+=/ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(target.time_to_die<20|buff.bloodlust.up|time>=180)
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&!buff.ascendance.up
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled&!buff.ascendance.up
actions.single+=/flame_shock,if=!buff.ascendance.up&(!ticking|ticks_remain<2|((buff.bloodlust.up|buff.elemental_mastery.up)&ticks_remain<3))
actions.single+=/lava_burst,if=dot.flame_shock.remains>cast_time&(buff.ascendance.up|cooldown_react)
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled&!buff.ascendance.up
actions.single+=/earth_shock,if=buff.lightning_shield.react=buff.lightning_shield.max_stack
actions.single+=/earth_shock,if=buff.lightning_shield.react>3&dot.flame_shock.remains>cooldown&dot.flame_shock.remains<cooldown+action.flame_shock.tick_time
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/unleash_elements,moving=1
actions.single+=/lightning_bolt

head=firebirds_headpiece,id=87141,gems=burning_primal_80int_160spi_180int
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_mastery
shoulders=firebirds_shoulderwraps,id=87143,gems=160int,enchant=200int_100crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int
chest=mail_of_screaming_secrets,id=86951,gems=160int_80int_160mastery_120int,enchant=80all
wrists=bracers_of_tempestuous_fury,id=86962,enchant=180int,reforge=spi_mastery
hands=firebirds_gloves,id=87140,enchant=170mastery,addon=synapse_springs_mark_ii
waist=binders_chain_of_unending_summer,id=87183,gems=160int_160int
legs=firebirds_kilt,id=87142,gems=160int_60int,enchant=285int_165spi
feet=lightning_prisoners_boots,id=90515,gems=160int,enchant=170haste,reforge=spi_mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=watersoul_signet,id=90511,enchant=160int,reforge=spi_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=kritak_imperial_scepter_of_the_swarm,id=86990,gems=500int,enchant=jade_spirit
off_hand=eye_of_the_ancient_spirit,id=87039,enchant=165int,reforge=spi_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20442
# gear_intellect=18716
# gear_spirit=5180
# gear_spell_power=7907
# gear_crit_rating=1735
# gear_haste_rating=5579
# gear_mastery_rating=5585
# gear_armor=43524
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=firebirds_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=kritak_imperial_scepter_of_the_swarm,heroic=1,weapon=mace_2.40speed_3142min_5835max,enchant=jade_spirit

Shaman_Enhancement_T14H : 115157 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
115156.9 115156.9 50.09 / 0.04% 4198 / 3.6% 74.6 1309.0 1300.8 Mana 16.05% 41.1 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
Glyphs
  • chain_lightning
  • flame_shock

Charts

http://7.chart.apis.google.com/chart?chs=550x360&cht=bhg&chf=bg,s,333333&chd=t:190474|182263|97573|68847|66881|51877|40767|39700|19382|9875|4758&chds=0,380948&chco=ABD473,C41F3B,C41F3B,ABD473,C79C6E,ABD473,ABD473,ABD473,ABD473,C79C6E,C79C6E&chm=t++190474++stormblast,ABD473,0,0,15|t++182263++flame_shock,C41F3B,1,0,15|t++97573++lava_lash,C41F3B,2,0,15|t++68847++lightning_bolt,ABD473,3,0,15|t++66881++stormstrike,C79C6E,4,0,15|t++51877++earth_shock,ABD473,5,0,15|t++40767++unleash_elements,ABD473,6,0,15|t++39700++windlash_main_hand,ABD473,7,0,15|t++19382++windlash_off_hand,ABD473,8,0,15|t++9875++melee_main_hand,C79C6E,9,0,15|t++4758++melee_off_hand,C79C6E,10,0,15&chtt=Shaman_Enhancement_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,12,11,10,8,7,7,6,6,5,4,4,3,3,3,2,2,2,2,2,2,2,1,1,1,1,0&chds=0,100&chdls=ffffff&chco=C41F3B,ABD473,ABD473,C41F3B,C79C6E,C79C6E,C41F3B,C79C6E,C41F3B,ABD473,C79C6E,C79C6E,ABD473,ABD473,C41F3B,ABD473,C41F3B,C79C6E,ABD473,C79C6E,ABD473,ABD473,C79C6E,ABD473,C41F3B,C41F3B,C41F3B&chl=lava_lash|lightning_shield|lightning_bolt|greater_fire_elemental: fire_melee|stormstrike_mh|melee_main_hand|flame_shock|windfury_mh|flametongue_oh|earth_shock|stormstrike_oh|melee_off_hand|lightning_bolt_eoe|windlash_main_hand|searing_totem: searing_bolt|stormblast_mh|unleash_flame|spirit_wolf: melee|spirit_wolf: spirit_bite|greater_earth_elemental: earth_melee|earth_shock_eoe|windlash_off_hand|unleash_wind|stormblast_oh|greater_fire_elemental: fire_blast|unleash_flame_eoe|flame_shock_eoe&chtt=Shaman_Enhancement_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:wwvvxzz034456767840yyxxxxvsromkkjihgfffffgffeddbbbaZaaaabdddccccbbccddddddddddcbaZZYYYYYYYXXWWVVUUTTUUVVUUUUUUUUUUUTTUUVWWXXWXXXXXXYYYZZaabbaaZZZZaaZZZZaaaZZYXXWVVWWVWWWVUUUUTTUUUVWXZabbcdddeffffgggghgfeddbbaZZYYYYXWWWVVUUUTTTTTTTUUUUUUVVUVVVVWWXXYYYYYYYYYYYYZYYZZZZZZZYYYYYYXXYYYXYYXWWWVVVVVVVVVWWWWWXXXXWWXYZZaaaabbbbbbbccddffeeeecccccccddddcccbbbaZZZbbbbbbbbbaaaZ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=115157|max=251892&chxp=1,1,46,100&chtt=Shaman_Enhancement_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,1,1,1,4,3,14,17,25,31,53,57,85,107,157,164,260,265,298,403,451,488,505,611,557,616,581,522,557,508,383,404,391,318,252,227,180,130,103,75,53,46,29,26,16,6,4,5,4,1&chds=0,616&chbh=5&chxt=x&chxl=0:|min=105455|avg=115157|max=124252&chxp=0,1,52,100&chtt=Shaman_Enhancement_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:21.1,16.5,13.9,12.5,8.5,4.1,1.7,1.5,1.0,0.6,0.6,16.0&chds=0,100&chdls=ffffff&chco=ABD473,C79C6E,C41F3B,ABD473,ABD473,C41F3B,ABD473,C79C6E,ABD473,C79C6E,C79C6E,ffffff&chl=lightning_bolt 77.1s|stormstrike 60.2s|lava_lash 50.8s|earth_shock 45.6s|unleash_elements 31.0s|flame_shock 14.9s|stormblast 6.1s|searing_totem 5.3s|feral_spirit 3.7s|earth_elemental_totem 2.1s|fire_elemental_totem 2.1s|waiting 58.7s&chtt=Shaman_Enhancement_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Shaman_Enhancement_T14H 115157
ascendance 0 0.0% 2.0 182.62sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: ascendance

Static Values
  • id:114049
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:3120.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.strike.remains>=3
Spelldata
  • id:114049
  • name:Ascendance
  • school:physical
  • tooltip:(null)
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, gaining the ability to transform into a being of raw elemental energy for $114051d. |CFFFFFFFFElemental:|R While in the form of a Flame Ascendant, Lava Burst has no cooldown and Chain Lightning is empowered to become Lava Beam. |CFFFFFFFFEnhancement:|R While in the form of an Air Ascendant, autoattacks and Stormstrike deal pure Nature damage and have a 30-yard range. |CFFFFFFFFRestoration:|R While in the form of a Water Ascendant, all healing done is duplicated and distributed evenly among nearby allies.
blood_fury 0 0.0% 4.0 120.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33697
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33697
  • name:Blood Fury
  • school:physical
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
earth_elemental_totem 0 0.0% 2.0 302.05sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0390 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: earth_elemental_totem

Static Values
  • id:2062
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16860.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active
Spelldata
  • id:2062
  • name:Earth Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons an Earth Totem with $s1 health at the feet of the caster, calling forth a Greater Earth Elemental to protect the caster and $ghis:her; allies. Lasts $d.
earth_shock 4970 (6468) 4.3% (5.6%) 35.4 10.15sec 66899 51877 32166 66830 51408 55.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.39 35.39 0.00 0.00 1.2896 0.0000 1819091.78 1819091.78 0.00 51876.96 51876.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.74 44.49% 32166.20 28637 46962 32163.94 29617 35276 506396 506396 0.00
crit 19.64 55.51% 66829.53 58993 96742 66837.05 61689 72382 1312696 1312696 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
earth_shock_eoe 1498 1.3% 10.7 31.70sec 51443 0 32168 66795 51443 55.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.66 10.66 0.00 0.00 0.0000 0.0000 548157.64 548157.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.72 44.34% 32167.59 28637 46962 31952.08 0 44500 151969 151969 0.00
crit 5.93 55.66% 66795.44 58993 96742 66705.76 0 87315 396189 396189 0.00
DPS Timeline Chart

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:8640.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:(null)
  • description:Instantly shocks the target with concussive force, causing $s2 Nature damage and applying the Weakened Blows effect. |Tinterface\icons\ability_warrior_warcry.blp:24|t |cFFFFFFFFWeakened Blows|r Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.581000
  • base_dd_min:2034.97
  • base_dd_max:2249.18
feral_spirit 0 0.0% 3.0 122.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 1.2333 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7200.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:(null)
  • description:Summons two Spirit Wolves that aid the Shaman in battle, lasting $d. Spirit Wolves' attacks heal them and their master for $<percent>% of damage done.
fire_elemental_totem 0 0.0% 2.0 300.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_elemental_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.0365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: fire_elemental_totem

Static Values
  • id:2894
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:16139.0
  • cooldown:300.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
Spelldata
  • id:2894
  • name:Fire Elemental Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at the feet of the caster, calling forth a Greater Fire Elemental to rain destruction on the caster's enemies. Lasts $d.
flame_shock 7144 (7406) 6.2% (6.4%) 11.5 33.04sec 236545 182263 23895 50078 27936 15.4% 0.0% 0.0% 0.0% 136.3 14408 30199 16838 15.4% 0.0% 93.2%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.46 11.46 136.28 136.28 1.2978 2.5019 2614785.66 2614785.66 0.00 7618.03 182263.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.69 84.56% 23894.73 20660 34467 23889.28 20925 26636 231547 231547 0.00
crit 1.77 15.44% 50077.67 42559 71002 42510.65 0 71002 88583 88583 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.3 84.61% 14408.47 9552 21028 14408.30 13366 15749 1661372 1661372 0.00
crit 21.0 15.39% 30198.57 19676 43317 30167.51 26071 35594 633285 633285 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flame_shock_eoe 262 0.2% 3.4 83.16sec 27866 0 23851 49945 27866 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flame_shock_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.44 3.44 0.00 0.00 0.0000 0.0000 95830.78 95830.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.91 84.61% 23851.42 15892 34467 23087.67 0 32874 69404 69404 0.00
crit 0.53 15.39% 49944.82 32737 71002 20910.54 0 71002 26426 26426 0.00
DPS Timeline Chart

Action details: flame_shock

Static Values
  • id:8050
  • school:fire
  • resource:mana
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7140.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!ticking
Spelldata
  • id:8050
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Instantly sears the target with fire, causing $s1 Fire damage immediately and $o2 Fire damage over $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.449000
  • base_dd_min:1085.52
  • base_dd_max:1085.52
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.210000
  • base_td:290.88
  • num_ticks:10
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
flametongue_oh 5418 4.7% 233.4 1.57sec 8497 0 7241 15228 8497 15.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: flametongue_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 233.37 233.37 0.00 0.00 0.0000 0.0000 1982950.83 1982950.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 196.67 84.28% 7241.49 4927 11554 7241.45 6926 7530 1424202 1424202 0.00
crit 36.69 15.72% 15227.89 10150 23802 15228.21 13487 17097 558749 558749 0.00
DPS Timeline Chart

Action details: flametongue_oh

Static Values
  • id:8024
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8024
  • name:Flametongue Weapon
  • school:fire
  • tooltip:(null)
  • description:Imbue the Shaman's weapon with fire, increasing magical damage done by $10400s2%. Each hit causes $/77;s2 to $/25;s2 additional Fire damage, based on the speed of the weapon. Slower weapons cause more fire damage per swing. Lasts 60 minutes.$?s73680[ Unleashing this enchantment deals $73683s1 Fire damage to an enemy target and increases the damage dealt by the Shaman's next Fire spell by $73683s2%.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:224.53
  • base_dd_max:224.53
improved_lava_lash 0 0.0% 31.9 11.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: improved_lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
DPS Timeline Chart

Action details: improved_lava_lash

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
lava_lash 13547 11.8% 32.9 11.01sec 150514 97573 108620 226452 150514 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.94 32.94 0.00 0.00 1.5426 0.0000 4958147.58 4958147.58 0.00 97572.52 97572.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.23 64.45% 108620.05 97621 135855 108606.97 103820 112435 2305927 2305927 0.00
crit 11.71 35.55% 226451.64 199892 279861 226502.15 212012 247616 2652221 2652221 0.00
DPS Timeline Chart

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:2400.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.ticking
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:(null)
  • description:You charge your off-hand weapon with lava, instantly dealing $s1% of that weapon's damage to an enemy target$?s55444[][ and spreading your Flame Shock from the target to up to four enemies within $105792A1 yards]. Damage is increased by $s2% if your off-hand weapon is enchanted with Flametongue.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.50
lightning_bolt 11198 (14510) 9.7% (12.6%) 60.0 6.01sec 88503 68847 42685 88795 68310 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.00 60.00 0.00 0.00 1.2855 0.0000 4098482.96 4098482.96 0.00 68846.86 68846.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.66 44.43% 42684.91 31490 68983 42684.98 38177 47305 1137778 1137778 0.00
crit 33.34 55.57% 88794.78 64869 142104 88807.80 80488 97391 2960705 2960705 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_bolt_eoe 3312 2.9% 17.7 19.70sec 68545 0 42778 89123 68559 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_bolt_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.68 17.68 0.00 0.00 0.0000 0.0000 1212019.83 1212019.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.84 44.37% 42778.13 31490 68983 42779.02 31490 61198 335566 335566 0.00
crit 9.83 55.63% 89122.73 64869 142104 89152.04 0 114652 876454 876454 0.00
DPS Timeline Chart

Action details: lightning_bolt

Static Values
  • id:403
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4260.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
Spelldata
  • id:403
  • name:Lightning Bolt
  • school:nature
  • tooltip:(null)
  • description:Casts a bolt of lightning at the target for $s1 Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.684000
  • base_dd_min:1098.65
  • base_dd_max:1255.18
lightning_shield 11958 10.4% 135.7 3.04sec 32256 0 20390 42275 32256 54.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: lightning_shield

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.68 135.68 0.00 0.00 0.0000 0.0000 4376459.23 4376459.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.18 44.36% 20390.42 17800 30038 20390.02 19131 21992 1227179 1227179 0.00
crit 74.49 54.91% 42275.34 36669 61878 42275.76 39580 45045 3149281 3149281 0.00
none 1.00 0.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: lightning_shield

Static Values
  • id:324
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:3.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.lightning_shield.up
Spelldata
  • id:324
  • name:Lightning Shield
  • school:nature
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
melee_main_hand 7267 6.3% 169.7 2.16sec 15673 9875 13845 28969 15673 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.69 169.69 0.00 0.00 1.5872 0.0000 2659546.95 2659546.95 0.00 9874.90 9874.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.83 22.29% 13845.04 13096 17644 13844.98 13361 14454 523724 523724 0.00
crit 59.02 34.78% 28969.14 26979 36347 28969.40 28094 29884 1709652 1709652 0.00
glance 40.65 23.96% 10483.83 9822 13233 10483.76 10043 10911 426172 426172 0.00
miss 32.19 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 3609 3.1% 168.6 2.17sec 7832 4758 6920 14477 7832 34.7% 18.9% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 168.63 168.63 0.00 0.00 1.6462 0.0000 1320794.41 1320794.41 0.00 4757.78 4757.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.59 22.29% 6919.63 6548 8822 6919.65 6679 7244 260126 260126 0.00
crit 58.58 34.74% 14476.98 13489 18173 14477.01 14047 15013 847991 847991 0.00
glance 40.60 24.08% 5238.36 4911 6617 5238.19 5068 5479 212678 212678 0.00
miss 31.86 18.90% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
searing_totem 0 0.0% 5.2 63.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_totem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 5.16 0.00 0.00 1.0363 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.16 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: searing_totem

Static Values
  • id:3599
  • school:physical
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:3540.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:num_targets<=5&!totem.fire.active
Spelldata
  • id:3599
  • name:Searing Totem
  • school:physical
  • tooltip:(null)
  • description:Summons a Fire Totem with $s1 health at your feet for $d that repeatedly attacks an enemy within $3606r1 yards for $3606s1 Fire damage.
stormblast 0 (3198) 0.0% (2.8%) 4.0 63.86sec 292616 190474 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.5363 0.0000 0.00 0.00 0.00 190473.91 190473.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormblast

Static Values
  • id:115356
  • school:nature
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5621.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115356
  • name:Stormblast
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Hurl a staggering lightning blast at an enemy, dealing Nature damage equal to $115357s1% weapon damage and granting you an additional $115356s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $115356d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormblast_mh 2130 1.8% 4.0 63.86sec 194881 0 132611 277830 194881 42.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 779522.76 779522.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.28 57.12% 132611.30 115011 154947 128355.62 0 154947 302992 302992 0.00
crit 1.72 42.88% 277830.27 236922 319191 248794.81 0 319191 476531 476531 0.00
DPS Timeline Chart

Action details: stormblast_mh

Static Values
  • id:115357
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Stormblast
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormblast_oh 1068 0.9% 4.0 63.86sec 97735 0 66304 138897 97735 43.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormblast_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 390939.41 390939.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 2.27 56.70% 66304.06 57505 77474 63931.71 0 77474 150385 150385 0.00
crit 1.73 43.30% 138896.98 118461 159596 124801.43 0 159596 240555 240555 0.00
DPS Timeline Chart

Action details: stormblast_oh

Static Values
  • id:115360
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Stormblast Off-Hand
  • school:nature
  • tooltip:(null)
  • description:$@spelldesc115356
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike 0 (11009) 0.0% (9.6%) 39.1 9.40sec 103159 66881 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.06 39.06 0.00 0.00 1.5424 0.0000 0.00 0.00 0.00 66880.51 66880.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:mana
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:5640.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
stormstrike_mh 7341 6.4% 39.1 9.40sec 68794 0 50047 103994 68794 34.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.06 39.06 0.00 0.00 0.0000 0.0000 2686944.85 2686944.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.48 65.25% 50047.09 47315 63057 50044.07 48133 51962 1275435 1275435 0.00
crit 13.57 34.75% 103993.74 97470 129898 104011.90 98718 111450 1411510 1411510 0.00
DPS Timeline Chart

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
stormstrike_oh 3667 3.2% 39.1 9.40sec 34365 0 25025 51995 34365 34.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: stormstrike_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.06 39.06 0.00 0.00 0.0000 0.0000 1342204.49 1342204.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.53 65.37% 25024.51 23658 31529 25022.90 24214 26035 638914 638914 0.00
crit 13.53 34.63% 51994.68 48735 64949 52002.71 48969 56131 703291 703291 0.00
DPS Timeline Chart

Action details: stormstrike_oh

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:(null)
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:3.75
unleash_elements 0 (3450) 0.0% (3.0%) 23.8 15.76sec 52992 40767 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_elements

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.83 23.83 0.00 0.00 1.2999 0.0000 0.00 0.00 0.00 40767.13 40767.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: unleash_elements

Static Values
  • id:73680
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4919.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73680
  • name:Unleash Elements
  • school:nature
  • tooltip:(null)
  • description:Focuses the elemental force imbued in the Shaman's weaponry, with the concentrated effects depending on the enchantment unleashed.$?s86629[ If the same enchantment is present on both weapons, only one will be unleashed.][] See individual weapon imbue spell tooltips for details regarding the effects of unleashing each.
unleash_flame 1780 1.5% 23.8 15.76sec 27341 0 23457 48909 27341 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.83 23.83 0.00 0.00 0.0000 0.0000 651398.57 651398.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.19 84.74% 23457.19 20580 32550 23454.67 22075 25032 473602 473602 0.00
crit 3.64 15.26% 48908.88 42395 66275 48085.73 0 63834 177796 177796 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_flame_eoe 534 0.5% 7.2 46.65sec 27295 0 23444 48792 27295 15.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_flame_eoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.15 7.15 0.00 0.00 0.0000 0.0000 195275.40 195275.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.07 84.81% 23443.51 20580 32550 23419.09 0 30355 142242 142242 0.00
crit 1.09 15.19% 48791.93 42395 66275 33022.04 0 66275 53034 53034 0.00
DPS Timeline Chart

Action details: unleash_flame

Static Values
  • id:73683
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73683
  • name:Unleash Flame
  • school:fire
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:1135.00
  • base_dd_max:1345.88
unleash_wind 1136 1.0% 23.8 15.76sec 17456 0 12626 26267 17458 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unleash_wind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.83 23.82 0.00 0.00 0.0000 0.0000 415883.99 415883.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.38 64.57% 12625.83 11787 15408 12623.84 11944 13212 194216 194216 0.00
crit 8.44 35.43% 26267.15 24281 31740 26273.69 24281 28526 221668 221668 0.00
DPS Timeline Chart

Action details: unleash_wind

Static Values
  • id:73681
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:73681
  • name:Unleash Wind
  • school:physical
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.90
windfury_mh 5460 4.7% 94.4 11.44sec 21165 0 15240 31772 21165 35.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windfury_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.42 94.42 0.00 0.00 0.0000 0.0000 1998429.34 1998429.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.58 64.16% 15240.29 14330 18878 15240.75 14697 15928 923237 923237 0.00
crit 33.84 35.84% 31771.75 29520 38888 31770.31 30227 33736 1075192 1075192 0.00
DPS Timeline Chart

Action details: windfury_mh

Static Values
  • id:33757
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33757
  • name:Windfury Weapon (Passive)
  • school:nature
  • tooltip:(null)
  • description:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_main_hand 2866 2.5% 20.1 10.23sec 52068 39700 35134 73467 52068 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.15 20.15 0.00 0.00 1.3116 0.0000 1049068.58 1049068.58 0.00 39699.85 39699.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.25 55.82% 35134.31 30669 41319 35144.31 31371 39560 395163 395163 0.00
crit 8.90 44.18% 73467.13 63179 85118 73475.20 64446 82587 653906 653906 0.00
DPS Timeline Chart

Action details: windlash_main_hand

Static Values
  • id:114089
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Wind Lash
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
windlash_off_hand 1467 1.3% 20.6 10.00sec 26074 19382 17587 36745 26074 44.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: windlash_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.60 20.60 0.00 0.00 1.3453 0.0000 537087.48 537087.48 0.00 19381.74 19381.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.47 55.70% 17587.41 15335 20660 17588.88 15335 19100 201785 201785 0.00
crit 9.13 44.30% 36745.23 31590 42559 36745.61 32503 40854 335302 335302 0.00
DPS Timeline Chart

Action details: windlash_off_hand

Static Values
  • id:114093
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Wind Lash Off-Hand
  • school:nature
  • tooltip:(null)
  • description:A massive gust of air that deals $s1% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - spirit_wolf 13767 / 3385
melee 7151 1.5% 200.6 2.76sec 3208 3632 2403 4931 3208 37.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 200.62 200.62 0.00 0.00 0.8834 0.0000 643590.21 643590.21 0.00 3631.55 3631.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.64 38.70% 2403.20 2190 3326 2403.70 2246 2594 186572 186572 0.00
crit 74.87 37.32% 4931.36 4380 6651 4930.44 4545 5378 369194 369194 0.00
glance 48.12 23.98% 1825.24 1643 2494 1825.28 1654 1985 87824 87824 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
spirit_bite 6616 1.4% 29.9 10.46sec 19906 12868 14288 29291 19906 37.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: spirit_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.91 29.91 0.00 0.00 1.5469 0.0000 595420.40 595420.40 0.00 12868.11 12868.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.71 62.55% 14287.64 12732 19692 14286.00 12896 15816 267334 267334 0.00
crit 11.20 37.45% 29290.82 25465 39384 29302.37 25465 33930 328086 328086 0.00
DPS Timeline Chart

Action details: spirit_bite

Static Values
  • id:58859
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:7.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:58859
  • name:Spirit Bite
  • school:nature
  • tooltip:(null)
  • description:Bites the enemy, causing Nature damage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:891.60
  • base_dd_max:1337.40
pet - greater_fire_elemental 30483 / 9978
fire_blast 1873 0.5% 20.0 18.75sec 11222 0 8144 16813 11222 35.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.00 20.00 0.00 0.00 0.0000 0.0000 224433.26 224433.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.90 64.50% 8144.36 7084 12244 8141.46 7171 9331 105066 105066 0.00
crit 7.10 35.50% 16813.38 14168 24488 16831.09 14168 23794 119367 119367 0.00
DPS Timeline Chart

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:(null)
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.429000
  • base_dd_min:12.38
  • base_dd_max:12.38
fire_melee 28609 8.1% 125.1 2.89sec 27395 32982 20583 42789 27395 35.9% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: fire_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.12 125.12 0.00 0.00 0.8306 0.0000 3427609.29 3427609.29 0.00 32981.57 32981.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.22 40.14% 20583.40 18227 30254 20583.88 19043 22600 1033785 1033785 0.00
crit 44.93 35.91% 42788.91 36454 60509 42790.21 39248 46437 1922628 1922628 0.00
glance 29.96 23.95% 15725.89 13670 22691 15725.87 14319 17484 471196 471196 0.00
DPS Timeline Chart

Action details: fire_melee

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.40
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:1114.50
  • base_dd_max:1114.50
Weapon
  • normalized:false
  • weapon_power_mod:0.000000
  • weapon_multiplier:1.00
pet - greater_earth_elemental 4946 / 1501
earth_melee 4946 1.3% 83.5 4.24sec 6577 5549 4993 10240 6577 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: earth_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.51 83.51 0.00 0.00 1.1853 0.0000 549248.27 549248.27 0.00 5549.08 5549.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.69 40.35% 4993.39 4538 6746 4993.54 4611 5360 168248 168248 0.00
crit 29.80 35.69% 10240.13 9075 13492 10240.92 9405 11177 305158 305158 0.00
glance 20.01 23.97% 3789.39 3403 5060 3789.43 3436 4212 75842 75842 0.00
DPS Timeline Chart

Action details: earth_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - searing_totem 3999 / 2661
searing_bolt 3999 2.3% 149.9 2.04sec 6497 0 5552 11608 6497 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: searing_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.93 149.93 0.00 0.00 0.0000 0.0000 974084.58 974084.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.55 84.40% 5552.41 4883 8353 5552.34 5327 5829 702655 702655 0.00
crit 23.38 15.60% 11607.97 10060 17207 11607.99 10443 12853 271430 271430 0.00
DPS Timeline Chart

Action details: searing_bolt

Static Values
  • id:3606
  • school:fire
  • resource:none
  • range:20.0
  • travel_speed:19.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:3606
  • name:Searing Bolt
  • school:fire
  • tooltip:(null)
  • description:Deals Fire damage to the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.110000
  • base_dd_min:69.68
  • base_dd_max:90.75

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
ascendance 2.0 0.0 182.6sec 182.6sec 8.20% 8.20%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • ascendance_1:8.2%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Autoattacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:The Shaman surrenders $ghis:her; physical form to the power of the elements, transforming into a being of raw elemental energy for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
blood_fury 4.0 0.0 120.7sec 120.7sec 13.33% 13.33%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:attack_power
    • amount:4514.40
    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.3%

Spelldata details

  • id:33697
  • name:Blood Fury
  • tooltip:Melee attack power increased by $s1. Spell power increased by $s2.
  • description:Increases your melee attack power by $s1 and your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.01%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 9.5 5.8 37.6sec 22.6sec 39.64% 38.65%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:39.6%
dancing_steel_oh 7.3 2.7 46.7sec 32.9sec 28.12% 27.44%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:28.1%
flurry 12.9 156.0 28.3sec 2.2sec 94.90% 92.77%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_flurry
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:8.5%
  • flurry_2:1.2%
  • flurry_3:28.5%
  • flurry_4:4.3%
  • flurry_5:52.4%

Spelldata details

  • id:16278
  • name:Flurry
  • tooltip:Attack speed increased by $s1%. Haste from items increased by $s2%.
  • description:$@spelldesc16282
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
lightning_shield 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_lightning_shield
  • max_stacks:1
  • duration:1022.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • lightning_shield_1:100.0%

Spelldata details

  • id:324
  • name:Lightning Shield
  • tooltip:Deals Nature damage to attackers.
  • description:The caster is surrounded by a reactive lightning barrier. When a spell, melee or ranged attack hits the caster, the attacker will be struck for $26364s1 Nature damage. This effect may only occur once every few seconds. Lasts $d. Only one of your Elemental Shields can be active on you at once.
  • max_stacks:
  • duration:3600.00
  • cooldown:0.00
  • default_chance:1.00%
maelstrom_weapon 60.8 118.7 6.0sec 2.0sec 72.70% 63.44%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_maelstrom_weapon
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • maelstrom_weapon_1:22.7%
  • maelstrom_weapon_2:21.3%
  • maelstrom_weapon_3:13.8%
  • maelstrom_weapon_4:8.2%
  • maelstrom_weapon_5:6.6%

Spelldata details

  • id:53817
  • name:Maelstrom Weapon
  • tooltip:Reduces the cast time and mana cost of your next Nature spell with a base cast time shorter than 10 seconds by $53817s1%.$?$w3!=0[ Next spell's healing effectiveness increased by $w3%.][]
  • description:$@spelldesc51530
  • max_stacks:5
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_xuen 6.1 0.0 63.7sec 63.7sec 24.47% 24.47%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:55.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:24.5%
searing_flames 33.9 241.2 10.9sec 1.3sec 93.13% 94.94%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_searing_flames
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • searing_flames_1:13.0%
  • searing_flames_2:13.0%
  • searing_flames_3:13.0%
  • searing_flames_4:13.0%
  • searing_flames_5:41.2%

Spelldata details

  • id:77657
  • name:Searing Flames
  • tooltip:(null)
  • description:When your Searing Totem deals damage or your Fire Elemental lands a melee attack, the damage dealt by your Flametongue Weapon is increased by $77661s1% for $77661d. Stacks up to 5 times. Your Lava Lash ability will consume this effect, dealing $s1% increased damage for each application present.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 7.0 0.0 60.7sec 60.7sec 16.88% 16.88%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.9%
terror_in_the_mists 6.0 0.0 64.2sec 64.2sec 32.73% 32.73%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_terror_in_the_mists
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:crit_rating
    • amount:7796.00

    Stack Uptimes

    • terror_in_the_mists_1:32.7%
unleash_flame 23.8 0.0 15.8sec 15.8sec 37.55% 99.92%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_flame
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_flame_1:37.5%

Spelldata details

  • id:73683
  • name:Unleash Flame
  • tooltip:Damage dealt by the next Fire spell increased by $w2%.
  • description:Unleashes the Flametongue enchantment upon the Shaman's weapon, dealing $s1 Fire damage to target enemy and increasing the damage dealt by the Shaman's next Fire spell by $s2%.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:1.01%
unleash_wind 23.8 0.0 15.8sec 15.8sec 22.93% 31.54%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleash_wind
  • max_stacks:6
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • unleash_wind_1:0.5%
  • unleash_wind_2:8.6%
  • unleash_wind_3:0.4%
  • unleash_wind_4:8.9%
  • unleash_wind_5:0.4%
  • unleash_wind_6:4.1%

Spelldata details

  • id:73681
  • name:Unleash Wind
  • tooltip:Melee attack speed increased by $w2%.
  • description:Unleashes the Windfury enchantment upon the Shaman's weapon, dealing $s3% of weapon damage to the target enemy and increasing the Shaman's melee attack speed by $s2% for the next 6 swings or until $d have elapsed.
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.01%
unleashed_fury_wf 23.8 0.0 15.8sec 15.8sec 51.01% 57.23%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_wf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_wf_1:51.0%

Spelldata details

  • id:118472
  • name:Unleashed Fury
  • tooltip:Your melee autoattacks can trigger Static Shock.
  • description:Your melee autoattacks can trigger Static Shock.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
virmens_bite_potion 2.0 0.0 60.6sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_virmens_bite_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:agility
    • amount:4000.00

    Stack Uptimes

    • virmens_bite_potion_1:12.3%
earth_elemental_totem-stunned 4.7 0.0 84.8sec 0.0sec 4.24% 4.24%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_earth_elemental_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.3%
fire_elemental_totem-stunned 5.0 0.0 78.8sec 0.0sec 4.17% 4.17%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_fire_elemental_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.4%
greater_earth_elemental-stunned 4.7 0.0 84.8sec 0.0sec 4.24% 4.24%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_greater_earth_elemental
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.3%
greater_fire_elemental-stunned 5.0 0.0 78.8sec 0.0sec 4.17% 4.17%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_greater_fire_elemental
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.4%
searing_totem-stunned 9.0 0.0 24.4sec 0.0sec 3.69% 3.69%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_searing_totem
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:2.5%
spirit_wolf-stunned 2.6 0.0 74.1sec 0.0sec 2.82% 2.82%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_spirit_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.7%
spirit_wolf-stunned 2.6 0.0 74.1sec 0.0sec 2.82% 2.82%

Buff details

  • buff initial source:Shaman_Enhancement_T14H_spirit_wolf
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.7%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Shaman_Enhancement_T14H
ascendance Mana 2.0 1560.0 780.0 780.0 0.0
bloodlust Mana 0.9 3060.1 3225.0 3225.0 0.0
earth_elemental_totem Mana 2.0 8430.0 4215.0 4215.0 0.0
earth_shock Mana 35.4 76432.8 2160.0 2160.0 31.0
feral_spirit Mana 3.0 5400.0 1800.0 1800.0 0.0
fire_elemental_totem Mana 2.0 8069.5 4034.8 4034.8 0.0
flame_shock Mana 11.5 20454.6 1785.0 1785.0 132.5
lava_lash Mana 32.9 79059.3 2400.0 2400.0 62.7
searing_totem Mana 5.2 4563.6 885.0 885.0 0.0
stormblast Mana 4.0 22484.0 5621.0 5621.0 52.1
stormstrike Mana 39.1 220285.6 5640.0 5640.0 18.3
unleash_elements Mana 23.8 29299.2 1229.8 1229.8 43.1
Resource Gains Type Count Total Average Overflow
mp5_regen Mana 1463.00 83270.21 56.92 26454.79 24.11%
primal_wisdom Mana 221.01 392831.38 1777.45 270194.14 40.75%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 1300.82 1309.01
Combat End Resource Mean Min Max
Health -6350752.00 -6350752.00 -6350752.00
Mana 57011.09 43005.50 60000.00
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.2%
spirit_wolf-Mana Cap 2.2%
primal_fire_elemental-Mana Cap 2.2%
primal_earth_elemental-Mana Cap 2.2%
earth_elemental_totem-Mana Cap 2.2%
magma_totem-Mana Cap 2.2%
stormlash_totem-Mana Cap 2.2%

Procs

Count Interval
windfury_mh_maelstrom 41.0 13.8sec
windfury_mh_maelstrom_wasted 2.8 97.7sec
melee_main_hand_maelstrom 59.5 6.1sec
melee_main_hand_maelstrom_wasted 3.3 74.9sec
windlash_main_hand_maelstrom 8.7 24.6sec
windlash_main_hand_maelstrom_wasted 1.7 70.9sec
melee_off_hand_maelstrom 59.2 6.1sec
melee_off_hand_maelstrom_wasted 3.2 75.2sec
windlash_off_hand_maelstrom 8.9 24.0sec
windlash_off_hand_maelstrom_wasted 1.6 73.7sec
lava_lash_maelstrom 14.3 24.4sec
lava_lash_maelstrom_wasted 0.5 124.5sec
unleash_wind_maelstrom 10.3 34.1sec
unleash_wind_maelstrom_wasted 0.9 115.8sec
stormblast_mh_maelstrom 1.7 95.5sec
stormblast_mh_maelstrom_wasted 0.2 95.3sec
stormblast_oh_maelstrom 1.7 96.0sec
stormblast_oh_maelstrom_wasted 0.2 95.9sec
stormstrike_mh_maelstrom 17.0 20.6sec
stormstrike_mh_maelstrom_wasted 0.2 119.2sec
stormstrike_oh_maelstrom 16.9 20.7sec
stormstrike_oh_maelstrom_wasted 0.2 118.1sec
hat_donor 105.5 4.1sec
maelstrom_weapon 239.3 1.8sec
static_shock 134.7 3.0sec
swings_clipped_mh 21.4 15.7sec
swings_clipped_oh 21.4 15.6sec
uf_flame_shock 14.9 24.9sec
uf_wasted 11.7 30.2sec
wasted_maelstrom_weapon 14.6 25.6sec
windfury 31.5 11.4sec
maelstrom_weapon_stack_2 14.3 23.1sec
maelstrom_weapon_stack_3 13.5 24.4sec
maelstrom_weapon_stack_4 10.8 29.9sec
maelstrom_weapon_stack_5 21.5 16.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 115156.85
Minimum 105455.42
Maximum 124252.01
Spread ( max - min ) 18796.58
Range [ ( max - min ) / 2 * 100% ] 8.16%
Standard Deviation 2555.0458
5th Percentile 110963.88
95th Percentile 119360.62
( 95th Percentile - 5th Percentile ) 8396.74
Mean Distribution
Standard Deviation 25.5556
95.00% Confidence Intervall ( 115106.77 - 115206.94 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1891
0.1 Scale Factor Error with Delta=300 55728
0.05 Scale Factor Error with Delta=300 222915
0.01 Scale Factor Error with Delta=300 5572897
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 115156.85

Damage

Sample Data
Count 9996
Mean 35733022.53

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 250.68
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=spring_blossoms
1 0.00 food,type=sea_mist_rice_noodles
2 0.00 windfury_weapon,weapon=main
3 0.00 flametongue_weapon,weapon=off
4 0.00 lightning_shield,if=!buff.lightning_shield.up
5 0.00 snapshot_stats
6 0.00 virmens_bite_potion
Default action list
# count action,conditions
7 0.00 wind_shear
8 0.95 bloodlust,if=target.health.pct<25|time>5
9 15.00 auto_attack
A 6.96 use_item,name=firebirds_grips
B 1.00 virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
C 0.00 run_action_list,name=single,if=num_targets=1
D 0.00 run_action_list,name=ae,if=num_targets>1
actions.single
# count action,conditions
U 4.00 blood_fury
V 0.00 elemental_mastery,if=talent.elemental_mastery.enabled
W 2.00 fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
X 2.00 ascendance,if=cooldown.strike.remains>=3
Y 5.16 searing_totem,if=!totem.fire.active
Z 23.83 unleash_elements,if=talent.unleashed_fury.enabled
a 0.00 elemental_blast,if=talent.elemental_blast.enabled
b 15.77 lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
c 4.00 stormblast
d 8.62 flame_shock,if=buff.unleash_flame.up&!ticking
e 39.06 stormstrike
f 32.94 lava_lash
g 0.00 unleash_elements
h 17.95 lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
i 0.00 ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
j 0.00 lightning_bolt,if=buff.ancestral_swiftness.up
k 2.84 flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
l 35.39 earth_shock
m 3.00 feral_spirit
n 2.00 earth_elemental_totem,if=!active
o 0.00 spiritwalkers_grace,moving=1
p 28.22 lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

Sample Sequence

9AUYZde8WXbcbflmncZblfbehlpfZdehlbfe9plZpefhl9eABpfZYdehlfpelZpfehl9peZdfbehlfeZ9hlpUeAflpYZedbf9mlepZfhelpfelZbdefbl9eZlfb9eAlhXcYflZbcdbfhelZpfehlpefZb9ke9flepZlfUhAeplYfeZhkmefblpe9Zlfelbf9eZbdhfelpZeAWfblhen9bfZhdebflpeZlfhe9lpfZebdfe9blUZAY

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 236 225 80
Agility 21403 19019 18031
Stamina 22365 20332 20170
Intellect 251 239 80
Spirit 251 251 80
Health 459513 431051 0
Mana 60000 60000 0
Spell Power 26113 21111 0
Spell Hit 15.06% 15.06% 2568
Spell Crit 14.19% 9.19% 4137
Spell Haste 13.02% 7.64% 3245
Mana Per 5 1500 1500 0
Attack Power 47478 38383 0
Melee Hit 7.55% 7.55% 2568
Melee Crit 31.81% 24.92% 4137
Melee Haste 7.64% 7.64% 3245
Swing Speed 18.40% 7.64% 3245
Expertise 7.51% / 7.51% 7.51% / 7.51% 2214
Armor 25465 25465 25465
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.22% 37.22% 6364

Gear

Average Item Level: 507.81
Head firebirds_helmet,id=87136,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
Neck choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
Shoulders waterborne_shoulderguards,id=90505,gems=320agi_60agi,enchant=200agi_100crit,reforge=exp_mastery
Shirt empty
Chest firebirds_cuirass,id=87134,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all,reforge=crit_hit
Waist rangers_chain_of_unending_summer,id=87182,gems=80agi_160hit_160agi_60haste,reforge=haste_mastery
Legs firebirds_legguards,id=87137,gems=320agi_60agi,enchant=285agi_165crit,reforge=haste_mastery
Feet monstrous_stompers,id=86985,gems=80agi_160mastery_120haste,enchant=140agi,reforge=crit_mastery
Wrists jagged_hornet_bracers,id=86997,enchant=180agi
Hands firebirds_grips,id=87135,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
Finger1 painful_thorned_ring,id=86974,reforge=exp_haste
Finger2 regails_band_of_the_endless,id=90503,reforge=crit_mastery
Trinket1 terror_in_the_mists,id=87167
Trinket2 relic_of_xuen,id=79328
Back legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
Main Hand claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=exp_mastery
Off Hand claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Nature's Guardian Stone Bulwark Totem Astral Shift
30 Frozen Power Earthgrab Totem Windwalk Totem
45 Call of the Elements Totemic Restoration Totemic Projection
60 Elemental Mastery Ancestral Swiftness Echo of the Elements
75 Healing Tide Totem Ancestral Guidance Conductivity
90 Unleashed Fury Primal Elementalist Elemental Blast

Profile

#!./simc

shaman="Shaman_Enhancement_T14H"
origin="unknown"
level=90
race=orc
spec=enhancement
role=attack
position=back
professions=engineering=600/jewelcrafting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#WZ!020220
glyphs=chain_lightning/flame_shock

actions.precombat=flask,type=spring_blossoms
actions.precombat+=/food,type=sea_mist_rice_noodles
actions.precombat+=/windfury_weapon,weapon=main
actions.precombat+=/flametongue_weapon,weapon=off
actions.precombat+=/lightning_shield,if=!buff.lightning_shield.up
actions.precombat+=/snapshot_stats
actions.precombat+=/virmens_bite_potion

actions=wind_shear
actions+=/bloodlust,if=target.health.pct<25|time>5
actions+=/auto_attack
actions+=/use_item,name=firebirds_grips
actions+=/virmens_bite_potion,if=time>60&(pet.primal_fire_elemental.active|pet.greater_fire_elemental.active|target.time_to_die<=60)
actions+=/run_action_list,name=single,if=num_targets=1
actions+=/run_action_list,name=ae,if=num_targets>1

actions.ae=blood_fury
actions.ae+=/ascendance,if=cooldown.strike.remains>=3
actions.ae+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.ae+=/magma_totem,if=num_targets>5&!totem.fire.active
actions.ae+=/searing_totem,if=num_targets<=5&!totem.fire.active
actions.ae+=/fire_nova,if=(num_targets<=5&active_flame_shock=num_targets)|active_flame_shock>=5
actions.ae+=/lava_lash,if=dot.flame_shock.ticking
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>=3
actions.ae+=/unleash_elements
actions.ae+=/flame_shock,cycle_targets=1,if=!ticking
actions.ae+=/stormblast
actions.ae+=/stormstrike
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react=5&cooldown.chain_lightning.remains>=2
actions.ae+=/feral_spirit
actions.ae+=/chain_lightning,if=num_targets>2&buff.maelstrom_weapon.react>1
actions.ae+=/lightning_bolt,if=buff.maelstrom_weapon.react>1

actions.single=blood_fury
actions.single+=/elemental_mastery,if=talent.elemental_mastery.enabled
actions.single+=/fire_elemental_totem,if=!active&(buff.bloodlust.up|buff.elemental_mastery.up|target.time_to_die<=totem.fire_elemental_totem.duration+10|(talent.elemental_mastery.enabled&(cooldown.elemental_mastery.remains=0|cooldown.elemental_mastery.remains>80)|time>=60))
actions.single+=/ascendance,if=cooldown.strike.remains>=3
actions.single+=/searing_totem,if=!totem.fire.active
actions.single+=/unleash_elements,if=talent.unleashed_fury.enabled
actions.single+=/elemental_blast,if=talent.elemental_blast.enabled
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react=5|(set_bonus.tier13_4pc_melee=1&buff.maelstrom_weapon.react>=4&pet.spirit_wolf.active)
actions.single+=/stormblast
actions.single+=/flame_shock,if=buff.unleash_flame.up&!ticking
actions.single+=/stormstrike
actions.single+=/lava_lash
actions.single+=/unleash_elements
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>=3&target.debuff.unleashed_fury_ft.up&!buff.ascendance.up
actions.single+=/ancestral_swiftness,if=talent.ancestral_swiftness.enabled&buff.maelstrom_weapon.react<2
actions.single+=/lightning_bolt,if=buff.ancestral_swiftness.up
actions.single+=/flame_shock,if=buff.unleash_flame.up&dot.flame_shock.remains<=3
actions.single+=/earth_shock
actions.single+=/feral_spirit
actions.single+=/earth_elemental_totem,if=!active
actions.single+=/spiritwalkers_grace,moving=1
actions.single+=/lightning_bolt,if=buff.maelstrom_weapon.react>1&!buff.ascendance.up

head=firebirds_helmet,id=87136,gems=agile_primal_80agi_160hit_180agi,reforge=exp_haste
neck=choker_of_the_unleashed_storm,id=86953,reforge=crit_haste
shoulders=waterborne_shoulderguards,id=90505,gems=320agi_60agi,enchant=200agi_100crit,reforge=exp_mastery
back=legbreaker_greatcloak,id=86963,enchant=180crit,reforge=crit_haste
chest=firebirds_cuirass,id=87134,gems=80agi_160mastery_80agi_160mastery_120mastery,enchant=80all,reforge=crit_hit
wrists=jagged_hornet_bracers,id=86997,enchant=180agi
hands=firebirds_grips,id=87135,enchant=170mastery,addon=synapse_springs_mark_ii,reforge=crit_mastery
waist=rangers_chain_of_unending_summer,id=87182,gems=80agi_160hit_160agi_60haste,reforge=haste_mastery
legs=firebirds_legguards,id=87137,gems=320agi_60agi,enchant=285agi_165crit,reforge=haste_mastery
feet=monstrous_stompers,id=86985,gems=80agi_160mastery_120haste,enchant=140agi,reforge=crit_mastery
finger1=painful_thorned_ring,id=86974,reforge=exp_haste
finger2=regails_band_of_the_endless,id=90503,reforge=crit_mastery
trinket1=terror_in_the_mists,id=87167
trinket2=relic_of_xuen,id=79328
main_hand=claws_of_shekzeer,id=86988,gems=500agi,enchant=dancing_steel,reforge=exp_mastery
off_hand=claws_of_shekzeer,id=86988,enchant=dancing_steel,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=18031
# gear_stamina=20170
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2214
# gear_hit_rating=2568
# gear_crit_rating=4137
# gear_haste_rating=3245
# gear_mastery_rating=6364
# gear_armor=25465
# meta_gem=agile_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# hands=firebirds_grips,heroic=1,addon=synapse_springs_mark_ii
# main_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=claws_of_shekzeer,heroic=1,weapon=fist_2.60speed_6807min_12643max,enchant=dancing_steel

Warlock_Affliction_T14H : 123195 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
123194.9 123194.9 45.32 / 0.04% 3813 / 3.1% 18.4 6551.2 5840.9 Mana 0.00% 30.7 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
Glyphs
  • soul_shards

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:846554|504603|332423|259604|122405|109166|85646|27288&chds=0,1693108&chco=C79C6E,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++846554++summon_doomguard,C79C6E,0,0,15|t++504603++agony,9482C9,1,0,15|t++332423++corruption,9482C9,2,0,15|t++259604++unstable_affliction,9482C9,3,0,15|t++122405++haunt,9482C9,4,0,15|t++109166++drain_soul,9482C9,5,0,15|t++85646++malefic_grasp,9482C9,6,0,15|t++27288++soul_swap,9482C9,7,0,15&chtt=Warlock_Affliction_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,13,12,11,10,10,9,9,4,2,2,2,2,0,0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=agony|unstable_affliction|corruption|haunt|agony_mg|malefic_grasp|unstable_affliction_mg|corruption_mg|drain_soul|agony_ds|unstable_affliction_ds|corruption_ds|doomguard: doom_bolt|soul_swap|felhunter: shadow_bite&chtt=Warlock_Affliction_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:gkoqtvxyxwy135643346786420yxwwwtrrrpopomkjihgffdcaabaaZYXYXYYZZYZYZZabbbaabbbcccbbaabbbaaaaaaaaaaZZZZaaZYXXXYYYYXXXXXWWWWWWXXXXXXXXXXXXXXXYYYXXXXXXXXXXXXXXXYYYYZYYYYYYYYZYZZZZZZYYYXXYYZZYYYYYYZZYYYYYYYYYYYYYYYYYXXXXXWWVVVVVVVVUUUUTTTTTTUVVWWWXXXYYZZabbcddeeeffeeeeeeddddccbbaZYYXXXXXXXWWVVVVVVVVVWXXYYYZabbabbddefghhijjklmnnooprrrrrqonnmmllkjihggffedcbbbcccccbcbbbaa&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=123195|max=255326&chxp=1,1,48,100&chtt=Warlock_Affliction_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,2,3,3,6,9,10,20,28,44,84,100,153,193,230,256,329,365,396,513,567,641,596,625,607,595,509,540,478,428,331,301,217,216,165,110,109,50,47,37,38,12,14,9,4,3,1,0,1&chds=0,641&chbh=5&chxt=x&chxl=0:|min=114313|avg=123195|max=132206&chxp=0,1,50,100&chtt=Warlock_Affliction_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:53.5,12.2,10.5,6.1,4.4,3.5,2.2,2.2,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=malefic_grasp 196.0s|drain_soul 44.7s|haunt 38.6s|unstable_affliction 22.2s|corruption 16.3s|agony 12.7s|life_tap 8.1s|soul_swap 8.0s|summon_doomguard 1.0s&chtt=Warlock_Affliction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Affliction_T14H 123195
agony 17544 14.2% 11.1 28.78sec 579827 504603 0 0 0 0.0% 0.0% 0.0% 0.0% 288.1 18693 38923 22291 17.8% 0.0% 99.5%

Stats details: agony

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 18.77 288.06 288.06 1.1491 1.2642 6421077.35 6421077.35 0.00 17037.23 504603.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 236.8 82.21% 18692.99 11506 26025 18693.48 17424 19888 4426948 4426948 0.00
crit 51.2 17.79% 38923.28 23703 53612 38919.23 35490 42910 1994129 1994129 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_ds 2848 2.3% 29.6 2.23sec 35243 0 29498 61417 35243 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.57 29.57 0.00 0.00 0.0000 0.0000 1042257.96 1042257.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.25 82.00% 29498.29 21457 37060 29517.08 25987 33487 715375 715375 0.00
crit 5.32 18.00% 61417.33 44201 76343 61252.81 0 76343 326883 326883 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
agony_mg 12255 9.9% 271.0 1.09sec 16552 0 13892 28919 16552 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: agony_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 270.98 270.98 0.00 0.00 0.0000 0.0000 4485405.05 4485405.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 223.02 82.30% 13892.37 9780 19519 13894.72 13012 15024 3098259 3098259 0.00
crit 47.97 17.70% 28919.24 20147 40209 28918.62 25739 32654 1387146 1387146 0.00
DPS Timeline Chart

Action details: agony

Static Values
  • id:980
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:980
  • name:Agony
  • school:shadow
  • tooltip:$w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. Damage increases.
  • description:Inflicts increasing agony on the target, causing ${($m1+$SP*0.026)*75} to ${($m1+$SP*0.026)*120} Shadow damage over $d. This damage is dealt slowly at first and builds up each time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.026000
  • base_td:27.77
  • num_ticks:12
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
blood_fury 0 0.0% 3.9 121.14sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.94 3.94 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
corruption 14776 12.0% 14.4 21.94sec 376659 332423 0 0 0 0.0% 0.0% 0.0% 0.0% 288.3 15749 32764 18759 17.7% 0.0% 99.5%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.36 22.06 288.30 288.30 1.1331 1.2631 5408194.21 5408194.21 0.00 14216.38 332423.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 237.3 82.31% 15749.11 12101 22018 15749.28 14964 16554 3737384 3737384 0.00
crit 51.0 17.69% 32763.80 24929 45358 32763.13 29743 35667 1670810 1670810 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_ds 2421 2.0% 29.6 2.23sec 29963 0 25060 52219 29963 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.57 29.57 0.00 0.00 0.0000 0.0000 886112.59 886112.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.23 81.95% 25060.25 18152 31354 25077.82 22223 28109 607335 607335 0.00
crit 5.34 18.05% 52218.88 37394 64589 52096.21 0 64589 278778 278778 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
corruption_mg 10377 8.4% 271.0 1.09sec 14015 0 11764 24487 14015 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: corruption_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 270.98 270.98 0.00 0.00 0.0000 0.0000 3797879.06 3797879.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 223.04 82.31% 11763.79 9076 16514 11765.54 11095 12408 2623746 2623746 0.00
crit 47.95 17.69% 24487.09 18697 34018 24490.44 21745 27144 1174133 1174133 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 5.0 81.08sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113860
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113860
  • name:Dark Soul: Misery
  • school:shadow
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
drain_soul 5428 (13330) 4.4% (10.8%) 15.1 4.60sec 323661 109166 0 0 0 0.0% 0.0% 0.0% 0.0% 29.6 56274 116974 67179 18.0% 0.0% 11.3%

Stats details: drain_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 15.07 29.57 29.57 2.9649 1.3923 1986720.07 1986720.07 0.00 109165.56 109165.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.3 82.04% 56273.92 41348 71419 56278.03 51445 60465 1365256 1365256 0.00
crit 5.3 17.96% 116974.26 85177 147124 116473.79 0 147124 621464 621464 0.00
DPS Timeline Chart

Action details: drain_soul

Static Values
  • id:1120
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.health.pct<=20
Spelldata
  • id:1120
  • name:Drain Soul
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the warlock's other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage, every $t1 seconds.
  • description:Drains the soul of the target, causing ${$m1+$SP*0.375} Shadow damage every $t1 sec and energizing one Soul Shard after it deals damage twice. If the target dies, three Soul Shards are energized. Lasts $d. If the target is at or below $s3% health when Drain Soul deals damage, it deals $s6% additional damage and causes all of your other periodic Affliction damage effects to instantly deal $s5% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.390000
  • base_td:416.60
  • num_ticks:6
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
haunt 12896 10.5% 34.0 10.87sec 138965 122405 117470 244334 139882 17.7% 0.0% 0.0% 0.0% 132.0 0 0 0 0.0% 0.0% 72.1%

Stats details: haunt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.97 33.74 131.97 131.97 1.1353 2.0000 4720066.74 4720066.74 0.00 15603.47 122405.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.78 82.33% 117470.19 92764 168786 117376.44 106554 124897 3263547 3263547 0.00
crit 5.96 17.67% 244334.01 191095 347699 243907.41 0 347699 1456520 1456520 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: haunt

Static Values
  • id:48181
  • school:shadow
  • resource:soul_shard
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight_to_target&remains
Spelldata
  • id:48181
  • name:Haunt
  • school:shadow
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.750000
  • base_dd_min:1869.36
  • base_dd_max:1869.36
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:4
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
life_tap 0 0.0% 7.2 45.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.21 7.21 0.00 0.00 1.1180 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<35
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
malefic_grasp 11915 (45862) 9.7% (37.2%) 84.8 3.48sec 198009 85646 0 0 0 0.0% 0.0% 0.0% 0.0% 271.0 13532 28121 16093 17.6% 0.0% 50.1%

Stats details: malefic_grasp

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.77 84.77 270.98 270.98 2.3120 0.6763 4361006.62 4361006.62 0.00 85645.67 85645.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 223.4 82.44% 13531.71 10602 19291 13533.73 12815 14238 3023082 3023082 0.00
crit 47.6 17.56% 28120.82 21841 39739 28125.25 25633 30894 1337925 1337925 0.00
DPS Timeline Chart

Action details: malefic_grasp

Static Values
  • id:103103
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:4500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103103
  • name:Malefic Grasp
  • school:shadow
  • tooltip:Deals $w1 Shadow damage and causes all of the Warlock's other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage, every $t1 seconds.
  • description:Binds the target in twilight, causing $103103o1 Shadow damage over $103103d. Every $t1 sec, when Malefic Grasp deals damage, it causes all of your other periodic Affliction damage effects to instantly deal $s3% of their normal periodic damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:4
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
soul_swap 596 0.5% 7.7 53.79sec 28335 27288 23719 49275 28335 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_swap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.70 7.70 0.00 0.00 1.0384 0.0000 218141.26 218141.26 0.00 27288.12 27288.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.31 81.94% 23718.50 17669 30520 23738.99 0 29206 149617 149617 0.00
crit 1.39 18.06% 49274.85 36399 62872 38219.11 0 62872 68524 68524 0.00
DPS Timeline Chart

Action details: soul_swap

Static Values
  • id:86121
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:18000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.soulburn.up
Spelldata
  • id:86121
  • name:Soul Swap
  • school:shadow
  • tooltip:(null)
  • description:You instantly deal $86121s1 damage$?s56226[ and copy your Shadow damage-over-time effects from the target][, and remove your Shadow damage-over-time effects from the target]. For $86211d afterwards, the next target you cast Soul Swap: Exhale on will be afflicted by the Shadow damage-over-time effects and suffer $86121s1 damage. You cannot Soul Swap to the same target.$?s74434&!s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Corruption, Unstable Affliction and Agony.|r][]$?s74434&s603[ |cFFFFFFFFSoulburn:|r |cFF8282FFInstantly applies Doom, Unstable Affliction and Agony.|r][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:534.10
  • base_dd_max:534.10
soulburn 0 0.0% 7.9 52.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soulburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.88 7.88 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 7.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soulburn

Static Values
  • id:74434
  • school:shadow
  • resource:soul_shard
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:1.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
Spelldata
  • id:74434
  • name:Soulburn
  • school:shadow
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
summon_doomguard 0 (2396) 0.0% (1.9%) 1.0 1.#Rsec 877030 846554 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.0360 0.0000 0.00 0.00 0.00 846554.04 846554.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
unstable_affliction 15722 12.8% 19.5 17.58sec 295156 259604 0 0 0 0.0% 0.0% 0.0% 0.0% 281.3 17173 35710 20455 17.7% 0.0% 99.4%

Stats details: unstable_affliction

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.50 27.19 281.31 281.31 1.1369 1.2937 5754133.72 5754133.72 0.00 14903.61 259604.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 231.5 82.30% 17173.21 13200 24018 17173.14 16375 17994 3975662 3975662 0.00
crit 49.8 17.70% 35710.05 27193 49478 35709.67 32862 38902 1778472 1778472 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_ds 2633 2.1% 29.6 2.23sec 32616 0 27291 56743 32616 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_ds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.55 29.55 0.00 0.00 0.0000 0.0000 963845.54 963845.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.21 81.92% 27290.53 19800 34202 27306.76 24368 30342 660635 660635 0.00
crit 5.34 18.08% 56743.40 40789 70455 56562.25 0 70455 303210 303210 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
unstable_affliction_mg 11314 9.2% 271.0 1.09sec 15282 0 12834 26696 15282 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: unstable_affliction_mg

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 270.98 270.98 0.00 0.00 0.0000 0.0000 4141061.90 4141061.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 223.14 82.34% 12833.86 9900 18014 12835.95 11967 13526 2863719 2863719 0.00
crit 47.85 17.66% 26696.38 20394 37108 26699.74 23853 29309 1277343 1277343 0.00
DPS Timeline Chart

Action details: unstable_affliction

Static Values
  • id:30108
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30108
  • name:Unstable Affliction
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec. If dispelled, will cause $w4 damage to the dispeller and silence them for $31117d.
  • description:Shadow energy slowly destroys the target, causing $o3 damage over $d. If the Unstable Affliction is dispelled it will cause ${$m3*7} damage to the dispeller$?s56233[ and $ghis:her; target.][ and silence them for $31117d.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:256.37
  • num_ticks:7
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
pet - felhunter 0 / 72
shadow_bite 0 0.1% 1.0 1.#Rsec 26391 25474 22118 44236 26391 19.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% -1.$%

Stats details: shadow_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 0.00 0.00 1.0360 0.0000 26390.82 26390.82 0.00 25473.77 25473.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.81 80.68% 22118.11 22118 22118 17845.39 0 22118 17845 17845 0.00
crit 0.19 19.32% 44236.22 44236 44236 8545.43 0 44236 8545 8545 0.00
DPS Timeline Chart

Action details: shadow_bite

Static Values
  • id:54049
  • school:shadow
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:54049
  • name:Shadow Bite
  • school:shadow
  • tooltip:(null)
  • description:Bite the enemy, causing $s1 Shadow damage.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - doomguard 14617 / 2396
doom_bolt 14617 1.9% 19.9 2.84sec 44064 15860 37052 75530 44064 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.90 19.90 0.00 0.00 2.7783 0.0000 877029.98 877029.98 0.00 15860.07 15860.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.28 81.78% 37051.76 32420 47201 37044.30 33104 39591 603062 603062 0.00
crit 3.63 18.22% 75530.39 64840 94401 74151.93 0 94401 273968 273968 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 3.9 0.0 121.3sec 121.1sec 12.88% 12.88%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:12.9%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 15.99%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 5.0 0.0 81.1sec 81.1sec 27.32% 30.93%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:27.3%

Spelldata details

  • id:113860
  • name:Dark Soul: Misery
  • tooltip:Spell haste increased by $s1%.
  • description:Infuses your soul with the misery of fallen foes, increasing spell haste by $113860s1% for $113860d.$?s56228[ |cFFFFFFFFPassive:|r Increases your spell haste by ${$113860m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 61.7sec 61.7sec 32.79% 32.79%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
grimoire_of_sacrifice 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_grimoire_of_sacrifice
  • max_stacks:1
  • duration:1022.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grimoire_of_sacrifice_1:100.0%

Spelldata details

  • id:108503
  • name:Grimoire of Sacrifice
  • tooltip:$?$w3>0[$@spelldesc132612][]$?$w4>0[$@spelldesc132613][]$?$w5>0[$@spelldesc132614][] $?s108415[ Maximum health increased by $108503s7%.][] Restores $108503s2% of maximum health every $108503t2 sec.
  • description:You sacrifice your demon to gain one of its abilities, increase the power of many of your single target spells by $?c0[$s5% to $s3][]$?c1[$s3][]$?c2[$s4][]$?c3[$s5][]%$?s108415[, increase your maximum health by $s7%,][] and regenerate $s2% of maximum health every $t2 sec. Lasts for $d. Summoning another demon cancels the effect.
  • max_stacks:
  • duration:1200.00
  • cooldown:120.00
  • default_chance:0.00%
jade_serpent_potion 2.0 0.0 298.3sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.3 0.0 52.2sec 52.2sec 23.11% 23.08%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:23.1%
relic_of_yulon 7.9 0.0 51.3sec 51.3sec 29.77% 29.77%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:29.8%
soulburn 7.7 0.1 52.9sec 52.0sec 0.35% 88.50%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_soulburn
  • max_stacks:1
  • duration:30.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • soulburn_1:0.3%

Spelldata details

  • id:74434
  • name:Soulburn
  • tooltip:Unleashes hidden power in your next special spell cast.
  • description:Consumes a Soul Shard, unlocking the hidden power of your spells. Soulburn: Summon Demon has a 60 sec cooldown. Affected Spells: Summon Demon Drain Life$?s103111[ Fear][]$?s103101[ Health Funnel][]$?s103112[ Curses][]$?s104243[ Demonic Circle: Teleport][]$?s86664[ Seed of Corruption][]$?s5697[ Unending Breath][]$?s86121[ Soul Swap][]
  • max_stacks:
  • duration:30.00
  • cooldown:1.00
  • default_chance:0.00%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.2 0.0 61.2sec 61.1sec 16.45% 16.45%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.5%
doomguard-stunned 2.0 0.0 12.0sec 0.0sec 3.33% 3.33%

Buff details

  • buff initial source:Warlock_Affliction_T14H_doomguard
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Affliction_T14H
agony Mana 11.1 33222.4 3000.0 3000.0 193.3
corruption Mana 14.4 53843.8 3750.0 3750.0 100.4
dark_soul Mana 5.0 75000.0 15000.0 15000.0 0.0
drain_soul Mana 44.6 333997.6 7480.7 22156.9 14.6
haunt Soul Shard 34.0 34.0 1.0 1.0 138964.9
malefic_grasp Mana 355.8 1600900.2 4500.0 18885.1 10.5
soul_swap Mana 7.7 138576.2 18000.0 18000.0 1.6
soulburn Soul Shard 7.9 7.9 1.0 1.0 0.0
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 11.7
unstable_affliction Mana 19.5 87728.4 4500.0 4500.0 65.6
pet - felhunter
shadow_bite Energy 1.0 60.0 60.0 60.0 439.8
pet - doomguard
doom_bolt Energy 19.9 696.6 35.0 35.0 1259.0
Resource Gains Type Count Total Average Overflow
drain_soul Soul Shard 10.46 9.99 0.95 0.48 4.55%
life_tap Mana 7.21 529985.52 73511.25 0.00 0.00%
mp5_regen Mana 1463.00 1607773.53 1098.96 0.00 0.00%
nightfall Soul Shard 29.89 29.59 0.99 0.31 1.02%
pet - doomguard
energy_regen Energy 239.00 696.62 2.91 200.57 22.36%
Resource RPS-Gain RPS-Loss
Health 0.00 20055.33
Mana 5840.87 6551.19
Soul Shard 0.11 0.11
Combat End Resource Mean Min Max
Health -6849440.11 -6981791.25 -6761257.50
Mana 40438.80 0.00 90758.58
Soul Shard 1.76 0.00 4.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
hat_donor 364.7 1.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 123194.87
Minimum 114312.78
Maximum 132206.01
Spread ( max - min ) 17893.23
Range [ ( max - min ) / 2 * 100% ] 7.26%
Standard Deviation 2311.6336
5th Percentile 119420.92
95th Percentile 127046.86
( 95th Percentile - 5th Percentile ) 7625.94
Mean Distribution
Standard Deviation 23.1210
95.00% Confidence Intervall ( 123149.56 - 123240.19 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1352
0.1 Scale Factor Error with Delta=300 45616
0.05 Scale Factor Error with Delta=300 182465
0.01 Scale Factor Error with Delta=300 4561646
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 123194.87

Damage

Sample Data
Count 9996
Mean 44185902.07

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 187.05
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 6.24 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 3.94 blood_fury
A 5.00 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 1.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>3
F 1.00 summon_doomguard
G 5.30 soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
H 7.70 soul_swap,if=buff.soulburn.up
I 35.42 haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
J 0.00 soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
K 0.00 haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
L 2.58 soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
M 0.23 agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
N 0.19 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
O 1.34 unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
P 10.84 agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
Q 14.17 corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
R 18.84 unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
S 14.57 drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
T 7.21 life_tap,if=mana.pct<35
U 50.49 malefic_grasp,chain=1
V 0.00 life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
W 0.00 fel_flame,moving=1
X 0.00 life_tap

Sample Sequence

79ACFGHIUPIQRUIGHUIUIRUIQUUIPRUTIIU7UQUIRUPUAQRUIUUUTRPIQUIURUU9Q7IUPRUIUQUIRUTPUIURQIAUIUPRUQUU7TUIRUIPQURUIQRUPTUIURQIU9U7AGHUIUIRUTUIQUPIURUQURIU8SPSISQ7RSISSIRPQSAGHSISISRSIGHSISRII9S

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Soul Shard 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 19.67% 13.72% 2636
Spell Haste 24.48% 18.55% 7883
Mana Per 5 18671 17782 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 12.22% 7.21% 2636
Melee Haste 18.55% 18.55% 7883
Swing Speed 30.40% 18.55% 7883
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 55.65% 40.14% 2972

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_haste
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Affliction_T14H"
origin="unknown"
level=90
race=orc
spec=affliction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Va!....2.
talent_override=grimoire_of_service,if=num_targets>3
glyphs=soul_shards

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>3
actions+=/summon_doomguard
actions+=/soulburn,if=buff.dark_soul.up&(buff.dark_soul.remains>=18.5|buff.dark_soul.remains<=1.5)&shard_react
actions+=/soul_swap,if=buff.soulburn.up
actions+=/haunt,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&shard_react
actions+=/soul_swap,cycle_targets=1,if=num_targets>1&time<10&glyph.soul_swap.enabled
actions+=/haunt,cycle_targets=1,if=!in_flight_to_target&remains<tick_time+travel_time+cast_time&soul_shard>1
actions+=/soulburn,if=(dot.unstable_affliction.ticks_remain<action.unstable_affliction.add_ticks%2|dot.corruption.ticks_remain<action.corruption.add_ticks%2|dot.agony.ticks_remain<action.agony.add_ticks%2)&target.health.pct<=20&shard_react
actions+=/agony,cycle_targets=1,if=(!ticking|remains<=action.drain_soul.new_tick_time*2)&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=(!ticking|remains<(cast_time+tick_time))&target.time_to_die>=5&miss_react
actions+=/agony,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=8&miss_react
actions+=/corruption,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=6&miss_react
actions+=/unstable_affliction,cycle_targets=1,if=ticks_remain<add_ticks%2+1&target.time_to_die>=5&miss_react
actions+=/drain_soul,interrupt=1,chain=1,if=target.health.pct<=20
actions+=/life_tap,if=mana.pct<35
actions+=/malefic_grasp,chain=1
actions+=/life_tap,moving=1,if=mana.pct<80&mana.pct<target.health.pct
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/soulburn,cycle_targets=1,if=buff.soulburn.down&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target&shard_react
actions.aoe+=/seed_of_corruption,cycle_targets=1,if=(buff.soulburn.down&!in_flight_to_target&!ticking)|(buff.soulburn.up&!dot.soulburn_seed_of_corruption.ticking&!action.soulburn_seed_of_corruption.in_flight_to_target)
actions.aoe+=/haunt,cycle_targets=1,if=!in_flight_to_target&debuff.haunt.remains<cast_time+travel_time&shard_react
actions.aoe+=/life_tap,if=mana.pct<70
actions.aoe+=/fel_flame,cycle_targets=1,if=!in_flight_to_target

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all,reforge=crit_mastery
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_mastery
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=2636
# gear_haste_rating=7883
# gear_mastery_rating=2972
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warlock_Demonology_T14H : 118581 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
118581.1 118581.1 43.36 / 0.04% 3648 / 3.1% 11.7 6313.4 5707.9 Mana 0.00% 55.6 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
Glyphs
  • shadow_bolt

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:868366|472605|457051|85135|66442|57875|35463|10770&chds=0,1736732&chco=C79C6E,9482C9,9482C9,435133,FF6F00,C41F3B,9482C9,9482C9&chm=t++868366++summon_doomguard,C79C6E,0,0,15|t++472605++doom,9482C9,1,0,15|t++457051++service_felguard,9482C9,2,0,15|t++85135++hand_of_guldan,435133,3,0,15|t++66442++touch_of_chaos,FF6F00,4,0,15|t++57875++soul_fire,C41F3B,5,0,15|t++35463++shadow_bolt,9482C9,6,0,15|t++10770++melee,9482C9,7,0,15&chtt=Warlock_Demonology_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:27,20,17,16,14,12,12,7,7,7,6,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,C41F3B,C79C6E,9482C9,9482C9,9482C9,C79C6E,C79C6E,435133,9482C9,9482C9,C79C6E,C79C6E,435133,C79C6E&chl=touch_of_chaos|soul_fire|wild_imp: firebolt|felguard: melee|doom|corruption|shadow_bolt|felguard: felstorm|felguard: legion_strike|shadowflame|melee|doomguard: doom_bolt|service_felguard: felstorm|service_felguard: melee|hand_of_guldan|service_felguard: legion_strike&chtt=Warlock_Demonology_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:pqrtvx333434455875331100zwtomljkkkjjgffegfffddccedcbZaZZZbbccaaaaccddbbcddeeefeeeeffhighhiiiihgffeddcccbbZYXXWVVWWXZZbabbbbbbbcbccdddddccbZaZZZZYYYYYXXXXYYYYYZaaabcddeffggggfeeeeedcccbaaZYYYXXXXXYYYYXWWWWWWVVVVVVVVWWWVUUUUUVUUUVWWWWWXYYabdfgijkklmnnoppqqponlkihgedddccbaaZZYYZZZZZZZYYZYXXXXXXYYYXXXXYYYZZaaaaZaaZaabbcdeefghiijklnppqqponnmllkjjhgfedcaaZYYYZaaaZZZZZZZ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=118581|max=235685&chxp=1,1,50,100&chtt=Warlock_Demonology_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,2,4,7,8,29,43,44,75,122,149,195,262,334,341,415,501,544,598,597,603,637,561,550,563,523,443,337,298,260,233,164,138,105,91,71,39,28,30,18,13,6,4,5,1,2,0,0,0,1&chds=0,637&chbh=5&chxt=x&chxl=0:|min=111258|avg=118581|max=128398&chxp=0,1,43,100&chtt=Warlock_Demonology_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.7,26.0,24.0,7.9,3.1,2.3,1.4,0.4,0.4&chds=0,100&chdls=ffffff&chco=FF6F00,C41F3B,9482C9,435133,9482C9,9482C9,9482C9,9482C9,C79C6E&chl=touch_of_chaos 108.6s|soul_fire 95.1s|shadow_bolt 88.0s|hand_of_guldan 29.1s|life_tap 11.3s|doom 8.3s|service_felguard 5.2s|corruption 1.3s|summon_doomguard 1.3s&chtt=Warlock_Demonology_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Demonology_T14H 118581
blood_fury 0 0.0% 4.0 120.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
cancel_metamorphosis 0 0.0% 11.8 26.00sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: cancel_metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.82 11.82 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 11.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: cancel_metamorphosis

Static Values
  • id:0
  • school:unknown
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
corruption 8937 7.5% 1.0 40.52sec 3265872 2494869 0 0 0 0.0% 0.1% 0.0% 0.0% 235.9 11611 24194 13868 17.9% 0.0% 99.1%

Stats details: corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 1.00 235.85 235.85 1.3090 1.5372 3270773.09 3270773.09 0.00 8989.25 2494868.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 1.00 99.92% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 193.6 82.06% 11611.31 9509 17236 11611.43 10797 12263 2247370 2247370 0.00
crit 42.3 17.94% 24193.69 19588 35506 24191.20 21240 27275 1023403 1023403 0.00
DPS Timeline Chart

Action details: corruption

Static Values
  • id:172
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3750.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=6&miss_react
Spelldata
  • id:172
  • name:Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Corrupts the target, causing $o3 Shadow damage over $d.$?a104315[ Generates 4 Demonic Fury each time it deals damage.][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.200000
  • base_td:213.64
  • num_ticks:9
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
dark_soul 0 0.0% 5.0 80.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113861
  • school:shadow
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113861
  • name:Dark Soul: Knowledge
  • school:shadow
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
doom 10715 9.0% 8.0 45.67sec 489855 472605 0 0 0 0.0% 0.1% 0.0% 0.0% 32.0 102004 213473 122374 18.3% 0.0% 97.4%

Stats details: doom

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.01 8.01 32.05 32.05 1.0365 11.1263 3921679.18 3921679.18 0.00 10748.51 472605.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.00 99.91% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.2 81.73% 102004.27 58981 132149 102002.87 82288 110829 2671551 2671551 0.00
crit 5.9 18.27% 213473.05 121500 272228 213545.33 0 272228 1250129 1250129 0.00
DPS Timeline Chart

Action details: doom

Static Values
  • id:603
  • school:shadow
  • resource:demonic_fury
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains=30&miss_react
Spelldata
  • id:603
  • name:Doom
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $?$W2=2[${$t1/2000}.2][$t1] sec.
  • description:Inflicts impending doom upon the target, causing ${($m1+$SP*1)*4} Shadow damage over $d. When Doom critically strikes, a Wild Imp will be summoned to attack the target.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:1.000000
  • base_td:1068.20
  • num_ticks:4
  • base_tick_time:15.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
hand_of_guldan 1885 (6765) 1.6% (5.7%) 23.9 15.17sec 103738 85135 12172 25370 14521 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: hand_of_guldan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.87 47.51 0.00 0.00 1.2185 0.0000 689808.13 689808.13 0.00 85135.07 85135.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.02 82.14% 12172.09 0 39171 12171.27 8146 17243 474943 474943 0.00
crit 8.47 17.83% 25370.25 0 80693 25371.01 0 76857 214865 214865 0.00
miss 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: hand_of_guldan

Static Values
  • id:105174
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:1.3000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:15.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!in_flight&dot.shadowflame.remains
Spelldata
  • id:105174
  • name:Hand of Gul'dan
  • school:shadow
  • tooltip:(null)
  • description:Summons a falling meteor to strike the target and all enemies within $86040A1 yards for $86040s1 Shadow damage and inflicting them with Shadowflame. $@spellicon47960 $@spellname47960 $@spelldesc47960
life_tap 0 0.0% 9.3 36.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: life_tap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.27 9.27 0.00 0.00 1.2190 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 9.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: life_tap

Static Values
  • id:1454
  • school:shadow
  • resource:health
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:mana.pct<50
Spelldata
  • id:1454
  • name:Life Tap
  • school:shadow
  • tooltip:Absorbs $w3 healing.
  • description:$?s63320[Places a stacking heal absorb effect on you for $d equal to $m3% of your total health and restores][Restores] ${$m1*$MHP*0.01} mana.$?s63320[ Lasts $d.][]
melee 4264 3.6% 185.7 1.95sec 8404 10770 7112 14792 8486 18.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 185.71 183.91 0.00 0.00 0.7803 0.0000 1560668.11 1560668.11 0.00 10770.28 10770.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.74 81.96% 7112.16 4896 10969 7113.34 6635 7507 1072068 1072068 0.00
crit 33.03 17.96% 14791.94 10086 22597 14795.19 12194 17126 488600 488600 0.00
miss 0.15 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:103988
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:103988
  • name:Melee
  • school:shadow
  • tooltip:(null)
  • description:Your melee attacks become long ranged and deal Shadow.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.083000
  • base_dd_min:84.23
  • base_dd_max:93.09
metamorphosis 0 0.0% 16.5 23.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 16.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: metamorphosis

Static Values
  • id:103958
  • school:physical
  • resource:demonic_fury
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:10.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:103958
  • name:Metamorphosis
  • school:physical
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
service_felguard 0 (6539) 0.0% (5.5%) 4.0 120.92sec 598280 457051 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: service_felguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 1.3090 0.0000 0.00 0.00 0.00 457051.31 457051.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: service_felguard

Static Values
  • id:111898
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.grimoire_of_service.enabled
Spelldata
  • id:111898
  • name:Grimoire: Felguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Felguard who attacks the target for $d. Felguard will stun their target when summoned.
shadow_bolt 8526 7.2% 136.4 6.03sec 22877 35463 19221 40039 22877 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.41 136.41 0.00 0.00 0.6451 0.0000 3120553.91 3120553.91 0.00 35463.26 35463.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.26 82.30% 19220.58 17616 31932 19226.06 18354 20434 2157656 2157656 0.00
crit 24.05 17.63% 40038.65 36289 62653 40057.32 36397 49104 962898 962898 0.00
miss 0.10 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadow_bolt

Static Values
  • id:686
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:16500.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:686
  • name:Shadow Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s3 Shadow damage.$?a104315[ Generates 25 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.200000
  • base_dd_min:1281.84
  • base_dd_max:1281.84
shadowflame 4880 4.1% 23.7 15.16sec 75219 0 0 0 0 17.8% 0.0% 0.0% 0.0% 181.0 8243 17285 9866 18.0% 0.0% 37.5%

Stats details: shadowflame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.74 23.74 181.02 181.02 0.0000 0.7579 1786004.83 1786004.83 0.00 13018.19 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.51 82.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 4.23 17.82% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.5 82.05% 8243.03 5921 20444 8245.50 6958 9216 1224297 1224297 0.00
crit 32.5 17.95% 17284.98 12197 42116 17286.18 13587 23811 561708 561708 0.00
DPS Timeline Chart

Action details: shadowflame

Static Values
  • id:47960
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:47960
  • name:Shadowflame
  • school:shadowflame
  • tooltip:Deals $w1 Shadowflame damage every $t1 sec. Movement speed reduced by $w2%.
  • description:Reduces movement speed by $47960s2% and deals $47960o1 Shadowflame damage over $47960d. Generates 2 Demonic Fury every time it deals damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.137000
  • base_td:146.34
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
soul_fire 15046 12.7% 58.5 5.98sec 94122 57875 0 94833 94761 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: soul_fire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.51 58.11 0.00 0.00 1.6263 0.0000 5506725.32 5506725.32 0.00 57874.76 57874.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 58.07 99.92% 94832.97 74724 212525 94943.67 88139 104181 5506725 5506725 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: soul_fire

Static Values
  • id:6353
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:45000.0
  • cooldown:0.00
  • base_execute_time:4.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Spelldata
  • id:6353
  • name:Soul Fire
  • school:fire
  • tooltip:(null)
  • description:Burn the enemy's soul, causing $s1 Fire damage.$?s108869&1=0[ If used on a target below 25% health, the attack will trigger Molten Core.][] Soul Fire always critically strikes. In addition, the damage is increased by your critical strike chance.$?a104315&!a54879[ Generates 30 Demonic Fury.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.700000
  • base_dd_min:672.97
  • base_dd_max:822.52
summon_doomguard 0 (3106) 0.0% (2.6%) 1.0 1.#Rsec 1136691 868366 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_doomguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.3090 0.0000 0.00 0.00 0.00 868366.04 868366.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_doomguard

Static Values
  • id:18540
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:75000.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:18540
  • name:Summon Doomguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Doomguard to attack the target for $60478d. Doomguard will cast Doom Bolt until it departs. $@spelltooltip85692
touch_of_chaos 19720 16.6% 104.6 3.45sec 68994 66442 58032 120384 69071 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: touch_of_chaos

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.61 104.49 0.00 0.00 1.0384 0.0000 7217559.42 7217559.42 0.00 66441.68 66441.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.83 82.14% 58031.63 40066 89771 58037.94 53696 61095 4981083 4981083 0.00
crit 18.58 17.78% 120384.13 82537 184928 120415.25 97506 142362 2236476 2236476 0.00
miss 0.08 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: touch_of_chaos

Static Values
  • id:103964
  • school:chaos
  • resource:demonic_fury
  • range:40.0
  • travel_speed:120.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.corruption.remains<20
Spelldata
  • id:103964
  • name:Touch of Chaos
  • school:chaos
  • tooltip:(null)
  • description:Unleashes energy at the enemy, causing $s1 Chaos damage and extending the duration of Corruption.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.666000
  • base_dd_min:675.85
  • base_dd_max:746.99
pet - doomguard 18945 / 3106
doom_bolt 18945 2.6% 19.5 3.04sec 58358 20035 48987 100430 58358 18.3% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.48 19.48 0.00 0.00 2.9128 0.0000 1136691.15 1136691.15 0.00 20035.10 20035.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.90 81.64% 48987.22 39650 71887 48976.88 42108 55073 778978 778978 0.00
crit 3.56 18.29% 100429.70 79299 143774 98530.97 0 143774 357713 357713 0.00
miss 0.01 0.07% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45
pet - felguard 22215 / 22215
felstorm 5359 4.5% 8.1 45.87sec 242951 0 17968 36302 21189 17.7% 0.1% 0.0% 0.0% 56.0 27053 54706 31957 17.8% 0.1% 13.1%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.07 8.07 56.03 56.03 0.0000 0.8560 1961524.22 1961524.22 0.00 40899.17 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.64 82.26% 17968.32 15297 24823 17966.19 15297 20880 119341 119341 0.00
crit 1.43 17.65% 36301.97 30595 49645 28942.02 0 49645 51733 51733 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.0 82.11% 27053.07 22946 41194 27052.92 24969 28614 1244582 1244582 0.00
crit 10.0 17.81% 54705.59 45892 82387 54729.31 45892 69764 545868 545868 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 5079 4.3% 68.0 5.48sec 27337 26309 23141 46790 27337 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.00 68.00 0.00 0.00 1.0390 0.0000 1858895.45 1858895.45 0.00 26309.47 26309.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.83 82.11% 23141.32 19886 35701 23140.57 22119 24005 1292015 1292015 0.00
crit 12.12 17.82% 46790.27 39773 71402 46797.05 39773 58877 566880 566880 0.00
dodge 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.03 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 11776 9.9% 217.9 1.65sec 19777 13345 17641 35619 19777 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 217.94 217.94 0.00 0.00 1.4820 0.0000 4310179.74 4310179.74 0.00 13344.54 13344.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.69 58.13% 17640.50 15297 27462 17640.41 16987 18381 2234954 2234954 0.00
crit 38.81 17.81% 35618.59 30595 54925 35620.14 32405 40629 1382508 1382508 0.00
glance 52.26 23.98% 13255.06 11473 20597 13255.50 12318 14240 692717 692717 0.00
dodge 0.08 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.08 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
pet - wild_imp 16524 / 12750
firebolt 16524 10.8% 288.0 1.25sec 16202 7344 15192 30635 17923 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: firebolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 288.02 260.36 0.00 0.00 2.2060 0.0000 4666485.34 4666485.34 0.00 7344.45 7344.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 213.91 82.16% 15191.79 13216 23962 15192.28 14731 15807 3249702 3249702 0.00
crit 46.25 17.76% 30635.07 26432 47924 30637.52 28389 33281 1416783 1416783 0.00
miss 0.20 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: firebolt

Static Values
  • id:104318
  • school:fire
  • resource:energy
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:104318
  • name:Firebolt
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to a target.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.300000
  • base_dd_min:312.45
  • base_dd_max:328.47
pet - service_felguard 34530 / 6539
felstorm 14570 2.3% 4.0 120.92sec 252460 0 19826 39887 23518 18.5% 0.1% 0.0% 0.0% 24.8 31102 62574 36909 18.5% 0.1% 30.0%

Stats details: felstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 24.81 24.81 0.0000 0.8389 1009840.29 1009840.29 0.00 48517.36 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.26 81.45% 19825.53 15297 24801 19799.70 0 24350 64594 64594 0.00
crit 0.74 18.48% 39886.64 30595 49602 22344.80 0 49602 29480 29480 0.00
dodge 0.00 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.2 81.38% 31101.94 22946 41194 31111.97 27191 33626 627988 627988 0.00
crit 4.6 18.54% 62573.68 45892 82387 62225.19 0 82387 287779 287779 0.00
dodge 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.0 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: felstorm

Static Values
  • id:89751
  • school:physical
  • resource:energy
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:45.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89751
  • name:Felstorm
  • school:physical
  • tooltip:Striking for $89753m1% weapon damage every $t1 sec. Unable to use abilities during Felstorm.
  • description:The Felguard recklessly swings its weapon, striking all nearby targets within $89753A1 yards for $89753m1% weapon damage every $89751t1 sec for $89751d. The Felguard cannot perform any other abilities during Felstorm.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_CLIP
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Action details: felstorm_tick

Static Values
  • id:89753
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:89753
  • name:Felstorm
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc89751
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.50
legion_strike 7482 1.2% 16.0 17.11sec 32407 31218 27191 55334 32407 18.6% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: legion_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.00 16.00 0.00 0.00 1.0381 0.0000 518525.47 518525.47 0.00 31217.67 31217.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.01 81.33% 27191.46 19886 35701 27185.01 23693 30027 353834 353834 0.00
crit 2.98 18.60% 55334.34 39773 71402 53409.26 0 71402 164691 164691 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: legion_strike

Static Values
  • id:30213
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:30213
  • name:Legion Strike
  • school:physical
  • tooltip:Effectiveness of any healing reduced by $w4%.
  • description:A sweeping attack that does $s2% of the Felguard's weapon damage divided among all targets within $A2 yards. The Felguard's current target is also wounded, reducing the effectiveness of any healing received by $s4% for $30213d.$?a104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.30
melee 12478 2.0% 36.9 7.17sec 23442 17122 20699 42186 23442 18.5% 0.1% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.89 36.89 0.00 0.00 1.3691 0.0000 864754.90 864754.90 0.00 17122.16 17122.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.16 57.36% 20699.04 15297 27462 20698.38 18129 23141 437995 437995 0.00
crit 6.84 18.55% 42186.49 30595 54925 42177.98 0 54925 288637 288637 0.00
glance 8.86 24.01% 15594.30 11473 20597 15596.71 11473 20597 138123 138123 0.00
dodge 0.01 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
blood_fury 4.0 0.0 120.9sec 120.9sec 13.20% 13.20%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.2%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 13.16%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 5.0 0.0 80.8sec 80.9sec 27.32% 36.29%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:27.3%

Spelldata details

  • id:113861
  • name:Dark Soul: Knowledge
  • tooltip:Mastery increased by $s1.
  • description:Your soul is infused with demonic knowledge, increasing your Mastery by ${$113861m1} for $113861d.$?s56228[ |cFFFFFFFFPassive:|r Increases your Mastery by ${$113861m1/$56228m1}. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
demonic_calling 24.1 0.4 15.5sec 15.5sec 9.61% 11.52%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_demonic_calling
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • demonic_calling_1:9.6%

Spelldata details

  • id:114925
  • name:Demonic Calling
  • tooltip:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • description:Your next Shadow Bolt, Soul Fire,$?s114168[ Demonic Slash,][] or Touch of Chaos will summon a Wild Imp to attack the target.
  • max_stacks:1
  • duration:-0.00
  • cooldown:0.00
  • default_chance:1.00%
essence_of_terror 6.0 0.0 63.0sec 63.0sec 32.78% 32.78%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.8%
jade_serpent_potion 2.0 0.0 297.8sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 7.0 0.0 54.2sec 54.2sec 22.88% 23.71%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:22.9%
metamorphosis 16.5 0.0 22.9sec 22.9sec 38.84% 62.92%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • metamorphosis_1:38.8%

Spelldata details

  • id:103958
  • name:Metamorphosis
  • tooltip:Demon Form. Damage dealt increased by $103958w2%.
  • description:Temporarily transform into a demon, increasing damage dealt by ${$104315m1*$m3/100+$77219m1*$m3/100}.2%. $?!s124917|!s124913[ Metamorphosis prevents the use of ][]$?!s124913[Corruption and ][]$?!s124917[Hand of Gul'dan.][]
  • max_stacks:
  • duration:-0.00
  • cooldown:10.00
  • default_chance:1.00%
molten_core 17.0 48.0 16.6sec 5.4sec 58.37% 100.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_molten_core
  • max_stacks:99
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • molten_core_1:23.8%
  • molten_core_2:11.0%
  • molten_core_3:5.9%
  • molten_core_4:4.0%
  • molten_core_5:3.2%
  • molten_core_6:2.7%
  • molten_core_7:2.2%
  • molten_core_8:1.7%
  • molten_core_9:1.3%
  • molten_core_10:0.9%
  • molten_core_11:0.6%
  • molten_core_12:0.4%
  • molten_core_13:0.3%
  • molten_core_14:0.1%
  • molten_core_15:0.1%
  • molten_core_16:0.0%
  • molten_core_17:0.0%
  • molten_core_18:0.0%
  • molten_core_19:0.0%
  • molten_core_20:0.0%
  • molten_core_21:0.0%
  • molten_core_22:0.0%
  • molten_core_23:0.0%

Spelldata details

  • id:122355
  • name:Molten Core
  • tooltip:The cast time and mana cost of Soul Fire is reduced by $w1%.$?($W3>0)[ Soul Fire grants $s3 additional Demonic Fury.][]
  • description:Reduces the cast time and mana cost of your next Soul Fire spell by $122355s1%. $?($m3>0)[Soul Fire grants $s3 additional Demonic Fury. ][] Lasts $d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.00%
relic_of_yulon 7.1 0.0 52.2sec 52.2sec 28.74% 28.74%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.7%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.8 0.0 60.8sec 60.8sec 16.77% 16.77%

Buff details

  • buff initial source:Warlock_Demonology_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.8%
doomguard-stunned 2.0 0.0 12.0sec 0.0sec 3.33% 3.33%

Buff details

  • buff initial source:Warlock_Demonology_T14H_doomguard
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
felguard-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warlock_Demonology_T14H_felguard
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
service_felguard-stunned 1.0 0.0 0.0sec 0.0sec 1.44% 1.44%

Buff details

  • buff initial source:Warlock_Demonology_T14H_service_felguard
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
wild_imp-stunned 10.1 0.0 33.9sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:2.7%
wild_imp-stunned 10.3 0.0 32.7sec 0.0sec 3.84% 3.84%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:2.8%
wild_imp-stunned 4.0 0.0 65.6sec 0.0sec 3.54% 3.54%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:1.1%
wild_imp-stunned 1.0 0.0 79.3sec 0.0sec 2.39% 2.39%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.3%
wild_imp-stunned 0.1 0.0 59.2sec 0.0sec 0.30% 0.30%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.0%
wild_imp-stunned 0.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Warlock_Demonology_T14H_wild_imp
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.0%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Demonology_T14H
corruption Mana 1.0 3755.6 3750.0 3750.0 870.9
dark_soul Mana 5.0 75000.0 15000.0 15000.0 0.0
doom Demonic Fury 8.0 480.3 60.0 60.0 8164.2
hand_of_guldan Mana 23.9 357989.2 15000.0 15000.0 6.9
shadow_bolt Mana 45.5 750616.3 16500.0 5502.8 4.2
soul_fire Mana 46.6 1048345.6 22506.3 17918.5 5.3
soul_fire Demonic Fury 11.9 954.1 80.0 16.3 5771.6
summon_doomguard Mana 1.0 75000.0 75000.0 75000.0 15.2
touch_of_chaos Demonic Fury 104.6 4184.5 40.0 40.0 1724.8
pet - doomguard
doom_bolt Energy 19.5 681.7 35.0 35.0 1667.4
pet - felguard
felstorm Energy 8.1 484.4 60.0 60.0 4049.2
legion_strike Energy 68.0 4080.0 60.0 60.0 455.6
pet - wild_imp
firebolt Energy 288.0 288.0 1.0 1.0 16202.0
pet - service_felguard
felstorm Energy 4.0 240.0 60.0 60.0 4207.7
legion_strike Energy 16.0 960.0 60.0 60.0 540.1
Resource Gains Type Count Total Average Overflow
felguard Demonic Fury 67.95 815.36 12.00 0.00 0.00%
wild_imp Demonic Fury 287.80 1438.98 5.00 0.00 0.00%
service_felguard Demonic Fury 15.99 191.87 12.00 0.00 0.00%
corruption Demonic Fury 236.85 947.40 4.00 0.00 0.00%
metamorphosis Demonic Fury 136.56 -818.37 -5.99 -0.98 0.12%
shadowflame Demonic Fury 203.55 407.09 2.00 0.00 0.00%
soul_fire Demonic Fury 46.54 1396.32 30.00 0.00 0.00%
life_tap Mana 9.27 681788.16 73511.25 0.00 0.00%
shadow_bolt Demonic Fury 45.42 1135.61 25.00 0.00 0.00%
mp5_regen Mana 1463.00 1407308.37 961.93 135.39 0.01%
pet - doomguard
energy_regen Energy 240.00 655.82 2.73 199.40 23.32%
pet - felguard
energy_regen Energy 1463.00 4468.08 3.05 0.00 0.00%
pet - service_felguard
energy_regen Energy 275.51 863.53 3.13 25.49 2.87%
Resource RPS-Gain RPS-Loss
Health 0.00 20470.09
Mana 5707.91 6313.41
Demonic Fury 17.30 17.59
Combat End Resource Mean Min Max
Health -7002331.16 -7128813.75 -6908280.00
Mana 80626.86 10307.32 230829.82
Demonic Fury 87.86 0.00 331.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 0.0%
felhunter-Mana Cap 0.0%
succubus-Mana Cap 0.0%
infernal-Mana Cap 0.0%
observer-Mana Cap 0.0%
shivarra-Mana Cap 0.0%
abyssal-Mana Cap 0.0%
felguard-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
wild_imp-Mana Cap 0.0%
service_felguard-Mana Cap 0.0%
service_imp-Mana Cap 0.0%
service_voidwalker-Mana Cap 0.0%

Procs

Count Interval
hat_donor 80.7 4.4sec
wild_imp 29.9 12.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 118581.06
Minimum 111257.95
Maximum 128397.59
Spread ( max - min ) 17139.65
Range [ ( max - min ) / 2 * 100% ] 7.23%
Standard Deviation 2211.5942
5th Percentile 115051.98
95th Percentile 122347.20
( 95th Percentile - 5th Percentile ) 7295.21
Mean Distribution
Standard Deviation 22.1204
95.00% Confidence Intervall ( 118537.71 - 118624.42 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1336
0.1 Scale Factor Error with Delta=300 41753
0.05 Scale Factor Error with Delta=300 167014
0.01 Scale Factor Error with Delta=300 4175366
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 118581.06

Damage

Sample Data
Count 9996
Mean 27073771.99

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 339.25
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 6.82 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.00 blood_fury
A 5.00 dark_soul
B 4.00 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 22.57 melee
F 8.07 felguard:felstorm
G 0.00 wrathguard:wrathstorm
H 0.00 run_action_list,name=aoe,if=num_targets>5
I 1.00 summon_doomguard
J 1.00 corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
K 8.01 doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
L 16.47 metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
M 11.82 cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
N 23.87 hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
O 44.99 touch_of_chaos,if=dot.corruption.remains<20
P 62.57 soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
Q 59.62 touch_of_chaos
R 9.27 life_tap,if=mana.pct<50
S 49.17 shadow_bolt
T 0.00 fel_flame,moving=1
U 0.00 life_tap

Sample Sequence

79ABFIJLEKKOKNSSPNLEOOOOQQMPPPNPPPPRSSSRSNSLEOOOOEMSFPPSNSS7PPLEOOOQMRNSSPLEOQQQQAKQQQQQQQQQEQQQFQQQQQNPPNSSSPPNPPR79BLEOOOMPSSNPPPRSFSLEOOOOMNSSSSLEKOQQMPANPRLEQQQQQQEQQKQQQQQEMN7SSFSSNPSSPSPLEOOOOMNRSSSLEOQQQQMNPPPPPLEOFQQQQMNPPP79ABLEKOQQQQQQQQQQQQQQQQMNSSNPPRSSFPSNPLEOOEOMPPPP8PNPRPLEO7OOPMPPNPPLEOOPPMPAFRNPLEKOOPPOPPPOPPEPOQNPPPPNPLEOPEOP79BP

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 543 543 343
Health 490075 458841 0
Mana 300000 300000 0
Demonic Fury 1000 1000 0
Spell Power 32587 27225 7907
Spell Hit 14.92% 14.92% 5074
Spell Crit 19.90% 13.95% 2773
Spell Haste 17.77% 12.16% 5170
Mana Per 5 17666 16825 0
Attack Power 315 270 0
Melee Hit 14.92% 14.92% 5074
Melee Crit 12.45% 7.44% 2773
Melee Haste 12.16% 12.16% 5170
Swing Speed 23.38% 12.16% 5170
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 22.30% 17.30% 5581

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_mastery
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160mastery_80int_160mastery_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160mastery_80int_160hit_160int_120haste,reforge=haste_mastery
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit,reforge=haste_mastery
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160mastery_60mastery,enchant=140mastery
Wrists twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_mastery
Finger1 seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Demonology_T14H"
origin="unknown"
level=90
race=orc
spec=demonology
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#VZ!2...1.
glyphs=shadow_bolt

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/melee
actions+=/felguard:felstorm
actions+=/wrathguard:wrathstorm
actions+=/run_action_list,name=aoe,if=num_targets>5
actions+=/summon_doomguard
actions+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions+=/doom,cycle_targets=1,if=(!ticking|remains<tick_time|(ticks_remain+1<n_ticks&buff.dark_soul.up))&target.time_to_die>=30&miss_react
actions+=/metamorphosis,if=buff.dark_soul.up|dot.corruption.remains<5|demonic_fury>=900|demonic_fury>=target.time_to_die*30
actions+=/cancel_metamorphosis,if=dot.corruption.remains>20&buff.dark_soul.down&demonic_fury<=750&target.time_to_die>30
actions+=/hand_of_guldan,if=!in_flight&dot.shadowflame.remains<travel_time+action.shadow_bolt.cast_time
actions+=/touch_of_chaos,if=dot.corruption.remains<20
actions+=/soul_fire,if=buff.molten_core.react&(buff.metamorphosis.down|target.health.pct<25)
actions+=/touch_of_chaos
actions+=/life_tap,if=mana.pct<50
actions+=/shadow_bolt
actions+=/fel_flame,moving=1
actions+=/life_tap

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/corruption,cycle_targets=1,if=(!ticking|remains<tick_time)&target.time_to_die>=6&miss_react
actions.aoe+=/hand_of_guldan
actions.aoe+=/metamorphosis,if=demonic_fury>=1000|demonic_fury>=31*target.time_to_die
actions.aoe+=/immolation_aura
actions.aoe+=/void_ray,if=dot.corruption.remains<10
actions.aoe+=/doom,cycle_targets=1,if=(!ticking|remains<40)&target.time_to_die>30&miss_react
actions.aoe+=/void_ray
actions.aoe+=/harvest_life,chain=1,if=talent.harvest_life.enabled
actions.aoe+=/hellfire,if=!talent.harvest_life.enabled
actions.aoe+=/life_tap

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=crit_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_mastery
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int
chest=shaskin_robes,id=87190,gems=80int_160mastery_80int_160mastery_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int,reforge=haste_mastery
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii,reforge=haste_mastery
waist=belt_of_malleable_amber,id=86981,gems=80int_160mastery_80int_160hit_160int_120haste,reforge=haste_mastery
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit,reforge=haste_mastery
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160mastery_60mastery,enchant=140mastery
finger1=seal_of_the_profane,id=86982,enchant=160int,reforge=spi_haste
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=crit_mastery
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit,reforge=crit_mastery
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_mastery

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=343
# gear_spell_power=7907
# gear_hit_rating=5074
# gear_crit_rating=2773
# gear_haste_rating=5170
# gear_mastery_rating=5581
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felguard

Warlock_Destruction_T14H : 108250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
108250.1 108250.1 36.07 / 0.03% 3041 / 2.8% 3.1 27604.4 27483.4 Mana 0.00% 47.2 100.0%
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
Glyphs
  • conflagrate
  • burning_embers

Charts

http://4.chart.apis.google.com/chart?chs=550x210&cht=bhg&chf=bg,s,333333&chd=t:915416|354619|155942|151869|85857|64830&chds=0,1830832&chco=C79C6E,9482C9,C41F3B,9482C9,C41F3B,C41F3B&chm=t++915416++summon_terrorguard,C79C6E,0,0,15|t++354619++shadowburn,9482C9,1,0,15|t++155942++immolate,C41F3B,2,0,15|t++151869++chaos_bolt,9482C9,3,0,15|t++85857++conflagrate,C41F3B,4,0,15|t++64830++incinerate,C41F3B,5,0,15&chtt=Warlock_Destruction_T14H Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:48,25,17,13,9,8,5,4&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C79C6E,C41F3B,C41F3B,9482C9,9482C9,9482C9&chl=incinerate|chaos_bolt|observer: melee|immolate|conflagrate|observer: tongue_lash|shadowburn|terrorguard: doom_bolt&chtt=Warlock_Destruction_T14H Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:vtvvvwxx0013455582430z0yxwvutqpnnmmmmkiggggfgeeddcbZZZaZaZZaaaZZaZabbbbcdddcddefffeeeeffffgghgfffeedccddedcaZZZYYYZaaaaaacbbbbbbbbccbbaaaaabaaYYZZZYZabaaabbbcbcccdddcddeffeddefedcdcccaccdbbbaZZaaaYZaaaaaaaaaZZZZaaaaaaaZYXWXZYYXXXXXXXXYZZZabcdffefghihhiiijihihhhgfdcdcbbabbbaaZZZXXYYZabbaaabbbbacddcdfgffefegfeecddddcccdfeedeeefefgikjjiiiiihggghgfeeeedcaaabcbbaaaaZZZ&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=108250|max=212698&chxp=1,1,51,100&chtt=Warlock_Destruction_T14H DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:2,0,2,2,4,10,17,21,40,49,78,109,152,178,224,251,365,446,477,533,566,627,653,631,644,579,553,514,449,394,323,243,222,171,117,97,77,57,39,27,20,16,6,4,1,3,2,0,0,1&chds=0,653&chbh=5&chxt=x&chxl=0:|min=101375|avg=108250|max=116072&chxp=0,1,47,100&chtt=Warlock_Destruction_T14H DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:62.2,13.8,9.1,7.1,1.2,0.3&chds=0,100&chdls=ffffff&chco=C41F3B,9482C9,C41F3B,C41F3B,9482C9,C79C6E&chl=incinerate 227.6s|chaos_bolt 50.5s|conflagrate 33.2s|immolate 25.9s|shadowburn 4.5s|summon_terrorguard 1.2s&chtt=Warlock_Destruction_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warlock_Destruction_T14H 108250
blood_fury 0 0.0% 4.0 120.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.00 4.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: blood_fury

Static Values
  • id:33702
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:33702
  • name:Blood Fury
  • school:physical
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
chaos_bolt 20961 19.4% 22.4 13.50sec 342526 151869 0 342526 342526 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: chaos_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.40 22.40 0.00 0.00 2.2554 0.0000 7671816.26 7671816.26 0.00 151869.04 151869.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 22.40 100.00% 342526.06 294151 521032 342546.80 326685 355321 7671816 7671816 0.00
DPS Timeline Chart

Action details: chaos_bolt

Static Values
  • id:116858
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:16.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react&(buff.backdraft.stack<3|level<86)
Spelldata
  • id:116858
  • name:Chaos Bolt
  • school:shadow
  • tooltip:(null)
  • description:Unleashes a blast of chaos, causing ${$m1*(1+$77220m1/100)} Shadow damage. Chaos Bolt always critically strikes. In addition, the damage is increased by your critical strike chance.$?s116858[][ Replaces Soul Fire.]
Direct Damage
  • may_crit:true
  • direct_power_mod:2.250000
  • base_dd_min:2163.11
  • base_dd_max:2643.80
conflagrate 7789 7.2% 32.0 11.64sec 89088 85857 67408 142359 89088 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: conflagrate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.00 32.00 0.00 0.00 1.0376 0.0000 2850796.31 2850796.31 0.00 85857.01 85857.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.74 71.07% 67408.40 61951 90176 67396.23 63760 70703 1533123 1533123 0.00
crit 9.26 28.93% 142358.80 127619 185763 142449.39 127619 161885 1317673 1317673 0.00
DPS Timeline Chart

Action details: conflagrate

Static Values
  • id:17962
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:12000.0
  • cooldown:12.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.backdraft.down
Spelldata
  • id:17962
  • name:Conflagrate
  • school:fire
  • tooltip:Movement speed reduced by $s2%.
  • description:Target enemy instantly explodes, dealing $s1 Fire damage$?s56235[ and reducing their movement speed by $s2% for $d.][. If the target is afflicted by Immolate, their movement speed is reduced by $s2% for $17962d.]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.500000
  • base_dd_min:1522.19
  • base_dd_max:1682.42
dark_soul 0 0.0% 5.0 80.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dark_soul

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 5.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dark_soul

Static Values
  • id:113858
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:15000.0
  • cooldown:80.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:113858
  • name:Dark Soul: Instability
  • school:fire
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
immolate 11054 10.2% 22.1 16.35sec 183171 155942 16593 35067 21808 28.2% 0.0% 0.0% 0.0% 163.3 16544 34979 21824 28.6% 0.0% 97.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.09 22.09 163.30 163.30 1.1746 2.1892 4045591.52 4045591.52 0.00 10550.53 155941.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.85 71.77% 16592.57 15322 22303 16588.39 15709 17580 263016 263016 0.00
crit 6.23 28.23% 35066.77 31564 45945 35088.30 0 44067 218641 218641 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.5 71.36% 16543.83 15322 22303 16543.77 15968 17128 1927801 1927801 0.00
crit 46.8 28.64% 34979.23 31564 45945 34985.94 33050 36993 1636133 1636133 0.00
DPS Timeline Chart

Action details: immolate

Static Values
  • id:348
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:36000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ticks_remain=5&miss_react
Spelldata
  • id:348
  • name:Immolate
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Burns the enemy for ${$m1*$<mastery>} Fire damage and then an additional ${(($m2+($SP*0.3))*$<mastery>)*5} Fire damage over $d.$?s108647[ Critical strikes have a chance to generate Burning Embers.][]$?s348[][ Replaces Corruption.]
Direct Damage
  • may_crit:true
  • direct_power_mod:0.371000
  • base_dd_min:396.30
  • base_dd_max:396.30
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.371000
  • base_td:396.30
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_EXTEND
incinerate 40312 37.2% 174.8 2.06sec 84406 64830 65315 136953 84840 27.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: incinerate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 174.80 173.91 0.00 0.00 1.3020 0.0000 14754036.84 14754036.84 0.00 64830.11 64830.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.51 72.75% 65315.02 60712 88372 65314.09 63950 66562 8262912 8262912 0.00
crit 47.40 27.25% 136953.21 125066 182047 136964.24 130564 143563 6491125 6491125 0.00
DPS Timeline Chart

Action details: incinerate

Static Values
  • id:29722
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60000.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:29722
  • name:Incinerate
  • school:fire
  • tooltip:(null)
  • description:Deals $s1 Fire damage to an enemy.$?s108647[ Generates Burning Embers. Critical strikes double this effect.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:1420.71
  • base_dd_max:1570.26
shadowburn 4352 4.0% 5.6 11.98sec 285274 354619 216535 438431 285274 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowburn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.58 5.58 0.00 0.00 0.8045 0.0000 1592950.41 1592950.41 0.00 354619.42 354619.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 3.85 69.02% 216535.04 194944 269380 216504.47 0 262522 834557 834557 0.00
crit 1.73 30.98% 438430.59 401585 554922 387972.76 0 554922 758394 758394 0.00
DPS Timeline Chart

Action details: shadowburn

Static Values
  • id:17877
  • school:shadow
  • resource:burning_ember
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.5000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ember_react
Spelldata
  • id:17877
  • name:Shadowburn
  • school:shadow
  • tooltip:(null)
  • description:Instantly blasts the target for ${$17877m2*(1+$77220m1*0.01)} Shadow damage. Only usable on enemies that have less than 20% health. Restores $125882m1% of your total mana after $29341d. If the target dies within $29341d, and yields experience or honor, the caster gains a Burning Ember instead.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.500000
  • base_dd_min:3364.84
  • base_dd_max:4112.58
summon_terrorguard 0 (3099) 0.0% (2.9%) 1.0 1.#Rsec 1134200 915416 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: summon_terrorguard

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 2.00 0.00 0.00 1.2390 0.0000 0.00 0.00 0.00 915416.02 915416.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: summon_terrorguard

Static Values
  • id:112927
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:37500.0
  • cooldown:600.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:112927
  • name:Summon Terrorguard
  • school:shadow
  • tooltip:(null)
  • description:Summons a Terrorguard to attack the target for $112926d. The Terrorguard casts Doom Bolt until it departs. $@spelltooltip85692
pet - observer 20683 / 20683
melee 14014 12.9% 258.7 1.41sec 19829 14039 16092 32910 19829 27.8% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 258.66 258.66 0.00 0.00 1.4124 0.0000 5129100.92 5129100.92 0.00 14039.02 14039.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.67 48.20% 16091.54 15010 21638 16091.29 15723 16443 2006111 2006111 0.00
crit 71.96 27.82% 32910.07 30019 43276 32912.30 31757 34587 2368093 2368093 0.00
glance 62.04 23.98% 12168.40 11257 16228 12168.59 11723 12724 754897 754897 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
tongue_lash 6670 6.2% 80.0 4.64sec 30513 29388 23631 48348 30513 27.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: tongue_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.00 80.00 0.00 0.00 1.0383 0.0000 2441057.73 2441057.73 0.00 29388.38 29388.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.72 72.16% 23630.74 21874 31846 23629.29 22944 24305 1364058 1364058 0.00
crit 22.28 27.84% 48348.40 43747 63691 48360.12 44696 51984 1077000 1077000 0.00
DPS Timeline Chart

Action details: tongue_lash

Static Values
  • id:115778
  • school:shadow
  • resource:energy
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115778
  • name:Tongue Lash
  • school:shadow
  • tooltip:(null)
  • description:Lick the enemy, causing $s1 Shadow damage.$?s104315[ Master gains $s3 Demonic Fury.][] |cFF777777(Right-Click to toggle)|r
Direct Damage
  • may_crit:true
  • direct_power_mod:0.506000
  • base_dd_min:540.51
  • base_dd_max:540.51
pet - terrorguard 18903 / 3099
doom_bolt 18903 2.9% 19.4 2.87sec 58371 20545 42615 93721 58371 30.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: doom_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.43 19.43 0.00 0.00 2.8411 0.0000 1134200.45 1134200.45 0.00 20545.25 20545.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.44 69.17% 42615.30 38904 56641 42561.83 38904 45927 572757 572757 0.00
crit 5.99 30.83% 93720.77 77808 113282 93972.35 0 113282 561443 561443 0.00
DPS Timeline Chart

Action details: doom_bolt

Static Values
  • id:85692
  • school:shadow
  • resource:energy
  • range:30.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • cooldown:0.00
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85692
  • name:Doom Bolt
  • school:shadow
  • tooltip:(null)
  • description:Sends a shadowy bolt at the enemy, causing $s1 Shadow damage. Deals $s2% additional damage to targets below 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.900000
  • base_dd_min:913.31
  • base_dd_max:1009.45

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
backdraft 32.0 0.0 11.6sec 11.6sec 47.64% 50.08%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_backdraft
  • max_stacks:6
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • backdraft_1:11.5%
  • backdraft_2:14.4%
  • backdraft_3:21.8%

Spelldata details

  • id:117828
  • name:Backdraft
  • tooltip:Incinerate's cast time and mana cost reduced by $s1%.$?$W3>0[ Chaos Bolt's cast time reduced by $s3%][]
  • description:When you cast Conflagrate, the cast time for your next three Incinerate$?s123686[ or one Chaos Bolt][] is reduced by $117828s1%. Lasts $117828d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
blood_fury 4.0 0.0 121.0sec 120.9sec 13.13% 13.13%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:spell_power
    • amount:2257.20

    Stack Uptimes

    • blood_fury_1:13.1%

Spelldata details

  • id:33702
  • name:Blood Fury
  • tooltip:Spell power increased by $s2.
  • description:Increases your spell power by $s2. Lasts $d.
  • max_stacks:
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 14.62%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dark_soul 5.0 0.0 80.8sec 80.9sec 27.32% 27.61%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_dark_soul
  • max_stacks:1
  • duration:20.00
  • cooldown:80.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • dark_soul_1:27.3%

Spelldata details

  • id:113858
  • name:Dark Soul: Instability
  • tooltip:Critical strike chance increased by $w1%.
  • description:Infuses your soul with unstable power, increasing your critical strike chance by $113858s1% for $113858d.$?s56228[ |cFFFFFFFFPassive:|r Increases your critical strike chance by ${$113858m1/$56228m1}%. This effect is disabled while on cooldown.][]
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
essence_of_terror 6.0 0.0 66.0sec 66.0sec 32.03% 32.03%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:32.0%
jade_serpent_potion 2.0 0.0 297.8sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:12.3%
jade_spirit 6.6 0.0 58.6sec 58.6sec 21.14% 21.21%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:50.00
  • default_chance:10.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:21.1%
relic_of_yulon 7.0 0.0 54.5sec 54.5sec 28.56% 28.56%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_relic_of_yulon
  • max_stacks:1
  • duration:15.00
  • cooldown:50.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:3027.00

    Stack Uptimes

    • relic_of_yulon_1:28.6%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
synapse_springs_2 6.7 0.0 60.9sec 60.9sec 16.60% 16.60%

Buff details

  • buff initial source:Warlock_Destruction_T14H
  • cooldown name:synapse_springs_2_hands
  • max_stacks:1
  • duration:10.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:intellect
    • amount:1920.00

    Stack Uptimes

    • synapse_springs_2_1:16.6%
observer-stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warlock_Destruction_T14H_observer
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
terrorguard-stunned 2.0 0.0 12.0sec 0.0sec 3.33% 3.33%

Buff details

  • buff initial source:Warlock_Destruction_T14H_terrorguard
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:0.5%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warlock_Destruction_T14H
chaos_bolt Burning Ember 22.4 22.4 1.0 1.0 342526.1
conflagrate Mana 32.0 383997.6 12000.0 12000.0 7.4
dark_soul Mana 5.0 75000.0 15000.0 15000.0 0.0
immolate Mana 22.1 795111.6 36000.0 36000.0 5.1
incinerate Mana 174.8 8811617.0 50410.4 50410.4 1.7
shadowburn Burning Ember 5.6 5.6 1.0 1.0 285273.9
summon_terrorguard Mana 1.0 37500.0 37500.0 37500.0 30.2
pet - observer
tongue_lash Energy 80.0 4800.0 60.0 60.0 508.6
pet - terrorguard
doom_bolt Energy 19.4 680.1 35.0 35.0 1667.8
Resource Gains Type Count Total Average Overflow
shadowburn Mana 5.16 215884.55 41870.85 16133.76 6.95%
immolate Burning Ember 53.01 5.30 0.10 0.00 0.00%
incinerate Burning Ember 173.91 22.13 0.13 0.00 0.00%
mp5_regen Mana 1463.00 9843050.08 6727.99 911218.22 8.47%
pet - observer
energy_regen Energy 1463.00 4709.04 3.22 0.00 0.00%
pet - terrorguard
energy_regen Energy 239.00 680.08 2.85 219.02 24.36%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Mana 27483.43 27604.44
Burning Ember 0.07 0.08
Combat End Resource Mean Min Max
Health -6320190.00 -6320190.00 -6320190.00
Mana 255263.64 193227.16 300000.00
Burning Ember 0.45 0.00 1.10
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.5%
felhunter-Mana Cap 6.5%
succubus-Mana Cap 6.5%
infernal-Mana Cap 6.5%
observer-Mana Cap 6.5%
shivarra-Mana Cap 6.5%
abyssal-Mana Cap 6.5%
service_felguard-Mana Cap 6.5%
service_imp-Mana Cap 6.5%
service_voidwalker-Mana Cap 6.5%

Procs

Count Interval
hat_donor 46.8 7.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 108250.14
Minimum 101375.50
Maximum 116072.31
Spread ( max - min ) 14696.81
Range [ ( max - min ) / 2 * 100% ] 6.79%
Standard Deviation 1839.9811
5th Percentile 105222.98
95th Percentile 111304.79
( 95th Percentile - 5th Percentile ) 6081.81
Mean Distribution
Standard Deviation 18.4035
95.00% Confidence Intervall ( 108214.07 - 108286.21 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1109
0.1 Scale Factor Error with Delta=300 28900
0.05 Scale Factor Error with Delta=300 115603
0.01 Scale Factor Error with Delta=300 2890083
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 108250.14

Damage

Sample Data
Count 9996
Mean 30915191.35

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 287.74
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 dark_intent,if=!aura.spell_power_multiplier.up
3 0.00 summon_pet
4 0.00 snapshot_stats
5 0.00 jade_serpent_potion
Default action list
# count action,conditions
6 0.00 curse_of_the_elements,if=debuff.magic_vulnerability.down
7 6.75 use_item,name=shaskin_gloves
8 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
9 4.00 blood_fury
A 5.00 dark_soul
B 0.00 service_pet,if=talent.grimoire_of_service.enabled
C 0.00 grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
D 0.00 summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
E 0.00 run_action_list,name=aoe,if=num_targets>2
F 1.00 summon_doomguard
G 0.00 havoc,target=2,if=num_targets>1
H 5.58 shadowburn,if=ember_react
I 24.57 chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
J 32.00 conflagrate,if=buff.backdraft.down
K 22.66 immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
L 185.18 incinerate

Sample Sequence

79AFIJKLLLJLLLLKIJLLLLLLILLJLLKILLLLLJLILLLLKLJLLLI7LLLJKLLLLLIJLLLAKILLLJLLILLLLKJLILLLLLJLLKLI79LLJLLLLLIKJKLLLLLLIJKLLLLLLLLIAJLKLLLLIJLLLLL7KJLLLLILLJLLKLLLLIJLLLLKLLLIJLLLLLLLJKLILLL9L7AJLLLIKLLLJLILLLKLJLLLLILLLJKLLLLILLJ8LLLLLKHL7JLLLLLLHLJKLLLLLALLHJKLLLLLHLLJLLLLHKLLLJLLLLLHL9L7J

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 158 150 80
Agility 162 154 80
Stamina 24548 22317 20183
Intellect 21728 19328 18223
Spirit 550 550 350
Health 490075 458841 0
Mana 300000 300000 0
Burning Ember 4 4 0
Spell Power 32587 27225 7907
Spell Hit 15.01% 15.01% 5105
Spell Crit 21.66% 15.71% 3831
Spell Haste 24.62% 18.68% 7940
Mana Per 5 135520 129067 0
Attack Power 315 270 0
Melee Hit 15.01% 15.01% 5105
Melee Crit 14.22% 9.21% 3831
Melee Haste 18.68% 18.68% 7940
Swing Speed 30.55% 18.68% 7940
Expertise 0.00% 0.00% 0
Armor 14947 14947 14857
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 47.61% 32.61% 1720

Gear

Average Item Level: 506.50
Head shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
Neck amulet_of_seven_curses,id=87028,reforge=crit_haste
Shoulders shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
Shirt empty
Chest shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Waist belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
Legs dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
Feet sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery,reforge=mastery_crit
Wrists twisting_wind_bracers,id=86958,enchant=180int
Hands shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
Finger1 watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
Finger2 fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
Trinket1 essence_of_terror,id=87175
Trinket2 relic_of_yulon,id=79331
Back cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
Main Hand loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
Off Hand tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste
Unknown empty
Tabard empty

Talents

Level
15 Dark Regeneration Soul Leech Harvest Life
30 Howl of Terror Mortal Coil Shadowfury
45 Soul Link Sacrificial Pact Dark Bargain
60 Blood Fear Burning Rush Unbound Will
75 Grimoire of Supremacy Grimoire of Service Grimoire of Sacrifice
90 Archimonde's Vengeance Kil'jaeden's Cunning Mannoroth's Fury

Profile

#!./simc

warlock="Warlock_Destruction_T14H"
origin="unknown"
level=90
race=orc
spec=destruction
role=spell
position=back
professions=engineering=600/enchanting=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Vb!....0.
glyphs=conflagrate/burning_embers

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/dark_intent,if=!aura.spell_power_multiplier.up
actions.precombat+=/summon_pet
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion

actions=curse_of_the_elements,if=debuff.magic_vulnerability.down
actions+=/use_item,name=shaskin_gloves
actions+=/jade_serpent_potion,if=buff.bloodlust.react|target.health.pct<=20
actions+=/blood_fury
actions+=/dark_soul
actions+=/service_pet,if=talent.grimoire_of_service.enabled
actions+=/grimoire_of_sacrifice,if=talent.grimoire_of_sacrifice.enabled
actions+=/summon_pet,if=talent.grimoire_of_sacrifice.enabled&buff.grimoire_of_sacrifice.down
actions+=/run_action_list,name=aoe,if=num_targets>2
actions+=/summon_doomguard
actions+=/havoc,target=2,if=num_targets>1
actions+=/shadowburn,if=ember_react
actions+=/chaos_bolt,if=ember_react&(buff.backdraft.stack<3|level<86)
actions+=/conflagrate,if=buff.backdraft.down
actions+=/immolate,cycle_targets=1,if=ticks_remain<add_ticks%2&target.time_to_die>=5&miss_react
actions+=/incinerate

actions.aoe=summon_doomguard,if=num_targets<7
actions.aoe+=/summon_infernal,if=num_targets>=7
actions.aoe+=/rain_of_fire,if=!ticking&!in_flight
actions.aoe+=/fire_and_brimstone,if=ember_react&buff.fire_and_brimstone.down
actions.aoe+=/immolate,if=buff.fire_and_brimstone.up&!ticking
actions.aoe+=/conflagrate,if=ember_react&buff.fire_and_brimstone.up
actions.aoe+=/incinerate,if=buff.fire_and_brimstone.up
actions.aoe+=/immolate,cycle_targets=1,if=!ticking

head=shaskin_hood,id=87188,gems=burning_primal_80int_160hit_180int,reforge=mastery_haste
neck=amulet_of_seven_curses,id=87028,reforge=crit_haste
shoulders=shaskin_mantle,id=87191,gems=80int_160hit_60int,enchant=200int_100crit,reforge=mastery_haste
back=cloak_of_overwhelming_corruption,id=87150,enchant=180int,reforge=mastery_hit
chest=shaskin_robes,id=87190,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=twisting_wind_bracers,id=86958,enchant=180int
hands=shaskin_gloves,id=87187,enchant=170haste,addon=synapse_springs_mark_ii
waist=belt_of_malleable_amber,id=86981,gems=80int_160haste_80int_160hit_160int_120haste
legs=dreadwoven_leggings_of_failure,id=87174,gems=160int_80int_160hit_120int,enchant=285int_165crit
feet=sandals_of_the_blackest_night,id=87162,gems=80int_160haste_60mastery,enchant=140mastery,reforge=mastery_crit
finger1=watersoul_signet,id=87151,enchant=160int,reforge=spi_crit
finger2=fragment_of_fear_made_flesh,id=86949,enchant=160int,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=relic_of_yulon,id=79331
main_hand=loshan_terror_incarnate,id=87164,gems=500int,enchant=jade_spirit
off_hand=tornadosummoning_censer,id=86960,enchant=165int,reforge=crit_haste

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20183
# gear_intellect=18223
# gear_spirit=350
# gear_spell_power=7907
# gear_hit_rating=5105
# gear_crit_rating=3831
# gear_haste_rating=7940
# gear_mastery_rating=1720
# gear_armor=14857
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=shaskin_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=loshan_terror_incarnate,heroic=1,weapon=sword_2.20speed_2880min_5349max,enchant=jade_spirit
default_pet=felhunter

Warrior_Arms_T14H : 114908 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
114907.7 114907.7 73.30 / 0.06% 6126 / 5.3% 15937.3 7.2 7.3 Rage 0.01% 52.5 100.0%
Origin http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://9.chart.apis.google.com/chart?chs=550x300&cht=bhg&chf=bg,s,333333&chd=t:184605|135039|70662|59907|52078|44887|26114|14773|12313&chds=0,369211&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++184605++execute,C79C6E,0,0,15|t++135039++dragon_roar,C79C6E,1,0,15|t++70662++mortal_strike,C79C6E,2,0,15|t++59907++slam,C79C6E,3,0,15|t++52078++overpower,C79C6E,4,0,15|t++44887++colossus_smash,C79C6E,5,0,15|t++26114++impending_victory,C79C6E,6,0,15|t++14773++melee_main_hand,C79C6E,7,0,15|t++12313++heroic_throw,C79C6E,8,0,15&chtt=Warrior_Arms_T14H Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,14,12,9,9,7,6,5,5,3,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=mortal_strike|execute|overpower|melee_main_hand|slam|opportunity_strike|heroic_strike|bloodbath|deep_wounds|colossus_smash|dragon_roar|heroic_leap|heroic_throw|impending_victory&chtt=Warrior_Arms_T14H Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:6354223110zywxvrqomnmklkijiggfeffffdeecedbdcaccaaaYbbacadeeggfiihjjikkkljjkijifgedecbcaabZabZababbabbcccbbbbbbbbbbcccddefffggghhiiijiiihghfffeeeeeffefffggghhhiihgggffgeefcddbcdbcdbddefegggiihjjijjijihihhhfggeffdeececbcaabZZaYZaXaZXZaYaaccceffghhiiikkikkikjijhigfgeeedcdcbdbbdbbcababcabcbddcegfijimoorstwvzy0213644645854634513121y1zwwuutsrrqqqqpoopooqnmmoomnmlmlkljik&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=114908|max=197934&chxp=1,1,58,100&chtt=Warrior_Arms_T14H DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,5,4,4,15,28,35,44,89,108,179,202,295,365,405,493,542,593,641,638,590,649,612,586,523,441,445,333,299,216,168,126,93,61,51,54,20,17,11,7,3,2,1,0,1,0,0,0,1&chds=0,649&chbh=5&chxt=x&chxl=0:|min=101496|avg=114908|max=132482&chxp=0,1,43,100&chtt=Warrior_Arms_T14H DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:29.9,24.9,17.7,12.2,8.6,2.5,2.4,1.2,0.1,0.0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=overpower 109.4s|mortal_strike 91.0s|slam 64.9s|colossus_smash 44.7s|execute 31.4s|heroic_throw 9.3s|dragon_roar 8.6s|battle_shout 4.3s|impending_victory 0.3s|waiting 0.0s&chtt=Warrior_Arms_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Arms_T14H 114908
battle_shout 0 0.0% 2.8 93.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 0.00 0.00 1.5436 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 12.1 31.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.06 12.06 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 12.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.enrage.up
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 6459 5.6% 6.6 61.56sec 360044 0 0 0 0 0.0% 0.0% 0.0% 0.0% 102.6 23031 0 23031 0.0% 0.0% 28.0%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.57 101.56 102.65 102.65 0.0000 1.0000 2364096.18 2364096.18 0.00 23031.55 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.99 93.53% 0.00 0 0 0.00 0 0 0 0 0.00
none 6.57 6.47% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.6 100.00% 23031.42 657 87879 23030.60 15714 30584 2364096 2364096 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:40349.08
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
colossus_smash 5482 4.8% 28.9 12.69sec 69442 44887 51925 108413 69442 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.89 28.89 0.00 0.00 1.5470 0.0000 2006276.29 2006276.29 0.00 44887.16 44887.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.87 68.79% 51925.24 44862 85078 51869.32 46607 60335 1031965 1031965 0.00
crit 8.99 31.11% 108413.49 92415 175262 108367.23 93917 151036 974311 974311 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.remains<=1.5
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 6.2 60.40sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.24 6.24 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 5934 5.2% 58.9 6.25sec 36857 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.0 13635 28051 17949 29.9% 0.0% 99.2%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.93 58.93 121.00 121.00 0.0000 3.0000 2171835.83 2171835.83 0.00 5983.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 84.8 70.07% 13635.41 11512 18442 13634.64 13070 14212 1156119 1156119 0.00
crit 36.2 29.93% 28050.88 23024 36885 28058.27 26143 30376 1015716 1015716 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3184 2.8% 5.6 66.31sec 208794 135039 0 209087 208794 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.58 5.58 0.00 0.00 1.5462 0.0000 1165518.31 1165518.31 0.00 135038.62 135038.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 5.57 99.86% 209086.72 169854 273644 209113.06 181947 234125 1165518 1165518 0.00
dodge 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.01 0.11% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 15819 13.8% 20.3 3.32sec 285696 184605 205746 445027 285696 33.5% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.27 20.27 0.00 0.00 1.5476 0.0000 5789781.35 5789781.35 0.00 184605.47 184605.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.45 66.36% 205745.82 137435 320425 205621.86 163295 258548 2766927 2766927 0.00
crit 6.79 33.52% 445027.09 283116 660076 445635.21 0 660076 3022854 3022854 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.09% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2336 2.0% 11.2 33.82sec 76287 0 56389 119903 76287 31.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 0.00 0.00 0.0000 0.0000 855012.91 855012.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.68 68.51% 56388.91 47025 75806 56355.09 49107 65867 433014 433014 0.00
crit 3.52 31.40% 119902.69 96871 156160 118730.05 0 156160 421998 421998 0.00
miss 0.01 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 8139 7.1% 29.5 9.91sec 100808 0 76561 155718 100808 30.7% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.55 29.55 0.00 0.00 0.0000 0.0000 2978783.64 2978783.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.44 69.17% 76560.97 41918 307148 76505.82 48117 112157 1564751 1564751 0.00
crit 9.08 30.73% 155717.88 86350 666372 155311.39 90668 314426 1414032 1414032 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.02 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 313 0.3% 6.0 51.69sec 19046 12313 14320 30115 19048 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.02 6.02 0.00 0.00 1.5469 0.0000 114727.90 114727.90 0.00 12312.50 12312.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.21 69.89% 14320.47 13147 25165 14281.72 0 20063 60288 60288 0.00
crit 1.81 30.01% 30115.44 27084 51839 26606.24 0 51839 54440 54440 0.00
dodge 0.00 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 20 0.0% 0.2 83.51sec 40237 26114 31663 64810 40237 26.1% 0.2% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.18 0.18 0.00 0.00 1.5408 0.0000 7285.80 7285.80 0.00 26114.00 26114.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 0.13 73.70% 31663.08 26344 46842 3967.46 0 46842 4226 4226 0.00
crit 0.05 26.08% 64810.08 54269 96494 2997.99 0 96494 3060 3060 0.00
dodge 0.00 0.06% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.17% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_main_hand 13226 11.5% 112.0 3.26sec 43218 14773 35675 73509 43218 25.7% 0.1% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.01 112.01 0.00 0.00 2.9254 0.0000 4840817.21 4840817.21 0.00 14773.05 14773.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.33 50.29% 35674.92 26295 50329 35674.38 31863 39527 2009452 2009452 0.00
crit 28.75 25.66% 73508.73 54167 103678 73508.58 62526 84969 2113111 2113111 0.00
glance 26.82 23.95% 26776.71 19721 37747 26774.67 21850 31615 718254 718254 0.00
dodge 0.02 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.09 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
mortal_strike 17566 15.3% 59.0 6.24sec 108992 70662 82089 172148 108992 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mortal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.99 58.99 0.00 0.00 1.5424 0.0000 6429223.66 6429223.66 0.00 70661.68 70661.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.25 69.92% 82089.37 61811 116522 82082.76 74555 89694 3385957 3385957 0.00
crit 17.68 29.97% 172148.30 127331 240036 172194.69 140006 213144 3043267 3043267 0.00
dodge 0.01 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.05 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mortal_strike

Static Values
  • id:12294
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12294
  • name:Mortal Strike
  • school:physical
  • tooltip:Healing effects on you are increased by $s5%
  • description:A vicious strike that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. Generates 10 Rage.$?s58368[ When your Mortal Strike is affecting a target, healing effects on you are increased by $s5%. ][] |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1460.66
  • base_dd_max:1460.66
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.85
opportunity_strike 10245 8.9% 148.9 2.45sec 25178 0 19146 39211 25178 30.2% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: opportunity_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 148.92 148.92 0.00 0.00 0.0000 0.0000 3749545.29 3749545.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.86 69.74% 19145.71 13992 26564 19143.97 17321 20886 1988394 1988394 0.00
crit 44.91 30.16% 39210.87 27983 53129 39213.78 34030 44388 1761151 1761151 0.00
dodge 0.03 0.02% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.12 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: opportunity_strike

Static Values
  • id:76858
  • school:physical
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:76858
  • name:Opportunity Strike
  • school:physical
  • tooltip:(null)
  • description:Deals $s2% main hand weapon damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.55
overpower 15566 13.5% 70.7 5.16sec 80574 52078 41085 86281 80574 87.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: overpower

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.71 70.71 0.00 0.00 1.5472 0.0000 5697091.96 5697091.96 0.00 52077.70 52077.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.82 12.47% 41084.96 31554 60395 41078.08 31554 56114 362206 362206 0.00
crit 61.83 87.45% 86280.71 65000 124414 86299.97 79142 93487 5334886 5334886 0.00
miss 0.06 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: overpower

Static Values
  • id:7384
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.overpower.up
Spelldata
  • id:7384
  • name:Overpower
  • school:physical
  • tooltip:(null)
  • description:Instantly overpower the enemy causing $m1% weapon damage. Cannot be blocked, dodged or parried. Overpower has a $s3% increased chance to be a critical strike. Only usable after the target dodges$?s56638[ or when activated by Taste for Blood][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.20
recklessness 0 0.0% 3.0 154.67sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
slam 10618 9.2% 42.0 6.71sec 92627 59907 70818 148009 92627 28.4% 0.1% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.96 41.96 0.00 0.00 1.5462 0.0000 3886239.83 3886239.83 0.00 59907.20 59907.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.01 71.53% 70818.17 56587 106908 70848.44 62664 84471 2125452 2125452 0.00
crit 11.90 28.35% 148009.42 116569 220230 148107.30 119029 193820 1760788 1760788 0.00
dodge 0.01 0.03% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.04 0.08% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: slam

Static Values
  • id:1464
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
Spelldata
  • id:1464
  • name:Slam
  • school:physical
  • tooltip:(null)
  • description:Slams the opponent, causing $1464m2% weapon damage plus $1464m1.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:997.04
  • base_dd_max:997.04
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
berserker_rage 12.1 0.0 31.4sec 31.4sec 19.67% 19.67%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:19.7%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 6.6 0.0 61.2sec 61.5sec 20.20% 22.52%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.2%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 14.57%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
dancing_steel 11.7 19.3 31.4sec 11.5sec 65.00% 63.74%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:65.0%
darkmist_vortex 6.0 0.0 64.7sec 64.7sec 32.70% 32.70%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.7%
deadly_calm 6.2 0.0 60.4sec 60.4sec 10.91% 39.28%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:2.4%
  • deadly_calm_2:2.4%
  • deadly_calm_3:6.1%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 27.4 11.3 13.4sec 9.7sec 52.59% 52.34%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:52.6%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
mogu_power_potion 2.0 0.0 309.8sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
overpower 50.0 30.1 7.3sec 4.6sec 50.46% 50.46%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_overpower
  • max_stacks:1
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • overpower_1:50.5%
recklessness 3.0 0.0 154.5sec 154.6sec 14.75% 15.06%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:14.8%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 8.0 0.0 48.7sec 48.7sec 32.52% 32.52%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.5%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
taste_for_blood 15.2 6.0 22.5sec 16.0sec 26.47% 45.21%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_taste_for_blood
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • taste_for_blood_1:18.6%
  • taste_for_blood_2:5.6%
  • taste_for_blood_3:1.7%
  • taste_for_blood_4:0.4%
  • taste_for_blood_5:0.1%

Spelldata details

  • id:125831
  • name:Taste for Blood
  • tooltip:Your next Heroic Strike or Cleave will hit for $w1% additional damage.
  • description:$@spelldesc56638
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Arms_T14H
execute Rage 20.3 608.0 30.0 30.0 9523.2
heroic_strike Rage 29.5 770.4 26.1 26.1 3866.5
impending_victory Rage 0.2 1.8 10.0 10.0 4023.7
slam Rage 42.0 1258.7 30.0 30.0 3087.6
Resource Gains Type Count Total Average Overflow
battle_shout Rage 2.76 55.18 20.00 0.00 0.00%
enrage Rage 38.78 374.93 9.67 12.91 3.33%
incoming_damage Rage 152.00 275.99 1.82 3.95 1.41%
melee_main_hand Rage 111.92 1380.41 12.33 29.79 2.11%
mortal_strike Rage 58.99 583.37 9.89 6.51 1.10%
Resource RPS-Gain RPS-Loss
Health 0.00 18607.28
Rage 7.29 7.21
Combat End Resource Mean Min Max
Health -6349996.00 -6349996.00 -6349996.00
Rage 31.23 2.07 83.26
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 1.9%

Procs

Count Interval
hat_donor 172.1 2.4sec
strikes_of_opportunity 148.9 2.5sec
sudden_death 22.4 15.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 114907.75
Minimum 101496.40
Maximum 132482.34
Spread ( max - min ) 30985.93
Range [ ( max - min ) / 2 * 100% ] 13.48%
Standard Deviation 3739.1755
5th Percentile 108891.15
95th Percentile 121143.46
( 95th Percentile - 5th Percentile ) 12252.31
Mean Distribution
Standard Deviation 37.3992
95.00% Confidence Intervall ( 114834.45 - 114981.05 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4067
0.1 Scale Factor Error with Delta=300 119353
0.05 Scale Factor Error with Delta=300 477414
0.01 Scale Factor Error with Delta=300 11935355
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 114907.75

Damage

Sample Data
Count 9996
Mean 42056236.17

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 319.97
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 15.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 6.57 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 12.06 berserker_rage,use_off_gcd=1,if=!buff.enrage.up
B 11.21 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 6.24 deadly_calm,use_off_gcd=1,if=rage>=40
D 29.55 heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
E 58.99 mortal_strike
F 28.89 colossus_smash,if=debuff.colossus_smash.remains<=1.5
G 20.27 execute
H 0.00 storm_bolt,if=talent.storm_bolt.enabled
I 70.71 overpower,if=buff.overpower.up
J 0.00 shockwave,if=talent.shockwave.enabled
K 5.58 dragon_roar,if=talent.dragon_roar.enabled
L 39.32 slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
M 6.02 heroic_throw
N 2.76 battle_shout,if=rage<70&!debuff.colossus_smash.up
O 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
P 2.64 slam,if=target.health.pct>=20
Q 0.18 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
R 0.00 battle_shout,if=rage<70

Sample Sequence

579AEFBCDIDKDEFIIDEIIFEDIFDLEIDIIAEFBIDLEIFLEID5LMEILNEI5LL9AECFBDIDKDEIPPEIPMEFIIEFI5ADIEBILLEILPEIFLEI5LMEI9ALCNEIKFBDEDIDLP5EIPQEIPME7FILEILPAEILPEIP5FBEILME59ICPNEIIFDAEDIFKEDILLEIILEFBIIDEILLAEI5IL5EIFDLEIDIM9ECIILEILLAEFBDIKEDILLEFI5LEIFLEIDLAME5ILNEIGGEFBGGCEGGGEGGAI7956EFGGEGGIEGGIEGIFBE5GAGIEGFGEGGIE5FGI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20442 18104 17034
Agility 226 215 80
Stamina 22419 20381 20193
Intellect 121 115 80
Spirit 146 146 80
Health 460269 431737 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 14.89% 14.89% 2522
Spell Crit 23.65% 18.65% 10584
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 45214 36428 0
Melee Hit 7.42% 7.42% 2522
Melee Crit 28.66% 23.66% 10584
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.48% 7.48% 2542
Armor 34135 34135 34135
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.88% 10.25% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 44.51% 33.51% 4338

Gear

Average Item Level: 506.33
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck shackle_of_eversparks,id=90508,reforge=hit_crit
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=80str_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=80str_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
Wrists bracers_of_defiled_earth,id=87145,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_mastery
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Arms_T14H"
origin="http://mop.chardev.org/profile/470-Warrior_Arms_T14H.html"
level=90
race=worgen
spec=arms
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#Za!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!buff.enrage.up
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=((buff.taste_for_blood.up&buff.taste_for_blood.remains<=2)|(buff.taste_for_blood.stack=5&buff.overpower.up)|(buff.taste_for_blood.up&debuff.colossus_smash.remains<=2&!cooldown.colossus_smash.remains=0)|buff.deadly_calm.up|rage>110)&target.health.pct>=20&debuff.colossus_smash.up
actions+=/mortal_strike
actions+=/colossus_smash,if=debuff.colossus_smash.remains<=1.5
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/overpower,if=buff.overpower.up
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/slam,if=(rage>=70|debuff.colossus_smash.up)&target.health.pct>=20
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/slam,if=target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=shackle_of_eversparks,id=90508,reforge=hit_crit
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=80str_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_mastery
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=87145,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=80str_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery,reforge=mastery_hit
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel

# Gear Summary
# gear_strength=17034
# gear_agility=80
# gear_stamina=20193
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2542
# gear_hit_rating=2522
# gear_crit_rating=10584
# gear_haste_rating=784
# gear_mastery_rating=4338
# gear_armor=34135
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Warrior_Fury_1h_T14H : 125131 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
125131.0 125131.0 89.32 / 0.07% 7424 / 5.9% 12701.3 312.1 312.1 0.25 / 0.08% 20 / 6.5% 31.7 9.9 9.9 Rage 4.72% 60.7 100.0%
Origin http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://7.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:235371|172440|98011|50235|34939|34418|19866|15727|13272|10641&chds=0,470742&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++235371++execute,C79C6E,0,0,15|t++172440++dragon_roar,C79C6E,1,0,15|t++98011++raging_blow,C79C6E,2,0,15|t++50235++wild_strike,C79C6E,3,0,15|t++34939++bloodthirst,C79C6E,4,0,15|t++34418++colossus_smash,C79C6E,5,0,15|t++19866++impending_victory,C79C6E,6,0,15|t++15727++melee_main_hand,C79C6E,7,0,15|t++13272++melee_off_hand,C79C6E,8,0,15|t++10641++heroic_throw,C79C6E,9,0,15&chtt=Warrior_Fury_1h_T14H Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,12,10,9,8,8,8,7,6,5,3,2,2,0,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|melee_main_hand|melee_off_hand|bloodthirst|heroic_strike|raging_blow_mh|deep_wounds|raging_blow_oh|wild_strike|bloodbath|dragon_roar|heroic_leap|colossus_smash|impending_victory|heroic_throw&chtt=Warrior_Fury_1h_T14H Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:3110y0yxxwuvstqppmiihgfeddaaZYYYXYYXXWXXXXXWWWVVVUUUVVVVWWXXXYYZZZaabbbcbbbaaaaZYYYXXXWWWVWWVVVWVVVVVWWVVVUVUUUUUVVVVVWWWWXXYYYZZaaaaaaaaaZZZYYZZZaaababbbbbcccccbbbbbbaaaZZZZZZYZYYYYZYYYYYYYYZZZZZZZZZZZZZZZZZZYYZYYYXXXWVVVVVUUUTTTTTTTUUVVWXXXYYYZZZaaaaaaaaaaaaZZZYYYYYXXXWWWWVVVUUUVVVVVWWXYZacefhlnprtvyz1135578777666433110zyxyxvwutrqpppoooonnnmmnllmkkkllkljiihggfef&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=125131|max=254248&chxp=1,1,49,100&chtt=Warrior_Fury_1h_T14H DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,3,8,11,18,14,23,39,50,77,92,107,173,224,255,302,376,402,462,470,520,553,610,572,618,567,518,509,403,377,343,265,237,186,152,104,103,64,69,31,19,33,17,6,7,3,1,0,0,2&chds=0,618&chbh=5&chxt=x&chxl=0:|min=109534|avg=125131|max=142903&chxp=0,1,47,100&chtt=Warrior_Fury_1h_T14H DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.2,19.1,15.1,10.0,7.3,3.5,2.9,2.3,1.7,4.7&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 117.9s|raging_blow 70.1s|wild_strike 55.4s|execute 36.4s|colossus_smash 26.7s|heroic_throw 13.0s|impending_victory 10.7s|dragon_roar 8.5s|battle_shout 6.4s|waiting 17.3s&chtt=Warrior_Fury_1h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_1h_T14H 125131
battle_shout 0 0.0% 4.1 71.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.12 4.12 0.00 0.00 1.5449 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 10.9 35.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.89 10.89 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 6227 5.0% 6.9 60.56sec 330276 0 0 0 0 0.0% 0.0% 0.0% 0.0% 104.5 21812 0 21812 0.0% 0.0% 28.5%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 96.57 104.49 104.49 0.0000 1.0000 2279187.09 2279187.09 0.00 21812.07 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.67 92.85% 0.00 0 0 0.00 0 0 0 0 0.00
none 6.90 7.15% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.5 100.00% 21812.03 428 117460 21813.53 13502 30248 2279187 2279187 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:6256.47
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 11256 9.0% 76.3 4.83sec 53970 34939 32663 69657 53970 57.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 0.00 0.00 1.5447 0.0000 4119721.26 4119721.26 0.00 34938.95 34938.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.37 42.41% 32663.12 22138 55094 32728.05 29194 38469 1057316 1057316 0.00
crit 43.96 57.59% 69657.44 45605 117006 69602.22 62493 75637 3062405 3062405 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 312 100.0% 76.3 4.83sec 1496 0 1214 2425 1496 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 76.33 76.33 0.00 0.00 0.0000 0.0000 114211.43 117296.02 2.63 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.53 76.68% 1213.55 0 1246 1213.55 1191 1246 71029 72929 2.60
crit 17.80 23.32% 2425.43 0 2492 2425.41 1869 2492 43182 44367 2.67
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 2508 2.0% 17.3 21.53sec 53143 34418 39684 84152 53143 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 17.27 0.00 0.00 1.5441 0.0000 917922.58 917922.58 0.00 34417.79 34417.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.04 69.73% 39683.89 29285 51586 39671.91 32094 45000 477977 477977 0.00
crit 5.23 30.27% 84151.88 60327 106267 84192.51 0 102928 439945 439945 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 6.3 60.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.30 6.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 9777 7.8% 76.3 4.83sec 46879 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.0 22412 46553 29574 29.7% 0.0% 99.2%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 121.00 121.00 0.0000 3.0000 3578495.25 3578495.25 0.00 9858.11 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.1 70.33% 22412.14 15251 33529 22410.74 20443 24357 1907304 1907304 0.00
crit 35.9 29.67% 46553.04 30502 67058 46566.84 40126 52085 1671192 1671192 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 4000 3.2% 5.5 67.38sec 266132 172440 0 266132 266132 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.50 5.50 0.00 0.00 1.5433 0.0000 1464018.75 1464018.75 0.00 172440.37 172440.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 5.50 100.00% 266131.98 179952 398219 266545.32 189138 327731 1464019 1464019 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 23433 18.7% 23.6 2.85sec 363949 235371 259238 569197 363949 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.56 23.56 0.00 0.00 1.5463 0.0000 8576441.68 8576441.68 0.00 235370.81 235370.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.60 66.22% 259238.15 145759 465505 259034.82 192098 325805 4045189 4045189 0.00
crit 7.96 33.78% 569196.78 300263 958941 570833.58 388059 830101 4531253 4531253 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 3098 2.5% 9.0 43.05sec 125975 0 92300 200393 125975 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 1133885.81 1133885.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 6.20 68.85% 92299.51 62273 137904 92191.76 67660 113016 571960 571960 0.00
crit 2.80 31.15% 200392.92 128282 284082 195557.53 0 284082 561926 561926 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 10545 8.4% 59.4 4.96sec 64949 0 49039 103825 64949 29.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.42 59.42 0.00 0.00 0.0000 0.0000 3859487.32 3859487.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.17 70.96% 49038.74 26177 67691 49025.58 42596 54207 2067771 2067771 0.00
crit 17.26 29.04% 103825.47 53926 139443 103891.95 83884 122413 1791716 1791716 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 378 0.3% 8.4 37.65sec 16446 10641 12423 26330 16446 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.40 8.40 0.00 0.00 1.5456 0.0000 138171.42 138171.42 0.00 10640.85 10640.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.97 71.07% 12423.13 8563 20677 12423.75 8563 19487 74180 74180 0.00
crit 2.43 28.93% 26330.04 17640 42594 24795.54 0 42594 63992 63992 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 580 0.5% 6.9 41.57sec 30653 19866 23274 49247 30653 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.5430 0.0000 212226.82 212226.82 0.00 19865.85 19865.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.96 71.59% 23273.69 17180 41465 23254.00 0 39987 115358 115358 0.00
crit 1.97 28.41% 49247.34 35391 85417 44062.61 0 85417 96869 96869 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 6.9 41.57sec 0 0 0 0 0 23.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 6.92 6.92 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.30 76.52% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.63 23.48% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_1h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 14623 11.7% 173.3 2.11sec 30879 15727 30261 62342 30879 25.3% 18.8% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.32 173.32 0.00 0.00 1.9634 0.0000 5351925.75 5351925.75 0.00 15727.27 15727.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.54 32.04% 30260.70 18839 49427 30260.36 26687 34990 1680577 1680577 0.00
crit 43.78 25.26% 62342.08 38809 101819 62334.88 53713 70691 2729561 2729561 0.00
glance 41.49 23.94% 22699.80 14130 37070 22699.53 19547 26500 941788 941788 0.00
miss 32.51 18.76% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 12340 9.9% 173.3 2.11sec 26058 13272 25538 52624 26058 25.3% 18.7% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 173.32 173.32 0.00 0.00 1.9634 0.0000 4516312.37 4516312.37 0.00 13272.11 13272.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.50 32.02% 25537.71 15896 41704 25538.34 22354 28241 1417310 1417310 0.00
crit 43.76 25.25% 52623.58 32745 85910 52627.73 45632 59732 2302966 2302966 0.00
glance 41.58 23.99% 19144.55 11922 31278 19143.74 16079 22167 796037 796037 0.00
miss 32.48 18.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (18767) 0.0% (15.0%) 45.4 7.95sec 151309 98011 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.40 45.40 0.00 0.00 1.5438 0.0000 0.00 0.00 0.00 98010.65 98010.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 10176 8.1% 45.4 7.95sec 82044 0 61210 129352 82044 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.40 45.40 0.00 0.00 0.0000 0.0000 3724454.91 3724454.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.52 69.42% 61209.91 35523 92372 61209.99 54298 67903 1929086 1929086 0.00
crit 13.88 30.58% 129351.68 73178 190286 129441.70 98308 155969 1795369 1795369 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 8591 6.9% 45.4 7.95sec 69265 0 51616 109279 69265 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.40 45.40 0.00 0.00 0.0000 0.0000 3144327.71 3144327.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.50 69.39% 51615.66 29973 77939 51615.17 45847 57570 1625950 1625950 0.00
crit 13.89 30.61% 109278.58 61744 160553 109383.89 90431 139288 1518378 1518378 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.0 151.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 7599 6.1% 46.6 6.08sec 59659 50235 45665 95758 59659 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.62 46.62 0.00 0.00 1.1876 0.0000 2781362.48 2781362.48 0.00 50235.02 50235.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.60 72.06% 45665.01 31455 81386 45691.90 37798 55216 1534186 1534186 0.00
crit 13.02 27.94% 95758.31 64796 167655 95765.29 66047 127115 1247176 1247176 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
berserker_rage 10.9 0.0 35.3sec 35.3sec 17.72% 17.72%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.7%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 6.9 0.0 60.5sec 60.6sec 20.69% 23.06%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.7%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 14.26%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 12.3 2.9 28.4sec 22.8sec 29.65% 70.34%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:8.2%
  • bloodsurge_2:4.9%
  • bloodsurge_3:16.5%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 10.5 8.2 34.5sec 18.7sec 46.10% 44.94%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:46.1%
dancing_steel_oh 7.5 3.0 44.4sec 30.7sec 28.97% 29.00%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:29.0%
darkmist_vortex 6.0 0.0 63.8sec 63.8sec 32.77% 32.77%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.8%
deadly_calm 6.3 0.0 60.8sec 60.8sec 8.19% 25.21%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:2.8%
  • deadly_calm_2:2.8%
  • deadly_calm_3:2.6%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 23.7 36.4 15.8sec 6.3sec 76.46% 76.68%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:76.5%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 40.0 20.3 9.0sec 6.0sec 36.86% 42.93%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:16.9%
  • flurry_2:5.3%
  • flurry_3:14.7%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 306.3sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
raging_blow 46.4 13.7 7.8sec 6.3sec 38.10% 38.10%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:25.0%
  • raging_blow_2:13.1%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
recklessness 3.0 0.0 152.8sec 152.2sec 14.75% 15.23%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:14.8%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 8.0 0.0 48.0sec 48.0sec 32.71% 32.71%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.7%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_1h_T14H
execute Rage 23.6 706.9 30.0 30.0 12131.6
heroic_strike Rage 59.4 1632.9 27.5 27.5 2363.6
impending_victory Rage 6.9 69.2 10.0 10.0 3065.3
raging_blow Rage 45.4 454.0 10.0 10.0 15130.9
wild_strike Rage 46.6 742.7 15.9 15.9 3744.8
Resource Gains Type Count Total Average Overflow
battle_shout Rage 4.12 82.39 20.00 0.00 0.00%
bloodthirst Rage 76.33 763.34 10.00 0.00 0.00%
enrage Rage 60.08 597.91 9.95 2.86 0.48%
incoming_damage Rage 152.00 282.74 1.86 0.02 0.01%
melee_main_hand Rage 140.81 1281.34 9.10 0.02 0.00%
melee_off_hand Rage 140.84 632.61 4.49 1.18 0.19%
Resource RPS-Gain RPS-Loss
Health 312.05 18607.28
Rage 9.95 9.85
Combat End Resource Mean Min Max
Health -6240401.83 -6254894.00 -6223744.00
Rage 33.96 0.36 99.66
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 127.9 3.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 125130.99
Minimum 109534.33
Maximum 142902.77
Spread ( max - min ) 33368.44
Range [ ( max - min ) / 2 * 100% ] 13.33%
Standard Deviation 4556.1504
5th Percentile 117821.73
95th Percentile 132668.79
( 95th Percentile - 5th Percentile ) 14847.06
Mean Distribution
Standard Deviation 45.5706
95.00% Confidence Intervall ( 125041.67 - 125220.30 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5092
0.1 Scale Factor Error with Delta=300 177206
0.05 Scale Factor Error with Delta=300 708826
0.01 Scale Factor Error with Delta=300 17720655
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 125130.99

Damage

Sample Data
Count 9996
Mean 45797941.21

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 312.05
Minimum 272.35
Maximum 357.46
Spread ( max - min ) 85.11
Range [ ( max - min ) / 2 * 100% ] 13.64%
Standard Deviation 12.7314
5th Percentile 292.78
95th Percentile 333.63
( 95th Percentile - 5th Percentile ) 40.85
Mean Distribution
Standard Deviation 0.1273
95.00% Confidence Intervall ( 311.80 - 312.30 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6394
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 138
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 312.05

Heal

Sample Data
Count 9996
Mean 114211.43

HTPS

Sample Data
Count 9996
Mean 312.05

#Executed Foreground Actions

Sample Data
Count 9996
Mean 370.57
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 15.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 6.90 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 10.89 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 9.00 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 6.30 deadly_calm,use_off_gcd=1,if=rage>=40
D 59.42 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 76.33 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 11.60 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 24.93 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 17.27 colossus_smash
I 23.56 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 45.40 raging_blow,if=buff.raging_blow.react
L 21.09 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 5.50 dragon_roar,if=talent.dragon_roar.enabled
O 8.40 heroic_throw
P 3.77 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 3.69 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 6.92 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 10.23 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.35 battle_shout,if=rage<70

Sample Sequence

579AEHBKECDKDNDGEKOEDSKEDKDHDERDREKPEDKTEATKEHBDKD5EDOSEKGE5TG9EKHDCEDKDLDFEKLFEAKLGENODEHBDKDED5DKPEKLFELLFEKHDGEDKDSAE5KOEK9TETCDLFDEDHBDKE5GEKTEKNEDKHD7EDODKEKPEDKSEDTKEAHBD5RDEDKGE59KGEKCDODEDKHDEDKRESAGEKNGEDKLFEHBDKDFDEDOPGETT5EL5LFAEKHDEDKDSE9GECDKDDGEKOEHBDKDEDKDLFEANKE5SGEDTHDEDKRGELL5FEKOEIIAEHBIIIECIKEIIGE796I5KEHIIIAEIIEIIGEIIEHB5IEIKEIIEIKEI5HEI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 20050 17730 16678
Agility 226 215 80
Stamina 22092 20084 19896
Intellect 121 115 80
Spirit 146 146 80
Health 455691 427579 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.25% 15.25% 2633
Spell Crit 23.26% 18.25% 10346
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 44352 35680 0
Melee Hit 7.74% 7.74% 2633
Melee Crit 28.27% 23.26% 10346
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 10.77% 10.15% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 28.66% 21.66% 4484

Gear

Average Item Level: 506.50
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
Main Hand kilrak_jaws_of_terror,id=87173,gems=500str,enchant=dancing_steel,reforge=hit_crit
Off Hand kilrak_jaws_of_terror,id=87173,enchant=dancing_steel,reforge=hit_crit
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_1h_T14H"
origin="http://mop.chardev.org/profile/474-Warrior_Fury_1h_T14H.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_mastery
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_mastery
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=kilrak_jaws_of_terror,id=87173,gems=500str,enchant=dancing_steel,reforge=hit_crit
off_hand=kilrak_jaws_of_terror,id=87173,enchant=dancing_steel,reforge=hit_crit

# Gear Summary
# gear_strength=16678
# gear_agility=80
# gear_stamina=19896
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2633
# gear_crit_rating=10346
# gear_haste_rating=784
# gear_mastery_rating=4484
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel
# off_hand=kilrak_jaws_of_terror,heroic=1,weapon=sword_2.60speed_6807min_12643max,enchant=dancing_steel

Warrior_Fury_2h_T14H : 120156 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR HPS HPS(e) HPS Error HPS Range HPR RPS Out RPS In Primary Resource Waiting APM Active
120156.1 120156.1 87.31 / 0.07% 7337 / 6.1% 12166.7 318.3 318.3 0.26 / 0.08% 22 / 7.0% 32.2 9.9 10.0 Rage 4.42% 60.9 100.0%
Origin http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html
Talents http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
Glyphs
  • unending_rage
  • recklessness
  • death_from_above

Charts

http://6.chart.apis.google.com/chart?chs=550x330&cht=bhg&chf=bg,s,333333&chd=t:195022|141823|111299|48680|44740|44648|25890|15047|13949|9392&chds=0,390044&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chm=t++195022++execute,C79C6E,0,0,15|t++141823++dragon_roar,C79C6E,1,0,15|t++111299++raging_blow,C79C6E,2,0,15|t++48680++wild_strike,C79C6E,3,0,15|t++44740++bloodthirst,C79C6E,4,0,15|t++44648++colossus_smash,C79C6E,5,0,15|t++25890++impending_victory,C79C6E,6,0,15|t++15047++melee_main_hand,C79C6E,7,0,15|t++13949++heroic_throw,C79C6E,8,0,15|t++9392++melee_off_hand,C79C6E,9,0,15&chtt=Warrior_Fury_2h_T14H Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,12,12,11,8,7,7,7,6,5,3,3,2,1,0&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C55D54,C79C6E,C55D54,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E&chl=execute|bloodthirst|raging_blow_mh|melee_main_hand|heroic_strike|raging_blow_oh|melee_off_hand|deep_wounds|wild_strike|bloodbath|dragon_roar|colossus_smash|heroic_leap|impending_victory|heroic_throw&chtt=Warrior_Fury_2h_T14H Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:855423211zyywxuttpmmkjihggdccbbbabbZZZZaZZaZZZYXXXXXXYYXZZaaabbcccdeffffffeeeeddbbbaaZZZZYYYYYYYYYYYXZYYXXXXXXXXXXYYYYZZZaaabbccdddddddddccccbbbbcdddeeeeeffffgggfffefeeeeccccccccbbbbccbcbbbbbdcddccccccccccccccbbbbbbaaaYYYYYXXXXWWWWWWWWWYYYaaabbbcccdddedeeeedddccbbbbaaaZZZZZZXXXXXXYYYYYYZaabcdfgilnprsuwy0z13355555343111zzyxwuwvttsrpoonnnnnmmmlllmlkmjjjklkkiiigggfee&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=120156|max=227394&chxp=1,1,53,100&chtt=Warrior_Fury_2h_T14H DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:1,0,0,2,0,4,2,8,9,16,27,34,56,88,104,170,201,248,315,347,435,485,552,580,629,610,606,659,624,566,490,448,387,305,271,193,163,98,93,52,44,26,18,11,7,7,2,2,0,1&chds=0,659&chbh=5&chxt=x&chxl=0:|min=101312|avg=120156|max=137450&chxp=0,1,52,100&chtt=Warrior_Fury_2h_T14H DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:32.2,20.2,14.5,9.9,7.3,3.5,2.9,2.3,1.7,4.4&chds=0,100&chdls=ffffff&chco=C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,C79C6E,ffffff&chl=bloodthirst 117.9s|raging_blow 74.0s|wild_strike 53.2s|execute 36.1s|colossus_smash 26.7s|heroic_throw 12.9s|impending_victory 10.5s|dragon_roar 8.5s|battle_shout 6.3s|waiting 16.2s&chtt=Warrior_Fury_2h_T14H Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Warrior_Fury_2h_T14H 120156
battle_shout 0 0.0% 4.1 72.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: battle_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.08 4.08 0.00 0.00 1.5445 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: battle_shout

Static Values
  • id:6673
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage<70&!debuff.colossus_smash.up
Spelldata
  • id:6673
  • name:Battle Shout
  • school:physical
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1%. Lasts $d. Generates ${$92049m1/10} Rage.
berserker_rage 0 0.0% 10.6 36.37sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: berserker_rage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.60 10.60 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 10.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: berserker_rage

Static Values
  • id:18499
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
Spelldata
  • id:18499
  • name:Berserker Rage
  • school:physical
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
bloodbath 6173 5.1% 6.9 60.56sec 327245 0 0 0 0 0.0% 0.0% 0.0% 0.0% 104.5 21617 0 21617 0.0% 0.0% 28.6%

Stats details: bloodbath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 97.63 104.52 104.52 0.0000 1.0000 2259448.50 2259448.50 0.00 21616.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.72 92.93% 0.00 0 0 0.00 0 0 0 0 0.00
none 6.90 7.07% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.5 100.00% 21616.63 539 95551 21617.78 13533 28909 2259448 2259448 0.00
DPS Timeline Chart

Action details: bloodbath

Static Values
  • id:113344
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:113344
  • name:Bloodbath
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec. Movement slowed by $s2%.
  • description:Your target bleeds for an additional $12292s1% damage of the triggering attack over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:16987.49
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
bloodthirst 14411 12.0% 76.3 4.83sec 69098 44740 40791 86449 69098 62.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 0.00 0.00 1.5445 0.0000 5274379.63 5274379.63 0.00 44739.84 44739.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.00 37.99% 40790.85 27156 66524 40879.33 35544 47157 1182996 1182996 0.00
crit 47.33 62.00% 86448.83 55941 140661 86375.90 77826 93659 4091384 4091384 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: bloodthirst

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
bloodthirst_heal 318 100.0% 76.3 4.83sec 1526 0 1213 2427 1526 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: bloodthirst_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 76.33 76.33 0.00 0.00 0.0000 0.0000 116496.14 119631.96 2.62 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.64 74.21% 1213.37 0 1246 1213.37 1188 1246 68731 70579 2.62
crit 19.68 25.79% 2426.59 0 2492 2426.68 2077 2492 47765 49053 2.62
HPS Timeline Chart

Action details: bloodthirst_heal

Static Values
  • id:23881
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:4.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:23881
  • name:Bloodthirst
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target, dealing $s2% weapon damage plus $s1 with your main hand weapon and restoring $117313s1% of your health. Bloodthirst has double the normal chance to be a critical strike. Generates ${$m3/10} Rage.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:1246.30
  • base_dd_max:1246.30
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
colossus_smash 3251 2.7% 17.3 21.54sec 68923 44648 50579 106661 68923 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: colossus_smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.27 17.27 0.00 0.00 1.5437 0.0000 1189965.59 1189965.59 0.00 44648.27 44648.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.62 67.28% 50578.92 36752 63109 50563.31 40495 56571 587537 587537 0.00
crit 5.65 32.71% 106661.14 75710 130004 106752.60 0 130004 602428 602428 0.00
miss 0.00 0.01% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: colossus_smash

Static Values
  • id:86346
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:20.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86346
  • name:Colossus Smash
  • school:physical
  • tooltip:Defenses weakened, allowing the Warrior's attacks to bypass $w2% of armor.
  • description:Smashes a target for $s3% weapon damage plus $s1 and weakens their defenses, allowing your attacks to entirely bypass $s2% of their armor for $s4 sec, and causes the Physical Vulnerability effect on the target. Bypasses less armor on players.$?s89003[ Your Colossus Smash also causes Weakened Armor on your target. |Tinterface\icons\ability_warrior_sunder.blp:24|t |cFFFFFFFFWeakened Armor|r Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.][] |Tinterface\icons\ability_deathknight_brittlebones.blp:24|t |cFFFFFFFFPhysical Vulnerability|r Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:221.84
  • base_dd_max:221.84
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.75
deadly_calm 0 0.0% 6.2 60.75sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: deadly_calm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.25 6.25 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: deadly_calm

Static Values
  • id:85730
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:rage>=40
Spelldata
  • id:85730
  • name:Deadly Calm
  • school:physical
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
deep_wounds 8161 6.8% 76.3 4.83sec 39134 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.0 18371 37969 24687 32.2% 0.0% 99.2%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.33 121.00 121.00 0.0000 3.0000 2987083.72 2987083.72 0.00 8228.88 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 82.0 67.78% 18371.16 12251 26509 18370.08 16904 19837 1506579 1506579 0.00
crit 39.0 32.22% 37969.27 24503 53018 37980.47 33491 42630 1480505 1480505 0.00
DPS Timeline Chart

Action details: deep_wounds

Static Values
  • id:115767
  • school:bleed
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $s1 every $t1 sec.
  • description:Your Mortal Strike, Bloodthirst, and Devastate cause the target to bleed for $115767o1 Physical damage over $115767d.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.240000
  • base_td:218.10
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
dragon_roar 3294 2.7% 5.5 67.66sec 218902 141823 0 218910 218902 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: dragon_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.51 5.51 0.00 0.00 1.5435 0.0000 1205492.27 1205492.27 0.00 141822.62 141822.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
crit 5.51 100.00% 218909.65 144767 315036 219243.84 153768 268122 1205492 1205492 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dragon_roar

Static Values
  • id:118000
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dragon_roar.enabled
Spelldata
  • id:118000
  • name:Dragon Roar
  • school:physical
  • tooltip:(null)
  • description:Roar ferociously, causing $?s12712[${$m1*1.2}][$m1] damage to all enemies within $A1 yards, knocking them back and knocking them down for $118895d. Dragon Roar is always a critical strike and ignores all armor on the target.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.400000
  • base_dd_min:126.00
  • base_dd_max:126.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
execute 19258 16.0% 23.4 2.87sec 301527 195022 210600 461105 301527 36.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: execute

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.5461 0.0000 7048290.39 7048290.39 0.00 195022.01 195022.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.89 63.70% 210600.24 116747 367576 210440.90 160579 259074 3135681 3135681 0.00
crit 8.49 36.30% 461104.76 240500 757206 461883.52 0 624413 3912610 3912610 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: execute

Static Values
  • id:5308
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:5308
  • name:Execute
  • school:physical
  • tooltip:(null)
  • description:Attempt to finish off a wounded foe, causing $?s12712[${$m1*1.2}][$m1] physical damage. Only usable on enemies that have less than 20% health.
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:8721.60
  • base_dd_max:8721.60
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
heroic_leap 2595 2.2% 9.0 43.08sec 105530 0 75941 163544 105530 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_leap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.00 9.00 0.00 0.00 0.0000 0.0000 949744.98 949744.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.96 66.22% 75941.31 50105 109105 75836.34 0 92686 452586 452586 0.00
crit 3.04 33.78% 163543.59 103217 224756 160983.09 0 224756 497159 497159 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_leap

Static Values
  • id:6544
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.colossus_smash.up
Spelldata
  • id:6544
  • name:Heroic Leap
  • school:physical
  • tooltip:(null)
  • description:Leap through the air towards a targeted location, slamming down with destructive force to deal $?s12712[${1.2*$52174m1}][$52174m1] Physical damage to all enemies within $52174a1 yards.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
heroic_strike 9821 8.2% 60.3 4.89sec 59592 0 44237 93079 59592 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.32 60.32 0.00 0.00 0.0000 0.0000 3594393.60 3594393.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.35 68.56% 44236.65 23317 58864 44224.06 39050 49554 1829209 1829209 0.00
crit 18.96 31.44% 93079.40 48032 121260 93116.79 75506 108762 1765184 1765184 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_strike

Static Values
  • id:78
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:1.50
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
Spelldata
  • id:78
  • name:Heroic Strike
  • school:physical
  • tooltip:(null)
  • description:An attack that instantly deals $m2% weapon damage plus $m1 (${$m2*1.40}% plus ${$m1*1.40} if a one-handed weapon is equipped)$?s58366[, reducing the target's movement speed by $129923s1% for $129923d][]. Use when you have more Rage than you can spend.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:498.52
  • base_dd_max:498.52
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.10
heroic_throw 493 0.4% 8.4 38.25sec 21559 13949 15896 33486 21559 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: heroic_throw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.37 8.37 0.00 0.00 1.5456 0.0000 180518.15 180518.15 0.00 13949.32 13949.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.68 67.80% 15895.94 10787 25695 15901.92 10969 24928 90234 90234 0.00
crit 2.70 32.20% 33485.82 22221 52932 32290.76 0 52932 90284 90284 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: heroic_throw

Static Values
  • id:57755
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57755
  • name:Heroic Throw
  • school:physical
  • tooltip:(null)
  • description:Throw your weapon at the enemy, causing $m1% weapon damage$?s58357[ and silencing the target for $18498d][].
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.50
impending_victory 741 0.6% 6.8 42.72sec 39951 25890 29737 62643 39951 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.79 6.79 0.00 0.00 1.5431 0.0000 271169.97 271169.97 0.00 25889.82 25889.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 4.68 68.95% 29736.76 21613 51473 29696.75 0 47126 139173 139173 0.00
crit 2.11 31.04% 62642.55 44523 106035 57475.26 0 106035 131997 131997 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: impending_victory

Static Values
  • id:103840
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.impending_victory.enabled&target.health.pct>=20
Spelldata
  • id:103840
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:Instantly attack the target causing ${$AP*$m1/100} damage and healing you for $<impending>% of your maximum health. Killing an enemy that yields experience or honor resets the cooldown of Impending Victory and causes your next Impending Victory to heal for $<rush>% of your maximum health. Replaces Victory Rush.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:56.00
  • base_dd_max:56.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
impending_victory__heal 0 0.0% 6.8 42.72sec 0 0 0 0 0 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: impending_victory__heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 6.79 6.79 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 5.04 74.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.75 25.79% 0.00 0 0 0.00 0 0 0 0 0.00
HPS Timeline Chart

Action details: impending_victory__heal

Static Values
  • id:118340
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:30.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warrior_Fury_2h_T14H
  • harmful:true
  • if_expr:
Spelldata
  • id:118340
  • name:Impending Victory
  • school:physical
  • tooltip:(null)
  • description:$@spelldesc103840
melee_main_hand 13777 11.5% 124.8 2.92sec 40411 15047 38620 79596 40411 27.8% 18.9% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.78 124.78 0.00 0.00 2.6857 0.0000 5042482.60 5042482.60 0.00 15046.53 15046.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.41 29.18% 38619.69 23731 60618 38617.13 32708 44807 1406006 1406006 0.00
crit 34.75 27.85% 79595.99 48886 124872 79597.86 68760 94119 2765746 2765746 0.00
glance 30.06 24.09% 28964.56 17798 45463 28968.77 24256 34695 870730 870730 0.00
miss 23.56 18.88% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
melee_off_hand 8601 7.2% 124.8 2.92sec 25228 9392 24134 49748 25228 27.8% 18.9% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_off_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.78 124.78 0.00 0.00 2.6861 0.0000 3147921.90 3147921.90 0.00 9392.04 9392.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.59 29.32% 24134.49 14832 37886 24131.36 20958 27760 883070 883070 0.00
crit 34.65 27.77% 49748.02 30554 78045 49746.05 42486 56683 1723767 1723767 0.00
glance 29.89 23.96% 18099.86 11124 28415 18101.97 14930 21436 541085 541085 0.00
miss 23.65 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: melee_off_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raging_blow 0 (22504) 0.0% (18.7%) 47.9 7.49sec 171842 111299 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.93 47.93 0.00 0.00 1.5440 0.0000 0.00 0.00 0.00 111298.91 111298.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: raging_blow

Static Values
  • id:85288
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:10.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.raging_blow.react
Spelldata
  • id:85288
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $96103m2% weapon damage from both melee weapons. Becoming Enraged enables one use of Raging Blow. Limit $131116s1 charges.
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
raging_blow_mh 13861 11.5% 47.9 7.49sec 105848 0 77552 163123 105848 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.93 47.93 0.00 0.00 0.0000 0.0000 5073118.30 5073118.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.08 66.93% 77552.13 44816 113454 77553.69 68432 85276 2487851 2487851 0.00
crit 15.85 33.07% 163123.35 92321 233714 163224.47 134226 195555 2585267 2585267 0.00
DPS Timeline Chart

Action details: raging_blow_mh

Static Values
  • id:96103
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96103
  • name:Raging Blow
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
raging_blow_oh 8643 7.2% 47.9 7.49sec 66001 0 48460 102014 66001 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raging_blow_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.93 47.93 0.00 0.00 0.0000 0.0000 3163334.68 3163334.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.23 67.25% 48460.11 28010 70908 48460.11 43128 53348 1561855 1561855 0.00
crit 15.70 32.75% 102014.33 57700 146071 102072.57 84661 121842 1601480 1601480 0.00
DPS Timeline Chart

Action details: raging_blow_oh

Static Values
  • id:85384
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:85384
  • name:Raging Blow Off-Hand
  • school:physical
  • tooltip:(null)
  • description:A mighty blow that deals $m2% weapon damage from both melee weapons. Can only be used while Enraged.
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.15
recklessness 0 0.0% 3.0 151.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: recklessness

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 3.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 3.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: recklessness

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:150.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
Spelldata
  • id:1719
  • name:Recklessness
  • school:physical
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
wild_strike 7076 5.9% 45.0 6.24sec 57513 48680 43075 90262 57513 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: wild_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.03 45.03 0.00 0.00 1.1814 0.0000 2589789.83 2589789.83 0.00 48680.26 48680.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.25 69.40% 43075.37 29242 73783 43099.37 35534 51207 1346118 1346118 0.00
crit 13.78 30.60% 90261.68 60239 151994 90270.39 64220 115972 1243672 1243672 0.00
miss 0.00 0.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: wild_strike

Static Values
  • id:100130
  • school:physical
  • resource:rage
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
Spelldata
  • id:100130
  • name:Wild Strike
  • school:physical
  • tooltip:Healing effects received reduced by $w1%.
  • description:A quick strike with your off-hand weapon that deals $m3% weapon damage plus $s2 and causes Mortal Wounds on the target. |Tinterface\icons\ability_criticalstrike.blp:24|t |cFFFFFFFFMortal Wounds|r Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:373.89
  • base_dd_max:373.89
Weapon
  • normalized:true
  • weapon_power_mod:0.071429
  • weapon_multiplier:2.20

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
battle_stance 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_battle_stance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • battle_stance_1:100.0%

Spelldata details

  • id:21156
  • name:Battle Stance Passive
  • tooltip:(null)
  • description:An aggressive combat stance. Generates high Rage from normal melee attacks.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
berserker_rage 10.6 0.0 36.2sec 36.3sec 17.26% 17.26%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_berserker_rage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • berserker_rage_1:17.3%

Spelldata details

  • id:18499
  • name:Berserker Rage
  • tooltip:Immune to Fear, Sap, and Incapacitate effects.
  • description:You become Enraged, generating ${$12880m1/10} Rage and increasing physical damage done by $12880s2% for $12880d. Also removes and grants immunity to Fear, Sap and Incapacitate effects for the duration of Berserker Rage.
  • max_stacks:
  • duration:6.00
  • cooldown:30.00
  • default_chance:1.00%
bloodbath 6.9 0.0 60.5sec 60.5sec 20.70% 22.94%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodbath
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodbath_1:20.7%

Spelldata details

  • id:12292
  • name:Bloodbath
  • tooltip:Melee special attacks cause an additional $12292s1% bleed damage.
  • description:For the next $12292d, causes your melee special attacks to deal an additional $12292s1% damage as a bleed over $113344d. While bleeding, the target moves at $113344s2% reduced speed.
  • max_stacks:
  • duration:12.00
  • cooldown:60.00
  • default_chance:1.00%
bloodlust 1.0 0.0 0.0sec 0.0sec 10.93% 14.26%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bloodlust_1:10.9%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell casting speed increased by $s1%.
  • description:Increases melee, ranged, and spell casting speed by $s1% for all party and raid members. Lasts $d. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for $57724d.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
bloodsurge 12.2 3.0 28.8sec 22.8sec 30.15% 71.57%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_bloodsurge
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-1.00

Stack Uptimes

  • bloodsurge_1:8.4%
  • bloodsurge_2:5.0%
  • bloodsurge_3:16.8%

Spelldata details

  • id:46916
  • name:Bloodsurge
  • tooltip:Wild Strike has a global cooldown of 1 sec and costs less Rage.
  • description:$@spelldesc46915
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:1.00%
dancing_steel 11.3 12.2 32.3sec 15.0sec 54.41% 52.92%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_1:54.4%
dancing_steel_oh 8.2 3.9 41.1sec 26.8sec 32.94% 33.00%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_dancing_steel_oh
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:1650.00
    • stat:agility
    • amount:1650.00

    Stack Uptimes

    • dancing_steel_oh_1:32.9%
darkmist_vortex 6.0 0.0 64.3sec 64.3sec 32.73% 32.73%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_darkmist_vortex
  • max_stacks:1
  • duration:20.00
  • cooldown:60.00
  • default_chance:15.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • darkmist_vortex_1:32.7%
deadly_calm 6.2 0.0 60.8sec 60.8sec 8.25% 24.82%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_deadly_calm
  • max_stacks:3
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • deadly_calm_1:2.8%
  • deadly_calm_2:2.8%
  • deadly_calm_3:2.6%

Spelldata details

  • id:85730
  • name:Deadly Calm
  • tooltip:Heroic Strike and Cleave cost less Rage.
  • description:You enter a battle trance, reducing the cost of your next 3 Heroic Strike or Cleave attacks by $/10;s1 Rage.
  • max_stacks:
  • duration:9.00
  • cooldown:60.00
  • default_chance:1.00%
enrage 22.8 40.8 16.4sec 5.9sec 79.92% 80.03%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_enrage
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • enrage_1:79.9%

Spelldata details

  • id:12880
  • name:Enrage
  • tooltip:Physical damage dealt increased by $s2%.$?$w4!=0[ Movement speed increased by $w4%.][]
  • description:$@spelldesc13046
  • max_stacks:
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
flurry 32.0 22.0 11.3sec 6.6sec 44.02% 47.83%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_flurry
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:9.00%
  • default_value:-1.00

Stack Uptimes

  • flurry_1:20.4%
  • flurry_2:5.2%
  • flurry_3:18.4%

Spelldata details

  • id:12968
  • name:Flurry
  • tooltip:Attack speed increased by $s1%.
  • description:Your melee hits have a $12972h% chance to increase your attack speed by $12968s1% for your next 3 swings.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.00%
mogu_power_potion 2.0 0.0 306.3sec 0.0sec 12.30% 12.30%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_mogu_power_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:4000.00

    Stack Uptimes

    • mogu_power_potion_1:12.3%
raging_blow 48.9 14.7 7.4sec 5.9sec 39.63% 39.63%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_raging_blow
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • raging_blow_1:26.0%
  • raging_blow_2:13.6%

Spelldata details

  • id:131116
  • name:Raging Blow!
  • tooltip:Allows the use of Raging Blow.
  • description:Allows the use of Raging Blow.
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:1.00%
recklessness 3.0 0.0 152.8sec 152.2sec 14.75% 15.12%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_recklessness
  • max_stacks:1
  • duration:18.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • recklessness_1:14.8%

Spelldata details

  • id:1719
  • name:Recklessness
  • tooltip:Critical chance of special attacks increased by $w1%.
  • description:Grants your special attacks an additional $s1% chance to critically hit. Lasts $d.
  • max_stacks:
  • duration:12.00
  • cooldown:300.00
  • default_chance:0.00%
relic_of_xuen 8.0 0.0 48.4sec 48.4sec 32.61% 32.61%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_relic_of_xuen
  • max_stacks:1
  • duration:15.00
  • cooldown:45.00
  • default_chance:20.00%
  • default_value:-1.00

    • Stat Buff details

    • stat:strength
    • amount:3027.00

    Stack Uptimes

    • relic_of_xuen_1:32.6%
stunned 14.0 0.0 24.2sec 0.0sec 3.83% 3.83%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stunned_1:3.8%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%

Resources

Resource Usage Type Count Total Average RPE APR
Warrior_Fury_2h_T14H
execute Rage 23.4 701.3 30.0 30.0 10050.9
heroic_strike Rage 60.3 1659.8 27.5 27.5 2165.6
impending_victory Rage 6.8 67.9 10.0 10.0 3995.1
raging_blow Rage 47.9 479.3 10.0 10.0 17184.2
wild_strike Rage 45.0 706.3 15.7 15.7 3666.5
Resource Gains Type Count Total Average Overflow
battle_shout Rage 4.08 81.59 20.00 0.00 0.00%
bloodthirst Rage 76.33 763.28 10.00 0.00 0.00%
enrage Rage 63.58 632.31 9.95 3.49 0.55%
incoming_damage Rage 152.00 261.78 1.72 0.03 0.01%
melee_main_hand Rage 101.22 1274.82 12.60 0.49 0.04%
melee_off_hand Rage 101.13 632.91 6.26 4.23 0.66%
Resource RPS-Gain RPS-Loss
Health 318.30 18607.28
Rage 9.96 9.88
Combat End Resource Mean Min Max
Health -6201804.56 -6217178.00 -6187274.00
Rage 31.72 0.22 90.33
Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Rage Cap 0.0%

Procs

Count Interval
hat_donor 139.1 2.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 120156.10
Minimum 101312.49
Maximum 137450.37
Spread ( max - min ) 36137.88
Range [ ( max - min ) / 2 * 100% ] 15.04%
Standard Deviation 4453.5662
5th Percentile 112758.71
95th Percentile 127432.99
( 95th Percentile - 5th Percentile ) 14674.29
Mean Distribution
Standard Deviation 44.5446
95.00% Confidence Intervall ( 120068.80 - 120243.41 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5277
0.1 Scale Factor Error with Delta=300 169316
0.05 Scale Factor Error with Delta=300 677266
0.01 Scale Factor Error with Delta=300 16931658
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 120156.10

Damage

Sample Data
Count 9996
Mean 43977134.10

DTPS

Sample Data
Count 9996
Mean 18607.28

HPS

Sample Data
Count 9996
Mean 318.30
Minimum 275.75
Maximum 367.67
Spread ( max - min ) 91.92
Range [ ( max - min ) / 2 * 100% ] 14.44%
Standard Deviation 13.0552
5th Percentile 296.18
95th Percentile 340.44
( 95th Percentile - 5th Percentile ) 44.26
Mean Distribution
Standard Deviation 0.1306
95.00% Confidence Intervall ( 318.04 - 318.55 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6462
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 145
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 318.30

Heal

Sample Data
Count 9996
Mean 116496.14

HTPS

Sample Data
Count 9996
Mean 318.30

#Executed Foreground Actions

Sample Data
Count 9996
Mean 371.35
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=winters_bite
1 0.00 food,type=black_pepper_ribs_and_shrimp
2 0.00 snapshot_stats
3 0.00 stance,choose=battle
4 0.00 mogu_power_potion
Default action list
# count action,conditions
5 15.00 auto_attack
6 1.00 mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
7 3.00 recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
8 0.00 avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
9 6.90 bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
A 10.60 berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
B 9.00 heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
C 6.25 deadly_calm,use_off_gcd=1,if=rage>=40
D 60.32 heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
E 76.33 bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
F 11.62 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
G 24.59 wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
H 17.27 colossus_smash
I 23.38 execute
J 0.00 storm_bolt,if=talent.storm_bolt.enabled
K 47.93 raging_blow,if=buff.raging_blow.react
L 20.52 wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
M 0.00 shockwave,if=talent.shockwave.enabled
N 5.51 dragon_roar,if=talent.dragon_roar.enabled
O 8.37 heroic_throw
P 3.76 battle_shout,if=rage<70&!debuff.colossus_smash.up
Q 0.00 bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
R 3.36 wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
S 6.79 impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
T 9.54 wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
U 0.32 battle_shout,if=rage<70

Sample Sequence

579AEHBKGECDKDNDEKOEKSDGEDTHDEDKDRGEKPEADTKGETTEHBD5DGEDKLFEKLGE5OK9ESAHDCEDKDNDEGEKTETTEHBDRED5OGEAKPGEKDSETHDEDKDGE5GEKL9FELAOCDGEDHBDKDGEDLLG5ELNGESGEKHDGEDRDGAEKOGEKTE7KTEHBD5DGEDKDLFEK59LGEKCDPDEDOHDEDKSAEKNEKTEKLFEHBDLDGEDKDOEKLF5EK5LGEKHDGEDKDRAE9KSECDPDGDEKLFEHBDKDFDEDKLFENOEA5KTGELHDFDEDKLFE5LLFESGEIHBIIA9IEICIEIKEI756GEHIIIEIIEIIEAIIGEHBI5IEINEIIGEIKEI5H9EIA

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 21788 19385 18254
Agility 226 215 80
Stamina 24697 22452 22264
Intellect 121 115 80
Spirit 146 146 80
Health 492161 460731 0
Rage 120 120 0
Spell Power 0 0 0
Spell Hit 15.00% 15.00% 2549
Spell Crit 25.79% 20.79% 11866
Spell Haste 6.94% 1.84% 784
Mana Per 5 0 0 0
Attack Power 48176 38990 0
Melee Hit 7.50% 7.50% 2549
Melee Crit 30.80% 25.80% 11866
Melee Haste 1.84% 1.84% 784
Swing Speed 12.03% 1.84% 784
Expertise 7.50% / 7.50% 7.50% / 7.50% 2551
Armor 34190 34190 34190
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 11.23% 10.59% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 30.24% 23.24% 5158

Gear

Average Item Level: 506.50
Head helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
Neck necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
Shoulders shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
Shirt empty
Chest battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_hit
Waist patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
Legs legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
Feet jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
Wrists bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
Hands gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_hit
Finger1 ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
Finger2 dread_shadow_ring,id=87158,reforge=hit_mastery
Trinket1 darkmist_vortex,id=87172
Trinket2 relic_of_xuen,id=79327
Back cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
Main Hand shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
Off Hand shinka_execution_of_dominion,id=87176,enchant=dancing_steel
Unknown empty
Tabard empty

Talents

Level
15 Juggernaut Double Time Warbringer
30 Enraged Regeneration Second Wind Impending Victory
45 Staggering Shout Piercing Howl Disrupting Shout
60 Bladestorm Shockwave Dragon Roar
75 Mass Spell Reflection Safeguard Vigilance
90 Avatar Bloodbath Storm Bolt

Profile

#!./simc

warrior="Warrior_Fury_2h_T14H"
origin="http://mop.chardev.org/profile/484-Warrior_Fury_2h_T14H_2.html"
level=90
race=worgen
spec=fury
role=attack
position=back
professions=jewelcrafting=600/blacksmithing=600
talents=http://us.battle.net/wow/en/game/mists-of-pandaria/feature/talent-specification#ZZ!122211
glyphs=unending_rage/recklessness/death_from_above

actions.precombat=flask,type=winters_bite
actions.precombat+=/food,type=black_pepper_ribs_and_shrimp
actions.precombat+=/snapshot_stats
actions.precombat+=/stance,choose=battle
actions.precombat+=/mogu_power_potion

actions=auto_attack
actions+=/mogu_power_potion,if=(target.health.pct<20&buff.recklessness.up)|buff.bloodlust.react|target.time_to_die<=25
actions+=/recklessness,use_off_gcd=1,if=((debuff.colossus_smash.remains>=5|cooldown.colossus_smash.remains<=4)&((!talent.avatar.enabled|!set_bonus.tier14_4pc_melee)&((target.health.pct<20|target.time_to_die>315|(target.time_to_die>165&set_bonus.tier14_4pc_melee)))|(talent.avatar.enabled&set_bonus.tier14_4pc_melee&buff.avatar.up)))|target.time_to_die<=18
actions+=/avatar,use_off_gcd=1,if=talent.avatar.enabled&(((cooldown.recklessness.remains>=180|buff.recklessness.up)|(target.health.pct>=20&target.time_to_die>195)|(target.health.pct<20&set_bonus.tier14_4pc_melee))|target.time_to_die<=20)
actions+=/bloodbath,use_off_gcd=1,if=talent.bloodbath.enabled&(((cooldown.recklessness.remains>=10|buff.recklessness.up)|(target.health.pct>=20&(target.time_to_die<=165|(target.time_to_die<=315&!set_bonus.tier14_4pc_melee))&target.time_to_die>75))|target.time_to_die<=19)
actions+=/berserker_rage,use_off_gcd=1,if=!(buff.enrage.react|(buff.raging_blow.react=2&target.health.pct>=20))
actions+=/heroic_leap,use_off_gcd=1,if=debuff.colossus_smash.up
actions+=/deadly_calm,use_off_gcd=1,if=rage>=40
actions+=/heroic_strike,use_off_gcd=1,if=(((debuff.colossus_smash.up&rage>=40)|(buff.deadly_calm.up&rage>=30))&target.health.pct>=20)|rage>=110
actions+=/bloodthirst,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20&cooldown.bloodthirst.remains<=1
actions+=/wait,sec=cooldown.bloodthirst.remains,if=!(target.health.pct<20&debuff.colossus_smash.up&rage>=30)&cooldown.bloodthirst.remains<=1
actions+=/colossus_smash
actions+=/execute
actions+=/storm_bolt,if=talent.storm_bolt.enabled
actions+=/raging_blow,if=buff.raging_blow.react
actions+=/wild_strike,if=buff.bloodsurge.react&target.health.pct>=20
actions+=/shockwave,if=talent.shockwave.enabled
actions+=/dragon_roar,if=talent.dragon_roar.enabled
actions+=/heroic_throw
actions+=/battle_shout,if=rage<70&!debuff.colossus_smash.up
actions+=/bladestorm,if=talent.bladestorm.enabled&cooldown.colossus_smash.remains>=5&!debuff.colossus_smash.up&cooldown.bloodthirst.remains>=2&target.health.pct>=20
actions+=/wild_strike,if=debuff.colossus_smash.up&target.health.pct>=20
actions+=/impending_victory,if=talent.impending_victory.enabled&target.health.pct>=20
actions+=/wild_strike,if=cooldown.colossus_smash.remains>=1&rage>=60&target.health.pct>=20
actions+=/battle_shout,if=rage<70

head=helmet_of_resounding_rings,id=87192,gems=reverberating_primal_160crit_160hit_180str,reforge=hit_crit
neck=necklace_of_congealed_weaknesses,id=86967,reforge=mastery_exp
shoulders=shoulderpads_of_misshapen_life,id=86986,gems=160exp_160crit_60str,enchant=200str_100crit,reforge=mastery_exp
back=cloak_of_peacock_feathers,id=87026,enchant=180crit,reforge=exp_hit
chest=battleplate_of_resounding_rings,id=87193,gems=320crit_320crit_120crit,enchant=80all,reforge=haste_hit
wrists=bracers_of_defiled_earth,id=90506,gems=480crit,enchant=180str,reforge=mastery_crit
hands=gauntlets_of_resounding_rings,id=87194,gems=480crit,enchant=170str,reforge=exp_hit
waist=patrollers_girdle_of_endless_spring,id=87186,gems=160crit_160hit_320crit_60crit,reforge=hit_mastery
legs=legplates_of_resounding_rings,id=87195,gems=160exp_160crit_60str,enchant=285str_165crit,reforge=mastery_crit
feet=jasper_clawfeet,id=87015,gems=320crit_60crit,enchant=140mastery
finger1=ring_of_the_bladed_tempest,id=86957,reforge=haste_crit
finger2=dread_shadow_ring,id=87158,reforge=hit_mastery
trinket1=darkmist_vortex,id=87172
trinket2=relic_of_xuen,id=79327
main_hand=shinka_execution_of_dominion,id=87176,gems=500str,enchant=dancing_steel
off_hand=shinka_execution_of_dominion,id=87176,enchant=dancing_steel

# Gear Summary
# gear_strength=18254
# gear_agility=80
# gear_stamina=22264
# gear_intellect=80
# gear_spirit=80
# gear_expertise_rating=2551
# gear_hit_rating=2549
# gear_crit_rating=11866
# gear_haste_rating=784
# gear_mastery_rating=5158
# gear_armor=34190
# meta_gem=reverberating_primal
# tier14_2pc_melee=1
# tier14_4pc_melee=1
# main_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel
# off_hand=shinka_execution_of_dominion,heroic=1,weapon=axe2h_3.60speed_14525min_21788max,enchant=dancing_steel

Healing Target : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active
8685.7 131503.0 Health 0.00% 0.0 100.0%

Charts

http://9.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|&chxp=1,1,-1,100&chtt=Healing%20Target DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Healing Target 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
divine_aegis 28.9 43.4 12.8sec 5.0sec 61.75% 85.37%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_divine_aegis
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • divine_aegis_1:61.8%

Spelldata details

  • id:47753
  • name:Divine Aegis
  • tooltip:Absorbs $w1 damage.
  • description:$@spelldesc47515
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
grace 1.0 209.5 0.0sec 1.7sec 99.51% 99.42%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_grace
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • grace_1:0.2%
  • grace_2:0.2%
  • grace_3:99.1%
health_decade_10__20 0.0 0.0 0.0sec 0.0sec 1.49% 1.49%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:1.5%
health_decade_20__30 0.1 0.0 0.0sec 2.0sec 3.95% 3.95%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:4.0%
health_decade_30__40 0.1 0.0 0.0sec 2.3sec 4.79% 4.79%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:4.8%
health_decade_40__50 0.1 0.0 0.0sec 2.0sec 0.83% 0.83%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:0.8%
health_decade_90__100 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:100.0%
power_word_shield 26.3 0.0 14.2sec 14.4sec 36.45% 100.00%

Buff details

  • buff initial source:Priest_Disc_T14H
  • cooldown name:buff_power_word_shield
  • max_stacks:1
  • duration:15.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • power_word_shield_1:36.5%

Spelldata details

  • id:17
  • name:Power Word: Shield
  • tooltip:Absorbs $w1 damage.
  • description:Draws on the soul of the friendly target to shield them, absorbing $<shield> damage$?s55672[ and healing them for $55672s1% of the absorption amount][]. Lasts $d. While the shield holds, spellcasting will not be interrupted by damage. Once shielded, the target cannot be shielded again for $6788d.
  • max_stacks:
  • duration:15.00
  • cooldown:6.00
  • default_chance:0.00%
weakened_soul 26.3 0.0 14.2sec 14.4sec 81.22% 77.51%

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_soul
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • weakened_soul_1:81.2%

Spelldata details

  • id:6788
  • name:Weakened Soul
  • tooltip:Cannot be affected by Power Word: Shield.
  • description:The target's soul is weakened by the force of Power Word: Shield, and cannot be shielded again for $d.
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Healing Target
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Healing Target
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 131502.97 8685.73
Combat End Resource Mean Min Max
Health 54947366.05 49045561.79 59204841.47
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 0.00

Damage

Sample Data
Count 9996
Mean 0.00

DTPS

Sample Data
Count 9996
Mean 8685.73

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 131502.97

#Executed Foreground Actions

Sample Data
Count 9996
Mean 0.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 100000000 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit 0.00% -1.#J% 0
Spell Haste 1.#J% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 0.00% -1.#J% 0
Melee Haste 1.#J% 0.00% 0
Swing Speed 1.#J% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 0 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

unknown="Healing Target"
origin="unknown"
level=90
race=humanoid
spec=unknown
role=tank
position=back


# Gear Summary

Simulation & Raid Information

Iterations: 9996
Threads: 7
Confidence: 95.00
Fight Length: 366 - 366 ( 366.0 )

Performance:
Total Events Processed: 991540225
Max Event Queue: 743
Sim Seconds: 3658536
CPU Seconds: 514.6720
Speed Up: 7108

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )
RNG global_deterministic
RNG global_deterministic: Actual ( Confidence Interval ): Roll=nan Range=nan nan

Simulation Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 366.00
95th Percentile 366.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 366.00 - 366.00 )
Normalized 95.00% Confidence Intervall ( 100.00% - 100.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart
Gear Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Ability Id Total Hit Crit Count Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Crit% T-Avoid% Interval Duration
Death_Knight_Frost_1h_T14H blood_fury 20572 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.28sec 366.00sec
Death_Knight_Frost_1h_T14H blood_plague 55078 1043292 0 0 55.7 0.0% 0.0% 0.0% 0.0% 103.6 9488 18947 6.1% 0.0% 12.10sec 366.00sec
Death_Knight_Frost_1h_T14H death_and_decay 43265 0 0 0 6.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 45.42sec 366.00sec
Death_Knight_Frost_1h_T14H empower_rune_weapon 47568 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 304.34sec 366.00sec
Death_Knight_Frost_1h_T14H frost_fever 55095 1764843 0 0 110.9 0.0% 0.0% 0.0% 0.0% 110.9 15000 30028 6.1% 0.0% 3.30sec 366.00sec
Death_Knight_Frost_1h_T14H frost_strike 49143 11405491 58531 121208 127.5 49.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.82sec 366.00sec
Death_Knight_Frost_1h_T14H frost_strike_offhand 66196 5703477 29272 60612 127.5 49.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.82sec 366.00sec
Death_Knight_Frost_1h_T14H horn_of_winter 57330 0 0 0 7.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 44.52sec 366.00sec
Death_Knight_Frost_1h_T14H howling_blast 49184 8308364 73654 151589 105.9 6.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.44sec 366.00sec
Death_Knight_Frost_1h_T14H melee_main_hand 0 2782569 15273 31450 208.0 11.1% 18.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.75sec 366.00sec
Death_Knight_Frost_1h_T14H melee_off_hand 0 1391377 7637 15735 208.0 11.2% 18.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.75sec 366.00sec
Death_Knight_Frost_1h_T14H obliterate 49020 1639832 46641 96014 27.1 28.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.62sec 366.00sec
Death_Knight_Frost_1h_T14H obliterate_offhand 66198 820498 23320 48019 27.1 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.62sec 366.00sec
Death_Knight_Frost_1h_T14H outbreak 77575 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 78.04sec 366.00sec
Death_Knight_Frost_1h_T14H pillar_of_frost 51271 0 0 0 6.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.33sec 366.00sec
Death_Knight_Frost_1h_T14H plague_leech 123693 0 0 0 14.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.92sec 366.00sec
Death_Knight_Frost_1h_T14H plague_strike 45462 421924 14894 30657 25.3 11.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.45sec 366.00sec
Death_Knight_Frost_1h_T14H plague_strike_offhand 66216 210864 7446 15349 25.3 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.45sec 366.00sec
Death_Knight_Frost_1h_T14H raise_dead 46584 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.43sec 366.00sec
Death_Knight_Frost_1h_T14H razorice 50401 244738 665 0 368.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 0.99sec 366.00sec
Death_Knight_Frost_1h_T14H soul_reaper 130735 2617823 15243 31396 18.3 11.1% 0.0% 0.0% 0.0% 17.5 117800 242401 11.2% 0.0% 7.51sec 366.00sec
Death_Knight_Frost_1h_T14H_ghoul claw 91776 534832 7520 15016 64.0 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.22sec 184.91sec
Death_Knight_Frost_1h_T14H_ghoul melee 0 902602 6073 12145 141.3 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.59sec 184.91sec
Death_Knight_Frost_1h_T14H_army_of_the_dead claw 91776 724379 5431 10866 120.0 11.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.58sec 35.00sec
Death_Knight_Frost_1h_T14H_army_of_the_dead melee 0 1265551 4358 8716 276.2 11.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.99sec 35.00sec
Death_Knight_Frost_2h_T14H blood_fury 20572 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.47sec 366.00sec
Death_Knight_Frost_2h_T14H blood_plague 55078 1196742 0 0 13.0 0.0% 0.0% 0.0% 0.0% 113.5 9633 19260 9.4% 0.0% 30.10sec 366.00sec
Death_Knight_Frost_2h_T14H empower_rune_weapon 47568 0 0 0 1.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.10sec 366.00sec
Death_Knight_Frost_2h_T14H frost_fever 55095 1684321 0 0 46.0 0.0% 0.0% 0.0% 0.0% 115.9 13277 26572 9.4% 0.0% 8.07sec 366.00sec
Death_Knight_Frost_2h_T14H frost_strike 49143 10608669 60488 124940 132.1 30.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.73sec 366.00sec
Death_Knight_Frost_2h_T14H horn_of_winter 57330 0 0 0 12.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 27.41sec 366.00sec
Death_Knight_Frost_2h_T14H howling_blast 49184 2769318 64300 132586 39.1 9.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.18sec 366.00sec
Death_Knight_Frost_2h_T14H melee_main_hand 0 4549919 27113 55847 153.5 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.38sec 366.00sec
Death_Knight_Frost_2h_T14H obliterate 49020 13469020 114329 235698 87.4 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.16sec 366.00sec
Death_Knight_Frost_2h_T14H outbreak 77575 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.78sec 366.00sec
Death_Knight_Frost_2h_T14H pillar_of_frost 51271 0 0 0 6.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.96sec 366.00sec
Death_Knight_Frost_2h_T14H plague_leech 123693 0 0 0 5.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 61.66sec 366.00sec
Death_Knight_Frost_2h_T14H plague_strike 45462 176133 24933 51329 6.1 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 59.53sec 366.00sec
Death_Knight_Frost_2h_T14H raise_dead 46584 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.52sec 366.00sec
Death_Knight_Frost_2h_T14H soul_reaper 130735 3243587 27068 55766 18.5 14.5% 0.0% 0.0% 0.0% 17.8 131097 269689 14.2% 0.6% 7.38sec 366.00sec
Death_Knight_Frost_2h_T14H_ghoul claw 91776 582486 7587 15174 67.1 14.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.92sec 184.60sec
Death_Knight_Frost_2h_T14H_ghoul melee 0 985209 6127 12251 148.3 14.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.47sec 184.60sec
Death_Knight_Frost_2h_T14H_army_of_the_dead claw 91776 795503 5436 10874 127.8 14.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.49sec 35.00sec
Death_Knight_Frost_2h_T14H_army_of_the_dead melee 0 1370766 4395 8787 287.7 14.4% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.95sec 35.00sec
Death_Knight_Unholy_T14H blood_fury 20572 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.56sec 366.00sec
Death_Knight_Unholy_T14H blood_plague 55078 3094848 0 0 6.9 0.0% 0.0% 0.0% 0.0% 115.7 23683 47379 12.9% 0.0% 60.62sec 366.00sec
Death_Knight_Unholy_T14H blood_tap 45529 0 0 0 37.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.42sec 366.00sec
Death_Knight_Unholy_T14H dark_transformation 63560 0 0 0 7.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 50.33sec 366.00sec
Death_Knight_Unholy_T14H death_coil 47541 5785297 54104 111545 94.0 12.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.79sec 366.00sec
Death_Knight_Unholy_T14H empower_rune_weapon 47568 0 0 0 1.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 307.52sec 366.00sec
Death_Knight_Unholy_T14H festering_strike 85948 1710205 49310 101567 29.2 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.53sec 366.00sec
Death_Knight_Unholy_T14H frost_fever 55095 2096176 0 0 6.9 0.0% 0.0% 0.0% 0.0% 115.7 16038 32072 12.9% 0.0% 60.62sec 366.00sec
Death_Knight_Unholy_T14H horn_of_winter 57330 0 0 0 13.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.27sec 366.00sec
Death_Knight_Unholy_T14H melee_main_hand 0 4412986 25294 52091 154.5 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.36sec 366.00sec
Death_Knight_Unholy_T14H outbreak 77575 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.62sec 366.00sec
Death_Knight_Unholy_T14H plague_leech 123693 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.62sec 366.00sec
Death_Knight_Unholy_T14H scourge_strike 55090 9586529 33662 72541 129.0 9.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.81sec 366.00sec
Death_Knight_Unholy_T14H soul_reaper 130736 4398527 25245 52004 18.7 18.0% 0.0% 0.0% 0.0% 17.9 181279 373363 17.8% 0.7% 7.31sec 366.00sec
Death_Knight_Unholy_T14H summon_gargoyle 49206 0 0 0 2.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.83sec 366.00sec
Death_Knight_Unholy_T14H unholy_frenzy 49016 0 0 0 2.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.79sec 366.00sec
Death_Knight_Unholy_T14H_gargoyle gargoyle_strike 51963 1349752 45800 91481 25.0 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.57sec 60.17sec
Death_Knight_Unholy_T14H_ghoul claw 91776 734161 10139 20297 61.4 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.12sec 366.00sec
Death_Knight_Unholy_T14H_ghoul melee 0 3355319 10565 21128 283.8 17.9% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.29sec 366.00sec
Death_Knight_Unholy_T14H_ghoul sweeping_claws 91778 1711438 18543 37077 78.3 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.30sec 366.00sec
Death_Knight_Unholy_T14H_army_of_the_dead claw 91776 1132217 5461 10924 175.8 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.70sec 35.00sec
Death_Knight_Unholy_T14H_army_of_the_dead melee 0 1711520 4425 8848 345.9 17.9% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 0.78sec 35.00sec
Druid_Balance_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.15sec 366.00sec
Druid_Balance_T14H moonfire 8921 4807705 15814 33095 21.4 22.6% 0.0% 0.0% 0.0% 256.7 13721 28608 22.6% 0.0% 17.13sec 366.00sec
Druid_Balance_T14H starfall 48505 4475765 0 0 13.0 0.0% 0.0% 0.0% 0.0% 128.8 27865 58170 22.8% 0.0% 31.00sec 366.00sec
Druid_Balance_T14H starfire 2912 10153634 112305 234261 72.5 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.95sec 366.00sec
Druid_Balance_T14H starsurge 78674 6422229 138181 287716 37.5 22.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.63sec 366.00sec
Druid_Balance_T14H sunfire 93402 4700263 15639 32611 21.4 22.6% 0.0% 0.0% 0.0% 253.4 13606 28240 22.6% 0.0% 17.25sec 366.00sec
Druid_Balance_T14H wild_mushroom_detonate 88751 144719 28421 58997 1.0 25.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Druid_Balance_T14H wrath 5176 5161257 55600 114749 75.1 22.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.73sec 366.00sec
Druid_Feral_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.33sec 366.00sec
Druid_Feral_T14H cat_melee 0 9130412 16023 33323 411.9 41.0% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 0.89sec 366.00sec
Druid_Feral_T14H feral_spirit 110807 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.30sec 366.00sec
Druid_Feral_T14H ferocious_bite 22568 78433 50341 104476 0.9 66.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.52sec 366.00sec
Druid_Feral_T14H healing_touch 5185 344156 0 0 14.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 24.98sec 366.00sec
Druid_Feral_T14H natures_swiftness 132158 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 106.47sec 366.00sec
Druid_Feral_T14H rake 1822 12328321 53954 113173 39.4 40.7% 0.1% 0.0% 0.0% 120.5 52895 111113 41.0% 0.0% 9.33sec 366.00sec
Druid_Feral_T14H rip 1079 2098125 0 0 3.2 0.0% 0.1% 0.0% 0.0% 37.2 39215 81350 40.7% 0.0% 83.73sec 366.00sec
Druid_Feral_T14H savage_roar 52610 0 0 0 14.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 27.51sec 366.00sec
Druid_Feral_T14H_symbiosis_wolf melee 0 354675 1633 3352 154.6 43.9% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.75sec 94.00sec
Druid_Feral_T14H_symbiosis_wolf spirit_bite 58859 290453 6315 12841 32.0 42.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.68sec 94.00sec
Hunter_BM_T14H arcane_shot 3044 4279153 33698 69827 96.2 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.75sec 366.00sec
Hunter_BM_T14H bestial_wrath 19574 0 0 0 6.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 59.32sec 366.00sec
Hunter_BM_T14H blood_fury 20572 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.72sec 366.00sec
Hunter_BM_T14H cobra_shot 77767 2404738 20694 42676 88.3 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.88sec 366.00sec
Hunter_BM_T14H dire_beast 120679 0 0 0 12.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.72sec 366.00sec
Hunter_BM_T14H focus_fire 82692 0 0 0 7.7 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 44.63sec 366.00sec
Hunter_BM_T14H glaive_toss 117050 2373064 38205 79267 23.8 30.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.70sec 366.00sec
Hunter_BM_T14H kill_command 34026 0 0 0 51.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.12sec 366.00sec
Hunter_BM_T14H kill_shot 53351 1404258 87369 180271 12.2 30.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.52sec 366.00sec
Hunter_BM_T14H lynx_rush 120697 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 13.0% 0.0% 79.15sec 366.00sec
Hunter_BM_T14H ranged 0 4387991 21016 43490 157.7 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.30sec 366.00sec
Hunter_BM_T14H rapid_fire 3045 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 102.82sec 366.00sec
Hunter_BM_T14H serpent_sting 1978 1101642 0 0 3.3 0.0% 0.0% 0.0% 0.0% 119.5 6985 14451 29.9% 0.0% 102.63sec 366.00sec
Hunter_BM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.72sec 366.00sec
Hunter_BM_T14H_cat claw 16827 4258363 25776 52148 105.0 56.2% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.50sec 366.00sec
Hunter_BM_T14H_cat kill_command 83381 6140009 85011 172671 51.1 40.2% 0.3% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 7.12sec 366.00sec
Hunter_BM_T14H_cat lynx_rush 120699 2113622 33480 70456 45.0 39.7% 3.5% 0.0% 1.3% 0.0 0 0 0.0% 0.0% 7.29sec 366.00sec
Hunter_BM_T14H_cat melee 0 5157649 15336 31603 245.6 40.4% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.49sec 366.00sec
Hunter_BM_T14H_cat rabid 53401 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 84.63sec 366.00sec
Hunter_BM_T14H_devilsaur claw 16827 198085 10675 21174 12.9 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.67sec 40.00sec
Hunter_BM_T14H_devilsaur melee 0 229988 5753 11841 28.0 45.6% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.78sec 40.00sec
Hunter_BM_T14H_devilsaur monstrous_bite 54680 0 0 0 8.0 43.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 45.92sec 40.00sec
Hunter_BM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 40.00sec
Hunter_BM_T14H_raptor claw 16827 197707 10699 21151 12.9 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.74sec 40.00sec
Hunter_BM_T14H_raptor melee 0 229682 5749 11845 28.0 45.4% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.77sec 40.00sec
Hunter_BM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 40.00sec
Hunter_BM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 40.00sec
Hunter_BM_T14H_hyena claw 16827 197454 10690 21172 12.9 44.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.73sec 40.00sec
Hunter_BM_T14H_hyena melee 0 229907 5748 11846 28.0 45.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.79sec 40.00sec
Hunter_BM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 40.00sec
Hunter_BM_T14H_wolf claw 16827 197358 10721 21095 12.9 44.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.74sec 40.00sec
Hunter_BM_T14H_wolf melee 0 229880 5748 11848 28.0 45.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.78sec 40.00sec
Hunter_BM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.75sec 40.00sec
Hunter_BM_T14H_dire_beast dire_beast_melee 0 1968329 20186 41214 76.6 31.8% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 4.53sec 166.06sec
Hunter_MM_T14H aimed_shot 19434 1856308 68846 152151 16.4 53.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.10sec 366.00sec
Hunter_MM_T14H aimed_shot_mm 82928 1557239 69541 144308 16.5 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 20.97sec 366.00sec
Hunter_MM_T14H arcane_shot 3044 3141028 31892 65915 72.9 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.14sec 366.00sec
Hunter_MM_T14H blood_fury 20572 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.70sec 366.00sec
Hunter_MM_T14H chimera_shot 53209 3490441 74034 153020 35.1 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.88sec 366.00sec
Hunter_MM_T14H dire_beast 120679 0 0 0 13.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 28.99sec 366.00sec
Hunter_MM_T14H glaive_toss 117050 2416804 37062 77085 24.2 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.29sec 366.00sec
Hunter_MM_T14H kill_shot 53351 1340163 84392 174748 11.8 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.80sec 366.00sec
Hunter_MM_T14H lynx_rush 120697 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 16.8% 0.0% 69.86sec 366.00sec
Hunter_MM_T14H piercing_shots 63468 1400893 0 0 63.4 0.0% 0.0% 0.0% 0.0% 273.7 5119 0 0.0% 0.0% 5.54sec 366.00sec
Hunter_MM_T14H ranged 0 4409327 20375 42185 159.7 33.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.28sec 366.00sec
Hunter_MM_T14H rapid_fire 3045 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 110.75sec 366.00sec
Hunter_MM_T14H serpent_sting 1978 1049481 0 0 1.2 0.0% 0.0% 0.0% 0.0% 113.9 6822 14145 32.7% 0.0% 112.21sec 366.00sec
Hunter_MM_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.15sec 366.00sec
Hunter_MM_T14H steady_shot 56641 1578332 10560 22109 108.5 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.27sec 366.00sec
Hunter_MM_T14H wild_quiver_shot 76663 3060790 15818 31813 145.4 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.49sec 366.00sec
Hunter_MM_T14H_cat claw 16827 2123161 14058 28966 103.9 43.0% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 3.54sec 366.00sec
Hunter_MM_T14H_cat lynx_rush 120699 1546856 23715 50327 45.0 43.3% 3.6% 0.0% 1.2% 0.0 0 0 0.0% 0.0% 6.44sec 366.00sec
Hunter_MM_T14H_cat melee 0 3362504 10083 20788 238.0 43.3% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.54sec 366.00sec
Hunter_MM_T14H_cat rabid 53401 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.67sec 366.00sec
Hunter_MM_T14H_devilsaur claw 16827 152574 7471 15507 13.5 47.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.53sec 40.00sec
Hunter_MM_T14H_devilsaur melee 0 164425 3929 8092 28.7 48.8% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_MM_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 46.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.73sec 40.00sec
Hunter_MM_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.19sec 40.00sec
Hunter_MM_T14H_raptor claw 16827 152736 7478 15489 13.5 47.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.53sec 40.00sec
Hunter_MM_T14H_raptor melee 0 164048 3931 8092 28.7 48.5% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_MM_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.19sec 40.00sec
Hunter_MM_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.19sec 40.00sec
Hunter_MM_T14H_hyena claw 16827 152787 7476 15494 13.5 47.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.53sec 40.00sec
Hunter_MM_T14H_hyena melee 0 164167 3930 8089 28.7 48.6% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_MM_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.19sec 40.00sec
Hunter_MM_T14H_wolf claw 16827 152595 7475 15502 13.5 47.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.54sec 40.00sec
Hunter_MM_T14H_wolf melee 0 164223 3928 8093 28.7 48.6% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_MM_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.19sec 40.00sec
Hunter_MM_T14H_dire_beast dire_beast_melee 0 1916108 14167 29206 102.3 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.52sec 178.92sec
Hunter_SV_T14H arcane_shot 3044 3084068 37141 76953 61.2 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.69sec 366.00sec
Hunter_SV_T14H black_arrow 3674 2890528 0 0 14.6 0.0% 0.0% 0.0% 0.0% 142.5 14897 31096 33.2% 0.0% 25.06sec 366.00sec
Hunter_SV_T14H blood_fury 20572 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.72sec 366.00sec
Hunter_SV_T14H cobra_shot 77767 2134411 23782 49154 66.9 32.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.14sec 366.00sec
Hunter_SV_T14H dire_beast 120679 0 0 0 12.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.82sec 366.00sec
Hunter_SV_T14H explosive_shot 53301 7813809 18589 38785 104.7 33.2% 0.0% 0.0% 0.0% 179.1 21558 43630 33.2% 0.0% 3.47sec 366.00sec
Hunter_SV_T14H glaive_toss 117050 2410564 37045 77086 24.0 32.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.44sec 366.00sec
Hunter_SV_T14H kill_shot 53351 1258518 84484 174721 11.2 33.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.16sec 366.00sec
Hunter_SV_T14H lynx_rush 120697 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 45.0 0 0 16.7% 0.0% 70.18sec 366.00sec
Hunter_SV_T14H ranged 0 4163207 20445 42424 149.8 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.44sec 366.00sec
Hunter_SV_T14H rapid_fire 3045 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 99.63sec 366.00sec
Hunter_SV_T14H serpent_sting 1978 2599505 0 0 2.0 0.0% 0.0% 0.0% 0.0% 119.8 16000 33265 33.0% 0.0% 63.95sec 366.00sec
Hunter_SV_T14H serpent_sting_burst 0 100618 35423 73336 2.0 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.95sec 366.00sec
Hunter_SV_T14H stampede 121818 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.14sec 366.00sec
Hunter_SV_T14H_cat claw 16827 1777946 13880 28590 88.0 43.1% 0.2% 0.0% 0.1% 0.0 0 0 0.0% 0.0% 4.20sec 366.00sec
Hunter_SV_T14H_cat lynx_rush 120699 1559503 23840 50769 45.0 43.4% 3.6% 0.0% 1.2% 0.0 0 0 0.0% 0.0% 6.47sec 366.00sec
Hunter_SV_T14H_cat melee 0 3363389 10097 20779 238.0 43.3% 0.2% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.54sec 366.00sec
Hunter_SV_T14H_cat rabid 53401 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.48sec 366.00sec
Hunter_SV_T14H_devilsaur claw 16827 141864 7226 14953 13.0 47.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.80sec 40.00sec
Hunter_SV_T14H_devilsaur melee 0 163797 3891 7965 28.9 49.1% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_SV_T14H_devilsaur monstrous_bite 54680 0 0 0 6.0 46.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.98sec 40.00sec
Hunter_SV_T14H_devilsaur rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.18sec 40.00sec
Hunter_SV_T14H_raptor claw 16827 141908 7224 14958 13.0 47.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.80sec 40.00sec
Hunter_SV_T14H_raptor melee 0 163581 3891 7967 28.9 48.9% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_SV_T14H_raptor rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.18sec 40.00sec
Hunter_SV_T14H_hyena cackling_howl 128432 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.18sec 40.00sec
Hunter_SV_T14H_hyena claw 16827 141788 7229 14949 13.0 47.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.80sec 40.00sec
Hunter_SV_T14H_hyena melee 0 163894 3892 7964 28.9 49.2% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 11.52sec 40.00sec
Hunter_SV_T14H_hyena rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.18sec 40.00sec
Hunter_SV_T14H_wolf claw 16827 142159 7217 14972 13.0 47.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.80sec 40.00sec
Hunter_SV_T14H_wolf melee 0 163812 3892 7968 28.9 49.1% 0.0% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 11.53sec 40.00sec
Hunter_SV_T14H_wolf rabid 53401 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 303.18sec 40.00sec
Hunter_SV_T14H_dire_beast dire_beast_melee 0 1778596 14073 28868 95.5 36.2% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 3.70sec 166.96sec
Mage_Arcane_T14H alter_time_activate 108978 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 194.07sec 366.00sec
Mage_Arcane_T14H arcane_barrage 44425 5319017 191951 402050 23.6 15.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.02sec 366.00sec
Mage_Arcane_T14H arcane_blast 30451 17343418 126646 265091 117.0 15.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.12sec 366.00sec
Mage_Arcane_T14H arcane_missiles 5143 14637593 0 0 54.0 0.0% 0.0% 0.0% 0.0% 259.1 48348 101700 15.8% 0.1% 6.61sec 366.00sec
Mage_Arcane_T14H arcane_power 12042 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.36sec 366.00sec
Mage_Arcane_T14H berserking 26297 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 187.23sec 366.00sec
Mage_Arcane_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.38sec 366.00sec
Mage_Arcane_T14H nether_tempest 114923 6501322 0 0 28.7 0.0% 0.1% 0.0% 0.0% 437.1 12707 26534 15.7% 0.0% 12.96sec 366.00sec
Mage_Arcane_T14H presence_of_mind 12043 0 0 0 4.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.27sec 366.00sec
Mage_Arcane_T14H rune_of_power 116011 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.77sec 366.00sec
Mage_Arcane_T14H_mirror_image arcane_blast 88084 752533 5693 11618 112.7 16.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.30sec 63.51sec
Mage_Fire_T14H alter_time_activate 108978 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 187.45sec 366.00sec
Mage_Fire_T14H berserking 26297 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 187.82sec 366.00sec
Mage_Fire_T14H combustion 11129 6645826 46733 97055 9.9 29.0% 0.0% 0.0% 0.0% 135.1 33819 70738 29.4% 0.0% 37.67sec 366.00sec
Mage_Fire_T14H evocation 12051 0 0 0 8.0 0.0% 0.0% 0.0% 0.0% 29.8 0 0 28.6% 0.0% 46.04sec 366.00sec
Mage_Fire_T14H fireball 133 13427696 77158 160420 118.4 43.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.05sec 366.00sec
Mage_Fire_T14H ignite 12654 5810574 0 0 178.2 0.0% 0.0% 0.0% 0.0% 173.2 33558 0 0.0% 0.0% 2.02sec 366.00sec
Mage_Fire_T14H inferno_blast 108853 1352608 0 64199 21.1 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.10sec 366.00sec
Mage_Fire_T14H mirror_image 55342 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.68sec 366.00sec
Mage_Fire_T14H nether_tempest 114923 4422607 0 0 26.6 0.0% 0.0% 0.0% 0.0% 409.6 8225 17051 29.2% 0.0% 13.89sec 366.00sec
Mage_Fire_T14H presence_of_mind 12043 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.95sec 366.00sec
Mage_Fire_T14H pyroblast 11366 14035107 151685 315730 39.1 43.7% 0.0% 0.0% 0.0% 145.4 24790 51587 43.8% 0.0% 9.07sec 366.00sec
Mage_Fire_T14H_mirror_image fireball 88082 867844 6083 12279 111.4 30.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.00sec 62.72sec
Mage_Frost_T14H alter_time_activate 108978 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 184.47sec 366.00sec
Mage_Frost_T14H blood_fury 33702 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 132.04sec 366.00sec
Mage_Frost_T14H cold_snap 11958 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.17sec 366.00sec
Mage_Frost_T14H evocation 12051 0 0 0 8.0 0.0% 0.0% 0.0% 0.0% 30.7 0 0 18.4% 0.0% 46.06sec 366.00sec
Mage_Frost_T14H frost_bomb 112948 5418605 0 0 38.5 0.0% 0.0% 0.0% 0.0% 38.2 118087 245434 18.8% 0.0% 9.46sec 366.00sec
Mage_Frost_T14H frostbolt 116 8329766 61942 126748 112.8 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.19sec 366.00sec
Mage_Frost_T14H frostfire_bolt 44614 5765199 78053 157473 39.1 87.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.12sec 366.00sec
Mage_Frost_T14H frozen_orb 84714 1842882 0 0 6.0 0.0% 0.0% 0.0% 0.0% 60.0 25444 52948 19.2% 0.0% 62.21sec 366.00sec
Mage_Frost_T14H ice_lance 30455 6983412 79596 160855 46.4 87.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.57sec 366.00sec
Mage_Frost_T14H icy_veins 12472 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.99sec 366.00sec
Mage_Frost_T14H mini_frostbolt 131079 2564986 34395 71657 0.0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Mage_Frost_T14H mini_frostfire_bolt 131081 2352351 44678 96847 0.0 89.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Mage_Frost_T14H mini_ice_lance 131080 2628265 40710 88927 0.0 89.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Mage_Frost_T14H mirror_image 55342 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 184.07sec 366.00sec
Mage_Frost_T14H presence_of_mind 12043 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.02sec 366.00sec
Mage_Frost_T14H_water_elemental freeze 33395 36210 2178 4368 14.0 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.65sec 366.00sec
Mage_Frost_T14H_water_elemental mini_waterbolt 131581 1824939 14781 29982 0.0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Mage_Frost_T14H_water_elemental waterbolt 31707 5771687 26101 51885 187.5 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.95sec 366.00sec
Mage_Frost_T14H_mirror_image fire_blast 59637 116359 3225 6532 30.0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 23.41sec 60.00sec
Mage_Frost_T14H_mirror_image frostbolt 59638 697350 3993 8083 145.0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.48sec 60.00sec
Monk_Windwalker_1h_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.90sec 366.00sec
Monk_Windwalker_1h_T14H blackout_kick 100784 8539343 65209 135410 91.8 39.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.91sec 366.00sec
Monk_Windwalker_1h_T14H blackout_kick_dot 128531 1273905 0 0 91.8 0.0% 0.0% 0.0% 0.0% 277.0 4600 0 0.0% 0.0% 3.91sec 366.00sec
Monk_Windwalker_1h_T14H energizing_brew 115288 0 0 0 5.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 62.40sec 366.00sec
Monk_Windwalker_1h_T14H fists_of_fury 113656 3747355 0 0 11.7 0.0% 0.0% 0.0% 0.0% 43.3 60837 126011 39.4% 0.0% 26.80sec 366.00sec
Monk_Windwalker_1h_T14H invoke_xuen 123904 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.92sec 366.00sec
Monk_Windwalker_1h_T14H jab 100780 2320437 13731 28519 118.3 39.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.10sec 366.00sec
Monk_Windwalker_1h_T14H melee_main_hand 0 6787014 33635 70974 168.4 40.0% 18.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.17sec 366.00sec
Monk_Windwalker_1h_T14H melee_off_hand 0 4059596 19539 41346 173.1 40.0% 19.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 2.11sec 366.00sec
Monk_Windwalker_1h_T14H rising_sun_kick 107428 6636065 116989 242672 39.8 39.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.27sec 366.00sec
Monk_Windwalker_1h_T14H tiger_palm 100787 1446828 27471 57040 36.8 40.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.96sec 366.00sec
Monk_Windwalker_1h_T14H tiger_strikes_melee 0 3196282 26953 56302 82.5 40.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.80sec 366.00sec
Monk_Windwalker_1h_T14H tigereye_brew_use 116740 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 58.93sec 366.00sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger crackling_tiger_lightning 123996 1616971 0 0 17.0 0.0% 0.0% 0.0% 0.0% 83.1 13607 27921 40.9% 0.0% 23.73sec 93.95sec
Monk_Windwalker_1h_T14H_xuen_the_white_tiger melee 0 688131 3282 6729 151.9 41.7% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.42sec 93.95sec
Paladin_Retribution_T14H ancient_fury 86704 225544 92928 191249 2.0 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.85sec 366.00sec
Paladin_Retribution_T14H avenging_wrath 31884 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.65sec 366.00sec
Paladin_Retribution_T14H censure 31803 3887989 0 0 252.8 0.0% 0.0% 0.0% 0.0% 163.6 19257 39902 21.8% 0.0% 1.44sec 366.00sec
Paladin_Retribution_T14H crusader_strike 35395 2614095 31546 65028 67.3 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.45sec 366.00sec
Paladin_Retribution_T14H execution_sentence 114157 2099013 0 0 6.0 0.0% 0.0% 0.0% 0.0% 60.0 28784 59062 20.5% 0.0% 61.16sec 366.00sec
Paladin_Retribution_T14H exorcism 879 3053786 62502 129719 40.2 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.15sec 366.00sec
Paladin_Retribution_T14H guardian_of_ancient_kings 86698 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.85sec 366.00sec
Paladin_Retribution_T14H hammer_of_wrath 24275 6057209 85991 177154 57.0 22.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.37sec 366.00sec
Paladin_Retribution_T14H hand_of_light 0 8374936 46618 0 179.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.03sec 366.00sec
Paladin_Retribution_T14H inquisition 84963 0 0 0 12.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.40sec 366.00sec
Paladin_Retribution_T14H judgment 20271 2410814 47644 98715 41.1 21.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.94sec 366.00sec
Paladin_Retribution_T14H melee 0 4102140 26875 55415 130.2 21.9% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 2.80sec 366.00sec
Paladin_Retribution_T14H seal_of_truth_proc 31801 1907856 6120 12639 252.8 21.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.44sec 366.00sec
Paladin_Retribution_T14H templars_verdict 85256 5651492 82811 170602 55.3 22.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.47sec 366.00sec
Paladin_Retribution_T14H_guardian_of_ancient_kings melee 0 2165534 47495 0 48.5 0.0% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 6.95sec 60.00sec
Priest_Disc_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.42sec 366.00sec
Priest_Disc_T14H divine_aegis 0 0 33460 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Priest_Disc_T14H greater_heal 2060 11624130 137808 275344 62.6 34.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.84sec 366.00sec
Priest_Disc_T14H greater_heal_divine_aegis 47753 2791664 0 0 21.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 16.69sec 366.00sec
Priest_Disc_T14H inner_focus 89485 0 0 0 12.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.68sec 366.00sec
Priest_Disc_T14H mindbender 123040 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.60sec 366.00sec
Priest_Disc_T14H penance_heal 47540 6963881 0 0 51.4 0.0% 0.0% 0.0% 0.0% 148.2 39730 79493 18.4% 0.0% 7.15sec 366.00sec
Priest_Disc_T14H penance_heal_tick_divine_aegis 47753 1006608 0 0 27.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.95sec 366.00sec
Priest_Disc_T14H power_word_shield 17 3508817 33282 0 26.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.36sec 366.00sec
Priest_Disc_T14H power_word_shield_glyph 55672 831091 26655 53333 26.3 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 14.36sec 366.00sec
Priest_Disc_T14H power_word_shield_glyph_divine_aegis 47753 120100 0 0 4.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 62.11sec 366.00sec
Priest_Disc_T14H renew 139 2560510 0 0 24.7 0.0% 0.0% 0.0% 0.0% 99.8 21659 43338 18.4% 0.0% 15.02sec 366.00sec
Priest_Disc_T14H renew_divine_aegis 47753 369442 0 0 18.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.77sec 366.00sec
Priest_Disc_T14H_mindbender melee 0 1835404 29965 59991 64.9 15.4% 15.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.91sec 86.24sec
Priest_Disc_T14H_mindbender shadowcrawl 63619 0 0 0 17.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.06sec 86.24sec
Priest_Holy_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.59sec 366.00sec
Priest_Holy_T14H chakra 81208 0 0 0 12.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.26sec 366.00sec
Priest_Holy_T14H echo_of_light 77489 4116367 0 0 192.2 0.0% 0.0% 0.0% 0.0% 359.1 11463 0 0.0% 0.0% 1.90sec 366.00sec
Priest_Holy_T14H flash_heal 2061 2521259 79358 158739 21.4 48.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 16.50sec 366.00sec
Priest_Holy_T14H greater_heal 2060 4641403 105594 211218 30.2 45.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 8.20sec 366.00sec
Priest_Holy_T14H heal 2050 7728950 49515 99053 108.5 43.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.35sec 366.00sec
Priest_Holy_T14H holy_word_serenity 88684 2704122 62769 125566 32.3 33.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.47sec 366.00sec
Priest_Holy_T14H renew 139 4094219 0 0 1.9 0.0% 0.0% 0.0% 0.0% 149.0 19147 38302 43.5% 0.0% 18.03sec 366.00sec
Priest_Holy_T14H shadowfiend 34433 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.12sec 366.00sec
Priest_Holy_T14H_shadowfiend melee 0 845816 44083 88224 20.4 15.2% 15.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 9.93sec 24.02sec
Priest_Holy_T14H_shadowfiend shadowcrawl 63619 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 62.41sec 24.02sec
Priest_Shadow_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.21sec 366.00sec
Priest_Shadow_T14H devouring_plague 2944 2237881 124654 258163 15.0 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 25.84sec 366.00sec
Priest_Shadow_T14H devouring_plague_mastery 124467 980547 20856 43294 39.3 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.24sec 366.00sec
Priest_Shadow_T14H devouring_plague_tick 2944 3094969 0 0 15.0 0.0% 0.0% 0.0% 0.0% 125.5 20633 42766 18.2% 0.0% 25.84sec 366.00sec
Priest_Shadow_T14H halo_damage 120644 1347388 124840 258794 9.0 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.74sec 366.00sec
Priest_Shadow_T14H mind_blast 8092 4358248 99000 205313 36.8 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.01sec 366.00sec
Priest_Shadow_T14H mind_flay 15407 7431931 0 0 110.9 0.0% 0.0% 0.0% 0.0% 237.5 26134 54244 18.3% 0.0% 3.24sec 366.00sec
Priest_Shadow_T14H mind_flay_mastery 124468 2320534 26077 54116 74.3 18.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.77sec 366.00sec
Priest_Shadow_T14H mind_spike 73510 3747155 99790 206892 31.4 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.14sec 366.00sec
Priest_Shadow_T14H shadow_word_death 32379 1637236 109935 227625 12.4 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.52sec 366.00sec
Priest_Shadow_T14H shadow_word_pain 589 3679264 0 0 17.9 0.0% 0.0% 0.0% 0.0% 183.4 15391 31870 28.3% 0.0% 21.19sec 366.00sec
Priest_Shadow_T14H shadow_word_pain_mastery 124464 1148495 15389 31846 57.4 28.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.24sec 366.00sec
Priest_Shadow_T14H shadowfiend 34433 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 181.33sec 366.00sec
Priest_Shadow_T14H shadowy_apparition 87532 1377935 19197 38666 61.9 18.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.81sec 366.00sec
Priest_Shadow_T14H vampiric_touch 34914 3317184 0 0 19.1 0.0% 0.0% 0.0% 0.0% 160.9 17223 35751 18.3% 0.0% 19.28sec 366.00sec
Priest_Shadow_T14H vampiric_touch_mastery 124465 1038087 17262 35793 50.4 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.07sec 366.00sec
Priest_Shadow_T14H_shadowfiend melee 0 1813397 53182 107814 29.8 20.0% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 6.70sec 24.02sec
Priest_Shadow_T14H_shadowfiend shadowcrawl 63619 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 62.58sec 24.02sec
Rogue_Assassination_T14H ambush 8676 42 59441 0 0.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Rogue_Assassination_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.83sec 366.00sec
Rogue_Assassination_T14H deadly_poison_dot 2818 4966045 0 0 440.9 0.0% 0.0% 0.0% 0.0% 121.0 29767 63407 33.5% 0.0% 1.05sec 366.00sec
Rogue_Assassination_T14H deadly_poison_instant 113780 9435134 15476 33136 439.9 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.05sec 366.00sec
Rogue_Assassination_T14H dispatch 111240 5201394 50949 106993 74.6 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.86sec 366.00sec
Rogue_Assassination_T14H envenom 32645 3937294 71679 154296 39.5 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.11sec 366.00sec
Rogue_Assassination_T14H melee_main_hand 0 3904769 12380 26505 279.0 33.0% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.32sec 366.00sec
Rogue_Assassination_T14H melee_off_hand 0 1957438 6212 13309 278.4 33.1% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.32sec 366.00sec
Rogue_Assassination_T14H mutilate 1329 0 0 0 59.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.01sec 366.00sec
Rogue_Assassination_T14H mutilate_mh 5374 2081454 25339 53947 59.6 33.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.01sec 366.00sec
Rogue_Assassination_T14H mutilate_oh 27576 1058538 12873 27424 59.6 33.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.01sec 366.00sec
Rogue_Assassination_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.54sec 366.00sec
Rogue_Assassination_T14H rupture 1943 1185432 0 0 19.5 0.0% 0.0% 0.0% 0.0% 180.1 4751 10113 34.1% 0.0% 19.06sec 366.00sec
Rogue_Assassination_T14H shadow_blade 121473 1490560 20674 43526 50.7 38.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.10sec 366.00sec
Rogue_Assassination_T14H shadow_blade_offhand 121474 743419 10336 21753 50.6 38.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.10sec 366.00sec
Rogue_Assassination_T14H shadow_blades 121471 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.64sec 366.00sec
Rogue_Assassination_T14H slice_and_dice 5171 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 306.16sec 366.00sec
Rogue_Assassination_T14H tricks_of_the_trade 57934 0 0 0 12.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.16sec 366.00sec
Rogue_Assassination_T14H vanish 1856 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 100.85sec 366.00sec
Rogue_Assassination_T14H vendetta 79140 0 0 0 3.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.52sec 366.00sec
Rogue_Assassination_T14H venomous_wound 79136 5048823 27131 57767 135.1 33.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.67sec 366.00sec
Rogue_Combat_T14H adrenaline_rush 13750 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 91.85sec 366.00sec
Rogue_Combat_T14H ambush 8676 67 54366 111993 0.0 71.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Rogue_Combat_T14H berserking 26297 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.62sec 366.00sec
Rogue_Combat_T14H deadly_poison_dot 2818 3292111 0 0 278.8 0.0% 0.0% 0.0% 0.0% 120.9 20038 42258 32.3% 0.0% 1.41sec 366.00sec
Rogue_Combat_T14H deadly_poison_instant 113780 4070717 10712 22740 277.8 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.41sec 366.00sec
Rogue_Combat_T14H eviscerate 2098 3396425 89566 187354 28.1 32.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.45sec 366.00sec
Rogue_Combat_T14H killing_spree 51690 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 40.0 0 0 33.5% 0.0% 63.02sec 366.00sec
Rogue_Combat_T14H killing_spree_mh 0 1572502 0 0 40.0 0.0% 0.0% 0.0% 0.0% 0.0 28342 59784 34.8% 0.0% 8.11sec 366.00sec
Rogue_Combat_T14H killing_spree_oh 0 951834 0 0 40.0 0.0% 0.0% 0.0% 0.0% 0.0 17177 36220 34.7% 0.0% 8.11sec 366.00sec
Rogue_Combat_T14H main_gauche 86392 4774380 23521 49371 152.4 32.1% 2.1% 0.0% 0.9% 0.0 0 0 0.0% 0.0% 2.40sec 366.00sec
Rogue_Combat_T14H melee_main_hand 0 4168553 19405 41051 192.5 32.5% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.91sec 366.00sec
Rogue_Combat_T14H melee_off_hand 0 3698031 11731 24820 282.4 32.5% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.30sec 366.00sec
Rogue_Combat_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.53sec 366.00sec
Rogue_Combat_T14H revealing_strike 84617 682660 24128 50203 21.0 32.1% 0.0% 0.0% 0.0% 121.0 0 0 32.4% 0.0% 18.05sec 366.00sec
Rogue_Combat_T14H rupture 1943 1298770 0 0 9.0 0.0% 0.0% 0.0% 0.0% 107.5 8841 18637 33.1% 0.0% 39.54sec 366.00sec
Rogue_Combat_T14H shadow_blade 121473 2286303 30011 62566 56.3 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.40sec 366.00sec
Rogue_Combat_T14H shadow_blade_offhand 121474 1980122 18149 37824 80.8 32.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.74sec 366.00sec
Rogue_Combat_T14H shadow_blades 121471 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 92.64sec 366.00sec
Rogue_Combat_T14H sinister_strike 1752 6625310 31099 64977 157.3 32.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.33sec 366.00sec
Rogue_Combat_T14H slice_and_dice 5171 0 0 0 12.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.60sec 366.00sec
Rogue_Combat_T14H tricks_of_the_trade 57934 0 0 0 12.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 30.77sec 366.00sec
Rogue_Combat_T14H vanish 1856 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 101.28sec 366.00sec
Rogue_Subtlety_T14H ambush 8676 48 60030 123663 0.0 14.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Rogue_Subtlety_T14H berserking 26297 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 189.42sec 366.00sec
Rogue_Subtlety_T14H deadly_poison_dot 2818 3522363 0 0 257.2 0.0% 0.0% 0.0% 0.0% 121.0 20409 43240 38.1% 0.0% 1.57sec 366.00sec
Rogue_Subtlety_T14H deadly_poison_instant 113780 3885425 10563 22461 256.2 38.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.57sec 366.00sec
Rogue_Subtlety_T14H eviscerate 2098 7492420 102664 218309 50.5 39.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.22sec 366.00sec
Rogue_Subtlety_T14H hemorrhage 16511 7357572 27149 56971 176.8 38.5% 0.0% 0.0% 0.0% 121.0 3050 6533 38.1% 0.0% 2.08sec 366.00sec
Rogue_Subtlety_T14H melee_main_hand 0 5246630 13510 28389 335.2 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.01sec 366.00sec
Rogue_Subtlety_T14H melee_off_hand 0 2632902 6777 14239 335.2 36.9% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.01sec 366.00sec
Rogue_Subtlety_T14H premeditation 14183 0 0 0 6.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 57.16sec 366.00sec
Rogue_Subtlety_T14H preparation 14185 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.48sec 366.00sec
Rogue_Subtlety_T14H rupture 1943 3144084 0 0 16.6 0.0% 0.0% 0.0% 0.0% 177.8 12431 26207 38.2% 0.0% 22.62sec 366.00sec
Rogue_Subtlety_T14H shadow_blade 121473 2295297 21999 46569 68.9 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.38sec 366.00sec
Rogue_Subtlety_T14H shadow_blade_offhand 121474 1146641 11013 23260 68.8 46.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.38sec 366.00sec
Rogue_Subtlety_T14H shadow_blades 121471 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.84sec 366.00sec
Rogue_Subtlety_T14H shadow_dance 51713 0 0 0 6.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.20sec 366.00sec
Rogue_Subtlety_T14H slice_and_dice 5171 0 0 0 11.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.91sec 366.00sec
Rogue_Subtlety_T14H tricks_of_the_trade 57934 0 0 0 11.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 32.17sec 366.00sec
Rogue_Subtlety_T14H vanish 1856 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 103.56sec 366.00sec
Shaman_Elemental_T14H ascendance 114049 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 180.98sec 366.00sec
Shaman_Elemental_T14H blood_fury 33697 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.83sec 366.00sec
Shaman_Elemental_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 301.84sec 366.00sec
Shaman_Elemental_T14H earth_shock 8042 892680 26818 69788 25.8 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.05sec 366.00sec
Shaman_Elemental_T14H earth_shock_eoe 0 51775 26063 67764 1.5 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 95.95sec 366.00sec
Shaman_Elemental_T14H elemental_blast 117014 3010065 96752 251981 24.0 18.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.29sec 366.00sec
Shaman_Elemental_T14H elemental_blast_eoe 0 179530 97029 253066 1.4 19.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 101.16sec 366.00sec
Shaman_Elemental_T14H elemental_blast_overload 120588 1097086 72859 189971 11.6 18.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 29.90sec 366.00sec
Shaman_Elemental_T14H elemental_blast_overload_eoe 0 65654 72676 189709 0.7 18.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 108.45sec 366.00sec
Shaman_Elemental_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Shaman_Elemental_T14H flame_shock 8050 1969877 14846 38568 12.6 17.5% 0.0% 0.0% 0.0% 156.1 8662 22503 17.5% 0.0% 30.34sec 366.00sec
Shaman_Elemental_T14H flame_shock_eoe 0 14226 14452 37598 0.8 17.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 129.49sec 366.00sec
Shaman_Elemental_T14H fulmination 26364 3208906 96325 250580 25.8 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.05sec 366.00sec
Shaman_Elemental_T14H lava_burst 51505 9786379 0 146392 66.9 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.41sec 366.00sec
Shaman_Elemental_T14H lava_burst_eoe 0 576097 50944 144390 4.0 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 66.61sec 366.00sec
Shaman_Elemental_T14H lava_burst_overload 77451 3548403 38665 108697 32.7 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.87sec 366.00sec
Shaman_Elemental_T14H lava_burst_overload_eoe 0 218704 40809 111592 2.0 99.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 89.93sec 366.00sec
Shaman_Elemental_T14H lightning_bolt 403 6659240 47935 124659 108.5 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.14sec 366.00sec
Shaman_Elemental_T14H lightning_bolt_eoe 0 388874 46567 121237 6.5 17.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 44.29sec 366.00sec
Shaman_Elemental_T14H lightning_bolt_overload 45284 2145293 33312 86655 50.5 17.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.71sec 366.00sec
Shaman_Elemental_T14H lightning_bolt_overload_eoe 0 128398 33355 86808 3.0 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.68sec 366.00sec
Shaman_Elemental_T14H searing_totem 3599 0 0 0 4.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 74.84sec 366.00sec
Shaman_Elemental_T14H_greater_fire_elemental fire_blast 57984 173706 6799 17169 20.0 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.75sec 120.00sec
Shaman_Elemental_T14H_greater_fire_elemental fire_melee 0 2197766 17108 43290 105.3 18.2% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 3.40sec 120.00sec
Shaman_Elemental_T14H_greater_earth_elemental earth_melee 0 406070 5730 11508 63.5 17.5% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 5.48sec 104.08sec
Shaman_Elemental_T14H_searing_totem searing_bolt 3606 839484 4701 12222 140.2 17.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.09sec 227.90sec
Shaman_Enhancement_T14H ascendance 114049 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 182.62sec 366.00sec
Shaman_Enhancement_T14H blood_fury 33697 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.74sec 366.00sec
Shaman_Enhancement_T14H earth_elemental_totem 2062 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 302.05sec 366.00sec
Shaman_Enhancement_T14H earth_shock 8042 1819092 32166 66830 35.4 55.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.15sec 366.00sec
Shaman_Enhancement_T14H earth_shock_eoe 0 548158 32168 66795 10.7 55.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.70sec 366.00sec
Shaman_Enhancement_T14H feral_spirit 51533 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 122.83sec 366.00sec
Shaman_Enhancement_T14H fire_elemental_totem 2894 0 0 0 2.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 300.71sec 366.00sec
Shaman_Enhancement_T14H flame_shock 8050 2614786 23895 50078 11.5 15.4% 0.0% 0.0% 0.0% 136.3 14408 30199 15.4% 0.0% 33.04sec 366.00sec
Shaman_Enhancement_T14H flame_shock_eoe 0 95831 23851 49945 3.4 15.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 83.16sec 366.00sec
Shaman_Enhancement_T14H flametongue_oh 8024 1982951 7241 15228 233.4 15.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.57sec 366.00sec
Shaman_Enhancement_T14H improved_lava_lash 0 0 0 0 31.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.34sec 366.00sec
Shaman_Enhancement_T14H lava_lash 60103 4958148 108620 226452 32.9 35.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.01sec 366.00sec
Shaman_Enhancement_T14H lightning_bolt 403 4098483 42685 88795 60.0 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.01sec 366.00sec
Shaman_Enhancement_T14H lightning_bolt_eoe 0 1212020 42778 89123 17.7 55.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 19.70sec 366.00sec
Shaman_Enhancement_T14H lightning_shield 324 4376459 20390 42275 135.7 54.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.04sec 366.00sec
Shaman_Enhancement_T14H melee_main_hand 0 2659547 13845 28969 169.7 34.8% 19.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.16sec 366.00sec
Shaman_Enhancement_T14H melee_off_hand 0 1320794 6920 14477 168.6 34.7% 18.9% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 2.17sec 366.00sec
Shaman_Enhancement_T14H searing_totem 3599 0 0 0 5.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.29sec 366.00sec
Shaman_Enhancement_T14H stormblast 115356 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.86sec 366.00sec
Shaman_Enhancement_T14H stormblast_mh 115357 779523 132611 277830 4.0 42.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.86sec 366.00sec
Shaman_Enhancement_T14H stormblast_oh 115360 390939 66304 138897 4.0 43.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 63.86sec 366.00sec
Shaman_Enhancement_T14H stormstrike 17364 0 0 0 39.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.40sec 366.00sec
Shaman_Enhancement_T14H stormstrike_mh 32175 2686945 50047 103994 39.1 34.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.40sec 366.00sec
Shaman_Enhancement_T14H stormstrike_oh 32176 1342204 25025 51995 39.1 34.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.40sec 366.00sec
Shaman_Enhancement_T14H unleash_elements 73680 0 0 0 23.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.76sec 366.00sec
Shaman_Enhancement_T14H unleash_flame 73683 651399 23457 48909 23.8 15.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.76sec 366.00sec
Shaman_Enhancement_T14H unleash_flame_eoe 0 195275 23444 48792 7.2 15.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 46.65sec 366.00sec
Shaman_Enhancement_T14H unleash_wind 73681 415884 12626 26267 23.8 35.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.76sec 366.00sec
Shaman_Enhancement_T14H windfury_mh 33757 1998429 15240 31772 94.4 35.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.44sec 366.00sec
Shaman_Enhancement_T14H windlash_main_hand 114089 1049069 35134 73467 20.1 44.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.23sec 366.00sec
Shaman_Enhancement_T14H windlash_off_hand 114093 537087 17587 36745 20.6 44.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.00sec 366.00sec
Shaman_Enhancement_T14H_spirit_wolf melee 0 643590 2403 4931 200.6 37.3% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.76sec 90.00sec
Shaman_Enhancement_T14H_spirit_wolf spirit_bite 58859 595420 14288 29291 29.9 37.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 10.46sec 90.00sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_blast 57984 224433 8144 16813 20.0 35.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 18.75sec 119.81sec
Shaman_Enhancement_T14H_greater_fire_elemental fire_melee 0 3427609 20583 42789 125.1 35.9% 0.0% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 2.89sec 119.81sec
Shaman_Enhancement_T14H_greater_earth_elemental earth_melee 0 549248 4993 10240 83.5 35.7% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 4.24sec 111.07sec
Shaman_Enhancement_T14H_searing_totem searing_bolt 3606 974085 5552 11608 149.9 15.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.04sec 243.59sec
Warlock_Affliction_T14H agony 980 6421077 0 0 11.1 0.0% 0.0% 0.0% 0.0% 288.1 18693 38923 17.8% 0.0% 28.78sec 366.00sec
Warlock_Affliction_T14H agony_ds 0 1042258 29498 61417 29.6 18.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.23sec 366.00sec
Warlock_Affliction_T14H agony_mg 0 4485405 13892 28919 271.0 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.09sec 366.00sec
Warlock_Affliction_T14H blood_fury 33702 0 0 0 3.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 121.14sec 366.00sec
Warlock_Affliction_T14H corruption 172 5408194 0 0 14.4 0.0% 0.0% 0.0% 0.0% 288.3 15749 32764 17.7% 0.0% 21.94sec 366.00sec
Warlock_Affliction_T14H corruption_ds 0 886113 25060 52219 29.6 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.23sec 366.00sec
Warlock_Affliction_T14H corruption_mg 0 3797879 11764 24487 271.0 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.09sec 366.00sec
Warlock_Affliction_T14H dark_soul 113860 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 81.08sec 366.00sec
Warlock_Affliction_T14H drain_soul 1120 1986720 0 0 15.1 0.0% 0.0% 0.0% 0.0% 29.6 56274 116974 18.0% 0.0% 4.60sec 366.00sec
Warlock_Affliction_T14H haunt 48181 4720067 117470 244334 34.0 17.7% 0.0% 0.0% 0.0% 132.0 0 0 0.0% 0.0% 10.87sec 366.00sec
Warlock_Affliction_T14H life_tap 1454 0 0 0 7.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 45.55sec 366.00sec
Warlock_Affliction_T14H malefic_grasp 103103 4361007 0 0 84.8 0.0% 0.0% 0.0% 0.0% 271.0 13532 28121 17.6% 0.0% 3.48sec 366.00sec
Warlock_Affliction_T14H soul_swap 86121 218141 23719 49275 7.7 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 53.79sec 366.00sec
Warlock_Affliction_T14H soulburn 74434 0 0 0 7.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 52.55sec 366.00sec
Warlock_Affliction_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Warlock_Affliction_T14H unstable_affliction 30108 5754134 0 0 19.5 0.0% 0.0% 0.0% 0.0% 281.3 17173 35710 17.7% 0.0% 17.58sec 366.00sec
Warlock_Affliction_T14H unstable_affliction_ds 0 963846 27291 56743 29.6 18.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.23sec 366.00sec
Warlock_Affliction_T14H unstable_affliction_mg 0 4141062 12834 26696 271.0 17.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.09sec 366.00sec
Warlock_Affliction_T14H_felhunter shadow_bite 54049 26391 22118 44236 1.0 19.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 0.00sec
Warlock_Affliction_T14H_doomguard doom_bolt 85692 877030 37052 75530 19.9 18.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.84sec 60.00sec
Warlock_Demonology_T14H blood_fury 33702 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.91sec 366.00sec
Warlock_Demonology_T14H cancel_metamorphosis 0 0 0 0 11.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 26.00sec 366.00sec
Warlock_Demonology_T14H corruption 172 3270773 0 0 1.0 0.0% 0.1% 0.0% 0.0% 235.9 11611 24194 17.9% 0.0% 40.52sec 366.00sec
Warlock_Demonology_T14H dark_soul 113861 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.85sec 366.00sec
Warlock_Demonology_T14H doom 603 3921679 0 0 8.0 0.0% 0.1% 0.0% 0.0% 32.0 102004 213473 18.3% 0.0% 45.67sec 366.00sec
Warlock_Demonology_T14H hand_of_guldan 105174 689808 12172 25370 23.9 17.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 15.17sec 366.00sec
Warlock_Demonology_T14H life_tap 1454 0 0 0 9.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 36.55sec 366.00sec
Warlock_Demonology_T14H melee 103988 1560668 7112 14792 185.7 18.0% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.95sec 366.00sec
Warlock_Demonology_T14H metamorphosis 103958 0 0 0 16.5 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 23.09sec 366.00sec
Warlock_Demonology_T14H service_felguard 111898 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.92sec 366.00sec
Warlock_Demonology_T14H shadow_bolt 686 3120554 19221 40039 136.4 17.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.03sec 366.00sec
Warlock_Demonology_T14H shadowflame 47960 1786005 0 0 23.7 17.8% 0.0% 0.0% 0.0% 181.0 8243 17285 18.0% 0.0% 15.16sec 366.00sec
Warlock_Demonology_T14H soul_fire 6353 5506725 0 94833 58.5 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.98sec 366.00sec
Warlock_Demonology_T14H summon_doomguard 18540 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Warlock_Demonology_T14H touch_of_chaos 103964 7217559 58032 120384 104.6 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.45sec 366.00sec
Warlock_Demonology_T14H_doomguard doom_bolt 85692 1136691 48987 100430 19.5 18.3% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.04sec 60.00sec
Warlock_Demonology_T14H_felguard felstorm 89753 1961524 17968 36302 8.1 17.7% 0.1% 0.0% 0.0% 56.0 27053 54706 17.8% 0.1% 45.87sec 366.00sec
Warlock_Demonology_T14H_felguard legion_strike 30213 1858895 23141 46790 68.0 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.48sec 366.00sec
Warlock_Demonology_T14H_felguard melee 0 4310180 17641 35619 217.9 17.8% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.65sec 366.00sec
Warlock_Demonology_T14H_wild_imp firebolt 104318 4666485 15192 30635 288.0 17.8% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.25sec 282.50sec
Warlock_Demonology_T14H_service_felguard felstorm 89751 1009840 19826 39887 4.0 18.5% 0.1% 0.0% 0.0% 24.8 31102 62574 18.5% 0.1% 120.92sec 69.31sec
Warlock_Demonology_T14H_service_felguard legion_strike 30213 518525 27191 55334 16.0 18.6% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 17.11sec 69.31sec
Warlock_Demonology_T14H_service_felguard melee 0 864755 20699 42186 36.9 18.5% 0.1% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 7.17sec 69.31sec
Warlock_Destruction_T14H blood_fury 33702 0 0 0 4.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 120.88sec 366.00sec
Warlock_Destruction_T14H chaos_bolt 116858 7671816 0 342526 22.4 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 13.50sec 366.00sec
Warlock_Destruction_T14H conflagrate 17962 2850796 67408 142359 32.0 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.64sec 366.00sec
Warlock_Destruction_T14H dark_soul 113858 0 0 0 5.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 80.86sec 366.00sec
Warlock_Destruction_T14H immolate 348 4045592 16593 35067 22.1 28.2% 0.0% 0.0% 0.0% 163.3 16544 34979 28.6% 0.0% 16.35sec 366.00sec
Warlock_Destruction_T14H incinerate 29722 14754037 65315 136953 174.8 27.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.06sec 366.00sec
Warlock_Destruction_T14H shadowburn 17877 1592950 216535 438431 5.6 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 11.98sec 366.00sec
Warlock_Destruction_T14H summon_terrorguard 112927 0 0 0 1.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 1.#Rsec 366.00sec
Warlock_Destruction_T14H_observer melee 0 5129101 16092 32910 258.7 27.8% 0.0% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 1.41sec 366.00sec
Warlock_Destruction_T14H_observer tongue_lash 115778 2441058 23631 48348 80.0 27.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.64sec 366.00sec
Warlock_Destruction_T14H_terrorguard doom_bolt 85692 1134200 42615 93721 19.4 30.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.87sec 60.00sec
Warrior_Arms_T14H battle_shout 6673 0 0 0 2.8 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 93.92sec 366.00sec
Warrior_Arms_T14H berserker_rage 18499 0 0 0 12.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 31.40sec 366.00sec
Warrior_Arms_T14H bloodbath 12292 2364096 0 0 6.6 0.0% 0.0% 0.0% 0.0% 102.6 23031 0 0.0% 0.0% 61.56sec 366.00sec
Warrior_Arms_T14H colossus_smash 86346 2006276 51925 108413 28.9 31.1% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 12.69sec 366.00sec
Warrior_Arms_T14H deadly_calm 85730 0 0 0 6.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.40sec 366.00sec
Warrior_Arms_T14H deep_wounds 115767 2171836 0 0 58.9 0.0% 0.0% 0.0% 0.0% 121.0 13635 28051 29.9% 0.0% 6.25sec 366.00sec
Warrior_Arms_T14H dragon_roar 118000 1165518 0 209087 5.6 99.9% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 66.31sec 366.00sec
Warrior_Arms_T14H execute 5308 5789781 205746 445027 20.3 33.5% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 3.32sec 366.00sec
Warrior_Arms_T14H heroic_leap 6544 855013 56389 119903 11.2 31.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 33.82sec 366.00sec
Warrior_Arms_T14H heroic_strike 78 2978784 76561 155718 29.5 30.7% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 9.91sec 366.00sec
Warrior_Arms_T14H heroic_throw 57755 114728 14320 30115 6.0 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 51.69sec 366.00sec
Warrior_Arms_T14H impending_victory 103840 7286 31663 64810 0.2 26.1% 0.2% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 83.51sec 366.00sec
Warrior_Arms_T14H melee_main_hand 0 4840817 35675 73509 112.0 25.7% 0.1% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 3.26sec 366.00sec
Warrior_Arms_T14H mortal_strike 12294 6429224 82089 172148 59.0 30.0% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.24sec 366.00sec
Warrior_Arms_T14H opportunity_strike 76858 3749545 19146 39211 148.9 30.2% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.45sec 366.00sec
Warrior_Arms_T14H overpower 7384 5697092 41085 86281 70.7 87.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 5.16sec 366.00sec
Warrior_Arms_T14H recklessness 1719 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 154.67sec 366.00sec
Warrior_Arms_T14H slam 1464 3886240 70818 148009 42.0 28.4% 0.1% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.71sec 366.00sec
Warrior_Fury_1h_T14H battle_shout 6673 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 71.81sec 366.00sec
Warrior_Fury_1h_T14H berserker_rage 18499 0 0 0 10.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 35.30sec 366.00sec
Warrior_Fury_1h_T14H bloodbath 12292 2279187 0 0 6.9 0.0% 0.0% 0.0% 0.0% 104.5 21812 0 0.0% 0.0% 60.56sec 366.00sec
Warrior_Fury_1h_T14H bloodthirst 23881 4119721 32663 69657 76.3 57.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.83sec 366.00sec
Warrior_Fury_1h_T14H bloodthirst_heal 23881 117296 1214 2425 76.3 23.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.83sec 366.00sec
Warrior_Fury_1h_T14H colossus_smash 86346 917923 39684 84152 17.3 30.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.53sec 366.00sec
Warrior_Fury_1h_T14H deadly_calm 85730 0 0 0 6.3 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.77sec 366.00sec
Warrior_Fury_1h_T14H deep_wounds 115767 3578495 0 0 76.3 0.0% 0.0% 0.0% 0.0% 121.0 22412 46553 29.7% 0.0% 4.83sec 366.00sec
Warrior_Fury_1h_T14H dragon_roar 118000 1464019 0 266132 5.5 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.38sec 366.00sec
Warrior_Fury_1h_T14H execute 5308 8576442 259238 569197 23.6 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.85sec 366.00sec
Warrior_Fury_1h_T14H heroic_leap 6544 1133886 92300 200393 9.0 31.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.05sec 366.00sec
Warrior_Fury_1h_T14H heroic_strike 78 3859487 49039 103825 59.4 29.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.96sec 366.00sec
Warrior_Fury_1h_T14H heroic_throw 57755 138171 12423 26330 8.4 28.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 37.65sec 366.00sec
Warrior_Fury_1h_T14H impending_victory 103840 212227 23274 49247 6.9 28.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.57sec 366.00sec
Warrior_Fury_1h_T14H impending_victory__heal 118340 0 0 0 6.9 23.5% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 41.57sec 366.00sec
Warrior_Fury_1h_T14H melee_main_hand 0 5351926 30261 62342 173.3 25.3% 18.8% 23.9% 0.0% 0.0 0 0 0.0% 0.0% 2.11sec 366.00sec
Warrior_Fury_1h_T14H melee_off_hand 0 4516312 25538 52624 173.3 25.3% 18.7% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.11sec 366.00sec
Warrior_Fury_1h_T14H raging_blow 85288 0 0 0 45.4 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.95sec 366.00sec
Warrior_Fury_1h_T14H raging_blow_mh 96103 3724455 61210 129352 45.4 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.95sec 366.00sec
Warrior_Fury_1h_T14H raging_blow_oh 85384 3144328 51616 109279 45.4 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.95sec 366.00sec
Warrior_Fury_1h_T14H recklessness 1719 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 151.87sec 366.00sec
Warrior_Fury_1h_T14H wild_strike 100130 2781362 45665 95758 46.6 27.9% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.08sec 366.00sec
Warrior_Fury_2h_T14H battle_shout 6673 0 0 0 4.1 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 72.47sec 366.00sec
Warrior_Fury_2h_T14H berserker_rage 18499 0 0 0 10.6 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 36.37sec 366.00sec
Warrior_Fury_2h_T14H bloodbath 12292 2259448 0 0 6.9 0.0% 0.0% 0.0% 0.0% 104.5 21617 0 0.0% 0.0% 60.56sec 366.00sec
Warrior_Fury_2h_T14H bloodthirst 23881 5274380 40791 86449 76.3 62.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.83sec 366.00sec
Warrior_Fury_2h_T14H bloodthirst_heal 23881 119632 1213 2427 76.3 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.83sec 366.00sec
Warrior_Fury_2h_T14H colossus_smash 86346 1189966 50579 106661 17.3 32.7% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 21.54sec 366.00sec
Warrior_Fury_2h_T14H deadly_calm 85730 0 0 0 6.2 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 60.75sec 366.00sec
Warrior_Fury_2h_T14H deep_wounds 115767 2987084 0 0 76.3 0.0% 0.0% 0.0% 0.0% 121.0 18371 37969 32.2% 0.0% 4.83sec 366.00sec
Warrior_Fury_2h_T14H dragon_roar 118000 1205492 0 218910 5.5 100.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 67.66sec 366.00sec
Warrior_Fury_2h_T14H execute 5308 7048290 210600 461105 23.4 36.3% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 2.87sec 366.00sec
Warrior_Fury_2h_T14H heroic_leap 6544 949745 75941 163544 9.0 33.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 43.08sec 366.00sec
Warrior_Fury_2h_T14H heroic_strike 78 3594394 44237 93079 60.3 31.4% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 4.89sec 366.00sec
Warrior_Fury_2h_T14H heroic_throw 57755 180518 15896 33486 8.4 32.2% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 38.25sec 366.00sec
Warrior_Fury_2h_T14H impending_victory 103840 271170 29737 62643 6.8 31.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.72sec 366.00sec
Warrior_Fury_2h_T14H impending_victory__heal 118340 0 0 0 6.8 25.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 42.72sec 366.00sec
Warrior_Fury_2h_T14H melee_main_hand 0 5042483 38620 79596 124.8 27.8% 18.9% 24.1% 0.0% 0.0 0 0 0.0% 0.0% 2.92sec 366.00sec
Warrior_Fury_2h_T14H melee_off_hand 0 3147922 24134 49748 124.8 27.8% 18.9% 24.0% 0.0% 0.0 0 0 0.0% 0.0% 2.92sec 366.00sec
Warrior_Fury_2h_T14H raging_blow 85288 0 0 0 47.9 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 366.00sec
Warrior_Fury_2h_T14H raging_blow_mh 96103 5073118 77552 163123 47.9 33.1% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 366.00sec
Warrior_Fury_2h_T14H raging_blow_oh 85384 3163335 48460 102014 47.9 32.8% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 7.49sec 366.00sec
Warrior_Fury_2h_T14H recklessness 1719 0 0 0 3.0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 151.89sec 366.00sec
Warrior_Fury_2h_T14H wild_strike 100130 2589790 43075 90262 45.0 30.6% 0.0% 0.0% 0.0% 0.0 0 0 0.0% 0.0% 6.24sec 366.00sec

Fluffy_Pillow : 898179 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active
898179.2 898179.2 74.49 / 0.01% 6198 / 0.7% -1.0 0.0 0.0 None 100.00% 0.2 100.0%

Charts

http://0.chart.apis.google.com/chart?chs=550x60&cht=bhg&chf=bg,s,333333&chd=t:8733&chds=0,17467&chco=C79C6E&chm=t++8733++melee_main_hand,C79C6E,0,0,15&chtt=Fluffy_Pillow Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:99,1&chds=0,100&chdls=ffffff&chco=9482C9,C79C6E&chl=raid_damage_shadow|melee_main_hand&chtt=Fluffy_Pillow Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x185&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=100,20&chd=s:JIQPONMLRQPPPPUUUPPPUUUOOORRRMMMOOOJJJMMMIIIKKKIIIKKKIIKKKKHKKKKKJJJJJLJJJJLIIIIKIIIIKIIIIKIIIIKIIIIKIIIIKIIIIKIIILLJJLLLJLLLLLLLLOLLLOMMMOMMMOMMMOMMMOLMLOLLLNLLLNLLLNLLLNLLNNLOOOOOORPPRRPRRRSSSSSSSSSSSSSSSSSSRRRRRRQQQQQQPPPPPPPPPPPRPRRSSUSUUVVXVXXXXaXaXaXaXaXaXaXaXaXaXaXaXZXZXZXZXZWZWZWYWYYaaddggjkmnqqtuxy11456777877777666554432211000zzzzzzzyyyyyyyyyzz00000111112&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=366|1:|0|avg=898179|max=2420124&chxp=1,1,37,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:3,6,3,15,23,51,51,95,146,166,242,301,357,421,425,492,547,589,615,599,573,578,476,460,475,376,342,299,252,203,169,155,108,84,83,53,36,39,28,12,16,7,3,7,4,3,4,1,2,1&chds=0,615&chbh=5&chxt=x&chxl=0:|min=886932|avg=898179|max=914823&chxp=0,1,40,100&chtt=Fluffy_Pillow DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:100.0&chds=0,100&chdls=ffffff&chco=ffffff&chl=waiting 366.0s&chtt=Fluffy_Pillow Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 898179
melee_main_hand 8686 1.0% 182.0 2.00sec 17467 8733 17467 0 17467 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee_main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 182.00 182.00 0.00 0.00 2.0000 0.0000 3178978.95 3178978.95 0.00 8733.46 8733.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.00 100.00% 17466.92 0 59609 17466.92 8900 24560 3178979 3178979 0.00
DPS Timeline Chart

Action details: melee_main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Healing Target
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.000000
  • base_dd_min:87529.00
  • base_dd_max:87529.00
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:1.00
raid_damage_shadow 889493 99.0% 7301.6 2.38sec 44587 0 44587 0 44587 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: raid_damage_shadow

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7301.64 7301.64 0.00 0.00 0.0000 0.0000 325554610.63 325554610.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7301.64 100.00% 44586.50 35156 44855 44586.50 44583 44591 325554611 325554611 0.00
DPS Timeline Chart

Action details: raid_damage_shadow

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Warlock_Destruction_T14H_terrorguard
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • direct_power_mod:0.000000
  • base_dd_min:44000.00
  • base_dd_max:44000.00

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
censure 1.0 251.8 1.2sec 1.4sec 99.66% 99.82%

Buff details

  • buff initial source:Paladin_Retribution_T14H
  • cooldown name:buff_censure
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • censure_1:0.4%
  • censure_2:0.7%
  • censure_3:0.5%
  • censure_4:0.2%
  • censure_5:97.8%

Spelldata details

  • id:31803
  • name:Censure
  • tooltip:Holy damage every $t1 sec.
  • description:Deals ${$m1*5} additional Holy damage over $31803d. Stacks up to $31803u times.
  • max_stacks:5
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
colossus_smash 25.6 3.3 14.4sec 12.7sec 45.97% 47.76%

Buff details

  • buff initial source:Warrior_Arms_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:46.0%
colossus_smash 17.3 0.0 21.5sec 21.5sec 28.07% 31.82%

Buff details

  • buff initial source:Warrior_Fury_1h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:28.1%
colossus_smash 17.3 0.0 21.5sec 21.5sec 28.06% 32.31%

Buff details

  • buff initial source:Warrior_Fury_2h_T14H
  • cooldown name:buff_colossus_smash
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • colossus_smash_1:28.1%
find_weakness 0.0 0.0 0.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Rogue_Subtlety_T14H
  • cooldown name:buff_find_weakness
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • find_weakness_1:0.0%

Spelldata details

  • id:91021
  • name:Find Weakness
  • tooltip:Armor $w1% less effective against the attacking Rogue.
  • description:Your Ambush, Garrote, and Cheap Shot abilities reveal a flaw in your target's defenses, causing all your attacks to bypass a portion of that enemy's armor for $91021d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
flying 1.0 0.0 0.0sec 0.0sec 100.00% 100.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_flying
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • flying_1:100.0%
frost_vulnerability 1.0 367.3 1.8sec 1.0sec 99.42% 99.78%

Buff details

  • buff initial source:Death_Knight_Frost_1h_T14H
  • cooldown name:buff_frost_vulnerability
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frost_vulnerability_1:0.4%
  • frost_vulnerability_2:0.2%
  • frost_vulnerability_3:0.2%
  • frost_vulnerability_4:0.1%
  • frost_vulnerability_5:98.4%

Spelldata details

  • id:51714
  • name:Frost Vulnerability
  • tooltip:Frost damage taken from the death knight's abilities increased by $s1%.
  • description:Imbues your rune weapon with the power of Frost. Your melee swings cause your target to take an additional $51714s1% damage from your Frost attacks for $51714d. This effect stacks up to 5 times.
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:1.01%
frostbolt 1.6 110.7 173.5sec 3.2sec 97.17% 96.10%

Buff details

  • buff initial source:Mage_Frost_T14H
  • cooldown name:buff_frostbolt
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-1.00

Stack Uptimes

  • frostbolt_1:0.7%
  • frostbolt_2:0.6%
  • frostbolt_3:95.9%

Spelldata details

  • id:116
  • name:Frostbolt
  • tooltip:$?$w1=0[][Movement slowed by $w1%. ]Damage taken from the mage's Frostbolt and Ice Lance, and the Mage's Water Elemental's Waterbolt increased by $w4%.
  • description:Launches a bolt of frost at the enemy, causing $s2 Frost damage and slowing movement speed by $s1% for $d. Also causes the target to take an additional $s4% damage from your Frostbolt and Ice Lance, and your Water Elemental's Waterbolt, stacking up to $u times.
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:1.01%
haunt 17.6 16.1 19.7sec 10.9sec 72.42% 74.30%

Buff details

  • buff initial source:Warlock_Affliction_T14H
  • cooldown name:buff_haunt
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • haunt_1:72.4%

Spelldata details

  • id:48181
  • name:Haunt
  • tooltip:Spell damage taken from the caster is increased by $s3%.
  • description:You send a ghostly soul into the target, dealing $s1 Shadow damage and increasing all damage done by your spells on the target by $s3% for $d.
  • max_stacks:
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
health_decade_0__10 1.0 0.0 0.0sec 0.0sec 9.97% 9.97%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_0__10
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_0__10_1:10.0%
health_decade_10__20 1.0 0.0 0.0sec 0.0sec 8.86% 8.86%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_10__20
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_10__20_1:8.9%
health_decade_20__30 1.0 0.0 0.0sec 0.0sec 11.33% 11.33%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_20__30
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_20__30_1:11.3%
health_decade_30__40 1.0 0.0 0.0sec 0.0sec 11.63% 11.63%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_30__40
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_30__40_1:11.6%
health_decade_40__50 1.0 0.0 0.0sec 0.0sec 10.16% 10.16%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_40__50
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_40__50_1:10.2%
health_decade_50__60 1.0 0.0 0.0sec 0.0sec 11.63% 11.63%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_50__60
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_50__60_1:11.6%
health_decade_60__70 1.0 0.0 0.0sec 0.0sec 11.64% 11.64%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_60__70
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_60__70_1:11.6%
health_decade_70__80 1.0 0.0 0.0sec 0.0sec 11.10% 11.10%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_70__80
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_70__80_1:11.1%
health_decade_80__90 1.0 0.0 0.0sec 0.0sec 8.26% 8.26%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_80__90
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_80__90_1:8.3%
health_decade_90__100 1.0 0.0 0.0sec 0.0sec 5.42% 5.42%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_health_decade_90__100
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • health_decade_90__100_1:5.4%
pyromaniac 6.0 20.5 61.2sec 13.9sec 95.87% 96.52%

Buff details

  • buff initial source:Mage_Fire_T14H
  • cooldown name:buff_pyromaniac
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • pyromaniac_1:95.9%

Spelldata details

  • id:132209
  • name:Pyromaniac
  • tooltip:(null)
  • description:Your Nether Tempest, Living Bomb, and Frost Bomb spells now also apply the Pyromaniac effect. $@spellname132210 $@spelldesc132210
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
rising_sun_kick 1.0 38.8 224.2sec 9.3sec 99.43% 99.39%

Buff details

  • buff initial source:Monk_Windwalker_1h_T14H
  • cooldown name:buff_rising_sun_kick
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • rising_sun_kick_1:99.4%

Spelldata details

  • id:130320
  • name:Rising Sun Kick
  • tooltip:Damage taken from abilities dealt by the Monk increased $w1%.
  • description:$@spelldesc107428
  • max_stacks:
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
stormstrike 1.0 40.0 195.1sec 8.9sec 98.97% 99.36%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_stormstrike
  • max_stacks:1
  • duration:15.00
  • cooldown:8.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • stormstrike_1:99.0%

Spelldata details

  • id:17364
  • name:Stormstrike
  • tooltip:Chance to be critically struck by the Shaman's Nature spells increased by $s1%.
  • description:Instantly strike an enemy with both weapons, dealing $32175s1% weapon damage and granting you an additional $17364s1% chance to critically strike that enemy with your Lightning Bolt, Chain Lightning, Lightning Shield, and Earth Shock spells for $17364d.
  • max_stacks:
  • duration:15.00
  • cooldown:8.00
  • default_chance:1.00%
unleashed_fury_ft 23.8 7.2 15.8sec 12.0sec 63.87% 66.49%

Buff details

  • buff initial source:Shaman_Enhancement_T14H
  • cooldown name:buff_unleashed_fury_ft
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • unleashed_fury_ft_1:63.9%

Spelldata details

  • id:118470
  • name:Unleashed Fury
  • tooltip:Increases damage taken from the Shaman's Lightning Bolt by $s1%.
  • description:Increases the enemy target's damage taken from your Lightning Bolt by $s1% for $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
vendetta 3.5 0.0 120.5sec 120.5sec 24.67% 26.57%

Buff details

  • buff initial source:Rogue_Assassination_T14H
  • cooldown name:buff_vendetta
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • vendetta_1:24.7%

Spelldata details

  • id:79140
  • name:Vendetta
  • tooltip:Marked for death.
  • description:Marks an enemy for death, increasing all damage you deal to the target by $s1% and granting you unerring vision of your target, regardless of concealments such as stealth and invisibility. Lasts $d.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
attack_haste

Buff details

  • buff initial source:
  • cooldown name:buff_attack_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_haste_1:100.0%
attack_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_attack_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • attack_power_multiplier_1:100.0%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00

Stack Uptimes

  • bleeding_1:100.0%
critical_strike

Buff details

  • buff initial source:
  • cooldown name:buff_critical_strike
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • critical_strike_1:100.0%
magic_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_magic_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • magic_vulnerability_1:100.0%

Spelldata details

  • id:104225
  • name:Curse of the Elements
  • tooltip:Increases magic damage taken by $s1%.
  • description:$@spelldesc1490
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
mastery

Buff details

  • buff initial source:
  • cooldown name:buff_mastery
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:5.00

Stack Uptimes

  • mastery_1:100.0%
mortal_wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.0%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for $115804d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
physical_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_physical_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.04

Stack Uptimes

  • physical_vulnerability_1:100.0%

Spelldata details

  • id:81326
  • name:Physical Vulnerability
  • tooltip:Increases physical damage taken by $s1%.
  • description:Weakens the constitution of an enemy target, increasing their physical damage taken by $81326s1% for $81326d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
ranged_vulnerability

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_ranged_vulnerability
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • ranged_vulnerability_1:100.0%

Spelldata details

  • id:1130
  • name:Hunter's Mark
  • tooltip:All attackers gain $s2% increased ranged damage against this target. Can be seen while stealthed or invisible.
  • description:Places the Hunter's Mark on the target, increasing the ranged damage of all attackers against that target by $s2%. In addition, the target of this ability can always be seen by the Hunter whether it stealths or turns invisible. The target also appears on the mini-map. Lasts for $d.
  • max_stacks:
  • duration:300.00
  • cooldown:0.00
  • default_chance:0.00%
slowed_casting

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_slowed_casting
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • slowed_casting_1:100.0%

Spelldata details

  • id:73975
  • name:Necrotic Strike
  • tooltip:The next $w1 healing received will be absorbed. Spell casting slowed by $s3%.
  • description:A vicious strike that deals $m2% weapon damage, absorbs the next ${$m1/100*$AP} healing received by the target, and clouds the target's mind, slowing their casting speed by $s3% (25% on player targets). Lasts $d.
  • max_stacks:
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
spell_haste

Buff details

  • buff initial source:
  • cooldown name:buff_spell_haste
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • spell_haste_1:100.0%
spell_power_multiplier

Buff details

  • buff initial source:
  • cooldown name:buff_spell_power_multiplier
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • spell_power_multiplier_1:100.0%
stamina

Buff details

  • buff initial source:
  • cooldown name:buff_stamina
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • stamina_1:100.0%
str_agi_int

Buff details

  • buff initial source:
  • cooldown name:buff_str_agi_int
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05

Stack Uptimes

  • str_agi_int_1:100.0%
weakened_armor

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_armor
  • max_stacks:3
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.04

Stack Uptimes

  • weakened_armor_3:100.0%

Spelldata details

  • id:113746
  • name:Weakened Armor
  • tooltip:Armor decreased by $s1%.
  • description:Weakens the armor of the target by $113746s1% for $113746d. Stacks up to $113746u times.
  • max_stacks:3
  • duration:30.00
  • cooldown:0.00
  • default_chance:1.01%
weakened_blows

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_weakened_blows
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • weakened_blows_1:100.0%

Spelldata details

  • id:115798
  • name:Weakened Blows
  • tooltip:Reduces physical damage dealt by $s1%.
  • description:Demoralizes the target, reducing their physical damage dealt by $115798s1% for $115798d.
  • max_stacks:
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 2749323.88
Combat End Resource Mean Min Max
Health 3359892.72 0.00 19839671.96
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
combo_points 55.4 9.3sec
combo_points_wasted 1.0 96.5sec
Rogue_Subtlety_T14H: combo_points 390.8 1.1sec
Rogue_Subtlety_T14H: anticipation_charges 18.9 18.4sec
Rogue_Assassination_T14H: combo_points 268.5 2.7sec
Rogue_Assassination_T14H: anticipation_charges 20.6 20.4sec
Rogue_Assassination_T14H: anticipation_charges_wasted 0.0 10.4sec
Rogue_Combat_T14H: combo_points 249.7 2.1sec
Rogue_Combat_T14H: anticipation_charges 112.9 4.2sec
Rogue_Combat_T14H: anticipation_charges_wasted 4.3 71.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 9996
Mean 366.00
Minimum 366.00
Maximum 366.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

DPS

Sample Data
Count 9996
Mean 898179.21
Minimum 886932.01
Maximum 914823.34
Spread ( max - min ) 27891.33
Range [ ( max - min ) / 2 * 100% ] 1.55%
Standard Deviation 3799.8222
5th Percentile 892327.82
95th Percentile 904723.57
( 95th Percentile - 5th Percentile ) 12395.75
Mean Distribution
Standard Deviation 38.0058
95.00% Confidence Intervall ( 898104.72 - 898253.70 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 68
0.1 Scale Factor Error with Delta=300 123256
0.05 Scale Factor Error with Delta=300 493026
0.01 Scale Factor Error with Delta=300 12325660
Distribution Chart

DPS(e)

Sample Data
Count 9996
Mean 898179.21

Damage

Sample Data
Count 9996
Mean 328733589.57

DTPS

Sample Data
Count 9996
Mean 2759869.86

HPS

Sample Data
Count 9996
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 9996
Mean 0.00

Heal

Sample Data
Count 9996
Mean 0.00

HTPS

Sample Data
Count 9996
Mean 0.00

#Executed Foreground Actions

Sample Data
Count 9996
Mean 1.00
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats
Default action list
# count action,conditions
1 1.00 auto_attack,damage=87529,attack_speed=2.0,target=Healing Target

Sample Sequence

1

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1011332653 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -1.#J% -1.#J% 0
Spell Haste 0.00% 0.00% 0
Mana Per 5 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit -1.#J% -1.#J% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
origin="unknown"
level=93
race=humanoid
spec=unknown
role=tank
position=back

actions.precombat=snapshot_stats

actions=auto_attack,damage=87529,attack_speed=2.0,target=Healing Target


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%%

Percentage of executes that resulted in critical strikes.

Dodge%%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%%

Percentage of executes that resulted in glancing blows.

G%%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

DPS gain per unit stat increase except for Hit/Expertise which represent DPS loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 366.00
Vary Combat Length: 0.00

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.