close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 3.37 - 2.81 - - - 2.26 - 1.45 1.37 1.33 - - - - - - wowhead lootrank
priest_90_di_mb - - - 3.49 - 2.74 - - - 2.15 - 1.48 1.41 1.40 - - - - - - wowhead lootrank
priest_90_di_swi - - - 3.35 - 2.63 - - - 2.31 - 1.40 1.33 1.53 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 3.45 - 2.74 - - - 2.24 - 1.47 1.23 1.41 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 3.37 - 2.74 - - - 2.35 - 1.36 0.47 1.27 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 3.33 - 2.69 - - - 2.22 - 1.46 0.90 1.53 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 3.43 - 2.74 - - - 2.24 - 1.50 1.26 1.54 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 3.48 - 2.80 - - - 2.04 - 1.46 1.09 1.36 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 3.29 - 2.74 - - - 1.95 - 1.47 1.01 1.67 - - - - - - wowhead lootrank

priest_90_di_fdcl : 90500 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
90500.2 90500.2 19.48 / 0.02% 3633 / 4.0% 18.9 4595.3 4258.6 Mana 0.58% 38.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.37 0.00 2.81 2.26 1.45 1.37 1.33
Normalized 1.00 0.00 0.83 0.67 0.43 0.41 0.39
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Haste > Mastery
Pawn string
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.37, SpellDamage=2.81, HitRating=2.26, CritRating=1.45, HasteRating=1.37, MasteryRating=1.33 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=3.37, SpellDamage=2.81, HitRating=0.00, CritRating=1.45, HasteRating=1.37, MasteryRating=1.33 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:300862|160803|115232|98052|91637|89074|77557|45801&chds=0,601723&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++300862++devouring_plague,9482C9,0,0,15|t++160803++vampiric_touch,9482C9,1,0,15|t++115232++halo,9482C9,2,0,15|t++98052++shadow_word_pain,9482C9,3,0,15|t++91637++shadow_word_death,9482C9,4,0,15|t++89074++mind_blast,9482C9,5,0,15|t++77557++mind_spike,4A79D3,6,0,15|t++45801++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,11,9,9,8,7,5,4,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.37,2.81,2.26,1.45,1.37,1.33|3.34,2.78,2.23,1.42,1.34,1.30|3.40,2.84,2.28,1.48,1.39,1.35&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.37++Int,FFFFFF,0,0,15,0.1,e|t++++2.81++SP,FFFFFF,0,1,15,0.1,e|t++++2.26++Hit,FFFFFF,0,2,15,0.1,e|t++++1.45++Crit,FFFFFF,0,3,15,0.1,e|t++++1.37++Haste,FFFFFF,0,4,15,0.1,e|t++++1.33++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.054&chtt=Scale Factors|priest_90_di_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6877655555536755645520yxwvwvvuutsssssrrqqqqqqqqqponmmmljjiiiiiiiihhhhhhijjjklllllkjjihiiiiiiiiihhhhhhhiijjkkkljhgggffggggghhhggghgghjjkkllkkkjiihgihiiiiiiiiijjkklllmmmmmmkjijklllllmmnoonnnnnnopqpoooooonmkjjkkkllllllllllllkkllmmmmmkihgffeeeefffffeefffegijjjklmmlkjjiijiiiiiiihhhhhhhijjjkkkjjihhhihhhhhhhhhhhhhhhhjkkjjklllllllllmmmmnnnnnnnnooopppppqpppomkjkkllmmnoprrrrssrrtvwxwwvvuusrpomnmmmmmmmmmmmnnnnoppqqrrrqoppqppppppppppooooooprrqqrrttttttuuvvwwxxxxxxxxxxxxyyxxxxwwtrqponnmmllllllllmmmmorsstuuvvvwvvvvvvvuuuuuuttttttttuuuuuttsqqqqqsstuvvwwxwvvwwwy001210&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6513,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=90500|max=138961&chxp=1,1,65,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,8,8,8,0,16,24,24,40,96,192,208,376,424,936,1016,1240,1576,1920,2256,2760,2688,3288,3064,3512,2944,3096,2976,2584,2424,2184,1672,1464,1200,1080,648,520,456,344,224,120,112,88,40,40,32,8,40&chds=0,3512&chbh=5&chxt=x&chxl=0:|min=80751|avg=90500|max=98805&chxp=0,1,54,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:40.6,13.4,13.1,9.0,6.1,5.2,4.1,2.9,0.5,0.0,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 183.6s|mind_blast 60.7s|shadow_word_pain 59.2s|mind_spike 40.6s|vampiric_touch 27.8s|devouring_plague 23.5s|shadow_word_death 18.3s|halo 13.3s|shadowfiend 2.5s|dispersion 0.0s|waiting 2.6s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 90500
devouring_plague 5954 (15652) 6.6% (17.3%) 19.7 23.63sec 358679 300862 112347 232475 136364 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.71 19.71 0.00 0.00 1.1922 0.0000 2687611.75 2687611.75 0.00 300861.66 300861.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.77 80.01% 112347.05 102399 137090 112380.03 105804 118582 1771628 1771628 0.00
crit 3.94 19.99% 232474.88 210941 282405 228966.35 0 282405 915984 915984 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2309 2.6% 46.4 9.19sec 22485 0 18587 38456 22520 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.38 46.31 0.00 0.00 0.0000 0.0000 1042908.51 1042908.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.14 80.21% 18587.40 17006 22766 18590.82 17646 19855 690400 690400 0.00
crit 9.17 19.79% 38455.95 35032 46897 38462.09 0 44643 352509 352509 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7388 8.2% 19.7 23.63sec 169403 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.4 18558 38429 22499 19.8% 0.0% 24.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.71 19.71 148.40 148.40 0.0000 0.7558 3338826.26 3338826.26 0.00 29770.28 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.0 80.17% 18557.73 17006 29577 18561.30 17668 19498 2207728 2207728 0.00
crit 29.4 19.83% 38428.97 35032 57319 38435.76 35874 41766 1131098 1131098 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3401) 0.0% (3.8%) 11.3 41.42sec 135941 115232 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 1.1797 0.0000 0.00 0.00 0.00 115231.54 115231.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.05 80.20% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.24 19.80% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3401 3.8% 11.3 41.42sec 135941 0 112007 231657 135937 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 0.0000 0.0000 1534307.97 1534307.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 80.00% 112007.35 104363 133162 112000.68 105214 120186 1011310 1011310 0.00
crit 2.26 20.00% 231656.64 214987 274315 213435.25 0 274315 522998 522998 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.42sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.29 123.06 0.00 0.00 0.0000 0.0000 0.00 23956830.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.87 77.09% 0.00 0 0 0.00 0 0 0 14839403 100.00
crit 28.19 22.91% 0.00 0 0 0.00 0 0 0 9117427 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11970 13.2% 49.6 9.06sec 108958 89074 89846 186102 108958 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.59 49.59 0.00 0.00 1.2232 0.0000 5403698.39 5403698.39 0.00 89074.40 89074.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.75 80.14% 89845.93 82079 110390 89865.81 86655 93685 3571148 3571148 0.00
crit 9.85 19.86% 186102.00 169082 227403 186146.81 169082 213375 1832551 1832551 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14190 (18641) 15.7% (20.6%) 108.8 4.06sec 77253 45801 0 0 0 0.0% 0.0% 0.0% 0.0% 220.2 23962 49654 29072 19.9% 0.0% 36.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.84 108.84 220.17 220.17 1.6867 0.7407 6400986.35 6400986.35 0.00 45801.38 45801.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.4 80.11% 23962.46 21797 29181 23969.21 23383 24817 4226609 4226609 0.00
crit 43.8 19.89% 49654.09 44901 60113 49669.97 47220 52419 2174377 2174377 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4450 4.9% 68.9 6.33sec 29124 0 23956 49670 29139 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.92 68.89 0.00 0.00 0.0000 0.0000 2007322.73 2007322.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.00 79.85% 23956.40 21797 29181 23963.68 22917 25426 1317712 1317712 0.00
crit 13.88 20.15% 49669.52 44901 60113 49693.24 45987 56842 689611 689611 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6980 7.7% 34.4 12.55sec 91592 77557 75556 156422 91592 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.39 34.39 0.00 0.00 1.1810 0.0000 3149757.06 3149757.06 0.00 77557.30 77557.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.57 80.17% 75556.24 68964 93036 75563.85 71708 80407 2083062 2083062 0.00
crit 6.82 19.83% 156422.43 142066 191655 156030.57 0 191655 1066695 1066695 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3704 4.1% 15.3 4.93sec 109529 91637 89946 186370 109529 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.32 15.32 0.00 0.00 1.1953 0.0000 1677697.09 1677697.09 0.00 91637.38 91637.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.21 79.69% 89945.69 79678 107383 90041.51 82061 98617 1097915 1097915 0.00
crit 3.11 20.31% 186370.11 164137 221210 179942.17 0 221210 579782 579782 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9788 (12851) 10.8% (14.2%) 50.1 8.97sec 115905 98052 0 0 0 0.0% 0.0% 0.0% 0.0% 241.1 13909 28746 18334 29.8% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.07 50.07 241.09 241.09 1.1821 1.8044 4420334.76 4420334.76 0.00 11742.04 98052.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.07 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.2 70.17% 13908.83 12783 17110 13910.14 13394 14419 2353087 2353087 0.00
crit 71.9 29.83% 28745.76 26333 35247 28748.20 27663 30006 2067247 2067247 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3063 3.4% 75.3 5.92sec 18367 0 13944 28830 18383 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.29 75.22 0.00 0.00 0.0000 0.0000 1382780.02 1382780.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.79 70.18% 13944.35 12783 17110 13946.71 13474 14640 736126 736126 0.00
crit 22.43 29.82% 28830.15 26333 35247 28833.79 26491 31003 646654 646654 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2186 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3724 4.1% 81.8 5.46sec 20555 0 17396 34965 20896 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.84 80.51 0.00 0.00 0.0000 0.0000 1682257.82 1682257.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.47 80.08% 17396.30 15875 21413 17398.53 16824 18115 1121508 1121508 0.00
crit 16.04 19.92% 34965.45 31750 42826 34970.93 32371 38922 560750 560750 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7531 (9886) 8.3% (10.9%) 23.0 19.66sec 193631 160803 0 0 0 0.0% 0.0% 0.0% 0.0% 178.7 15687 32484 19021 19.9% 0.0% 87.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.05 23.05 178.70 178.70 1.2042 2.2216 3399164.91 3399164.91 0.00 10505.60 160803.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.2 80.15% 15686.71 14287 19397 15689.36 15191 16254 2246719 2246719 0.00
crit 35.5 19.85% 32484.24 29431 39957 32488.66 30503 35208 1152446 1152446 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2355 2.6% 55.9 7.83sec 19008 0 15689 32490 19023 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.93 55.89 0.00 0.00 0.0000 0.0000 1063122.31 1063122.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.80 80.16% 15688.69 14287 19397 15691.75 14920 16454 702806 702806 0.00
crit 11.09 19.84% 32489.99 29431 39957 32491.97 29431 36651 360316 360316 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46422 / 3692
melee 46422 4.0% 31.3 12.68sec 52615 51738 45898 92770 52616 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.32 31.32 0.00 0.00 1.0170 0.0000 1647803.72 1647803.72 0.00 51738.00 51738.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.48 55.83% 45897.52 36329 55931 45905.97 41229 51573 802458 802458 0.00
crit 6.31 20.16% 92770.07 72658 111863 92721.93 0 111863 585600 585600 0.00
glance 7.52 24.02% 34531.55 27247 41949 34533.62 0 41949 259746 259746 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.60sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.1969 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.35%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.1 0.6 27.8sec 26.7sec 5.29% 28.46%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.29%

Trigger Attempt Success

  • trigger_pct:4.97%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.00% 20.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.00%

    Trigger Attempt Success

    • trigger_pct:16.39%
glyph_mind_spike 25.2 9.2 17.3sec 12.6sec 32.10% 47.97%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:25.63%
  • glyph_mind_spike_2:6.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.60% 43.95%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.60%

    Trigger Attempt Success

    • trigger_pct:2.32%
light_of_the_cosmos 9.5 0.0 49.2sec 49.2sec 41.25% 41.25%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.25%

    Trigger Attempt Success

    • trigger_pct:14.99%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.85% 49.41%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 30.1 5.1 14.5sec 12.3sec 18.86% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.29%
  • surge_of_darkness_2:1.56%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.19% 14.19%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.6sec 74.6sec 83.39% 77.57%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.68% 5.68%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.68%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl
devouring_plague Shadow Orb 19.7 59.1 3.0 3.0 119557.5
halo Mana 11.3 457105.7 40500.0 40499.8 3.4
mind_blast Mana 49.6 304201.4 6133.7 6133.8 17.8
mind_flay Mana 108.8 326522.4 3000.0 3000.0 25.8
shadow_word_death Mana 15.3 119478.5 7800.0 7800.2 14.0
shadow_word_pain Mana 50.1 660880.7 13200.0 13199.7 8.8
vampiric_touch Mana 23.0 207406.1 9000.0 8999.9 21.5
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.00 86.40 (0.00%) 18000.00 0.00 0.00%
shadowfiend Mana 31.32 239863.92 (12.47%) 7658.96 41998.80 14.90%
Shadow Orbs from Mind Blast Shadow Orb 49.60 49.60 (86.48%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.75 7.75 (13.52%) 1.00 0.00 0.00%
Devouring Plague Health Health 194.71 0.00 (-nan%) 0.00 2703925.16 100.00%
Vampiric Touch Mana Mana 234.59 1166165.04 (60.63%) 4971.12 73701.84 5.94%
mp5_regen Mana 1806.22 517392.72 (26.90%) 286.45 24472.85 4.52%
Resource RPS-Gain RPS-Loss
Mana 4258.57 4595.28
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 147904.85 0.00 300000.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.6%
shadowfiend-Mana Cap 4.6%
lightwell-Mana Cap 4.6%

Procs

Count Interval
Shadowy Recall Extra Tick 246.3 1.8sec
Shadowy Apparition Procced 81.8 5.5sec
Divine Insight Mind Blast CD Reset 27.7 26.7sec
FDCL Mind Spike proc 35.2 12.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl Damage Per Second
Count 49992
Mean 90500.20
Minimum 80751.32
Maximum 98805.26
Spread ( max - min ) 18053.93
Range [ ( max - min ) / 2 * 100% ] 9.97%
Standard Deviation 2222.5230
5th Percentile 86927.49
95th Percentile 94193.02
( 95th Percentile - 5th Percentile ) 7265.53
Mean Distribution
Standard Deviation 9.9402
95.00% Confidence Intervall ( 90480.72 - 90519.68 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2316
0.1 Scale Factor Error with Delta=300 42167
0.05 Scale Factor Error with Delta=300 168669
0.01 Scale Factor Error with Delta=300 4216733
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 90500.20
Distribution Chart

Damage

Sample Data
Count 49992
Mean 39190775.93
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 291.50
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.85 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.32 shadow_word_death,if=active_enemies<=5
F 52.57 mind_blast,if=active_enemies<=6&cooldown_react
G 19.04 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 24.82 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.39 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.29 halo,if=talent.halo.enabled
M 14.86 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.28 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 16.89 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 30.99 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.17 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 31.03 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGLWFHQQFTRTFMTHTFGRTWWWWWFTHRTFLRTRQFGMTHRWWWFTFRRRHTQFMTGLTFWWWWTHFTFTTFMJRGHTFGRWHTLFTTQFMTHRGFTFWWFMJRTFHRTLFTGTFBWWFHMTRFTFGHRTLWWWFMTFHHTQFTGTGWWFHMTLTFTRTHFGTWWWWFMTRTHFHRTLJFGRTWWWFHJMRTFTFGHTWWWLFMTFHRRTFGTBGWFHTLEDEFTHGEEFRWFMTEETFTHHEDEQFGTLEER9WRFDEEHTQFTEETFGMREEHW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb : 91990 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
91989.7 91989.7 17.43 / 0.02% 3274 / 3.6% 17.2 4786.9 4543.2 Mana 0.47% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.49 0.00 2.74 2.15 1.48 1.41 1.40
Normalized 1.00 0.00 0.79 0.62 0.42 0.40 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.02 0.03 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Haste = Mastery
Pawn string
  • ( Pawn: v1: "priest_90_di_mb": Intellect=3.49, SpellDamage=2.74, HitRating=2.15, CritRating=1.48, HasteRating=1.41, MasteryRating=1.40 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_mb": Intellect=3.49, SpellDamage=2.74, HitRating=0.00, CritRating=1.48, HasteRating=1.41, MasteryRating=1.40 )

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:300229|159078|115073|91547|90908|88531|46469&chds=0,600459&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++300229++devouring_plague,9482C9,0,0,15|t++159078++vampiric_touch,9482C9,1,0,15|t++115073++halo,9482C9,2,0,15|t++91547++shadow_word_death,9482C9,3,0,15|t++90908++shadow_word_pain,9482C9,4,0,15|t++88531++mind_blast,9482C9,5,0,15|t++46469++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,14,12,12,9,9,7,6,5,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.49,2.74,2.15,1.48,1.41,1.40|3.47,2.72,2.13,1.46,1.38,1.37|3.52,2.77,2.18,1.51,1.43,1.42&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.49++Int,FFFFFF,0,0,15,0.1,e|t++++2.74++SP,FFFFFF,0,1,15,0.1,e|t++++2.15++Hit,FFFFFF,0,2,15,0.1,e|t++++1.48++Crit,FFFFFF,0,3,15,0.1,e|t++++1.41++Haste,FFFFFF,0,4,15,0.1,e|t++++1.40++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.199&chtt=Scale Factors|priest_90_di_mb%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:02467655555468667566420xvstttsrqpqqppoonnnnnooonnmkjijihijjkllnnoopppppqrssrsrrqpnmkjhhggggggggfffefffghhiiijjhgeeeeghijklmnoopppppqsttttsqpomljighggggggggfgghiiijjkklkkkjhhghhhhhhhijjkkllmmmnopppppppponmlkkkjjjjjjjiijjjjijjjkkkkkigfeddeeefgijjlklmnnnprssttttsrpnmljjiihgggffefefffghhhiiiiihgfffffgghijkkllmnopprssstttttsrqpononmmlllllkkllmmnnnnooooomkjihggghiijkkllmnoppstuvvxxyxvvtsqpoonmllklkkkklllmnnoopqqqpnononnnnoopqqrqsstuvxyzzz001100zyyxyxxxwwvvvuuuvvvvwwwvwvvusponmllkjkklmmnnpqrstwz001234433210zzyxwvuttssssssssssttttttrqqqqpqpppqqrrrqsrrrrtuuuuvv&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6596,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=91990|max=139472&chxp=1,1,66,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,48,88,48,112,176,136,320,448,504,696,928,1320,1304,1408,1776,1936,2072,2272,2440,2400,2520,2296,2704,2640,2608,2424,2064,2064,1752,1656,1272,1040,880,752,616,520,432,304,248,208,200,136,72,48,24,8,8,32&chds=0,2704&chbh=5&chxt=x&chxl=0:|min=85688|avg=91990|max=98900&chxp=0,1,48,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.4,14.4,12.9,6.1,5.0,4.0,2.9,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 214.0s|shadow_word_pain 65.1s|mind_blast 58.4s|vampiric_touch 27.7s|devouring_plague 22.6s|shadow_word_death 18.2s|halo 13.3s|mindbender 8.3s|waiting 2.1s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 91990
devouring_plague 5735 (15046) 6.2% (16.4%) 19.0 24.57sec 358017 300229 112422 232617 136399 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.99 0.00 0.00 1.1925 0.0000 2589848.62 2589848.62 0.00 300229.42 300229.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.20 80.05% 112421.68 102399 137090 112455.13 104991 120312 1708772 1708772 0.00
crit 3.79 19.95% 232616.59 210941 282405 228512.75 0 282405 881077 881077 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2217 2.4% 44.5 9.58sec 22535 0 18597 38509 22567 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.45 44.39 0.00 0.00 0.0000 0.0000 1001786.89 1001786.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.54 80.06% 18596.97 17006 22766 18600.78 17664 19621 660969 660969 0.00
crit 8.85 19.94% 38508.92 35032 46897 38512.62 35032 44793 340818 340818 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7094 7.7% 19.0 24.57sec 168858 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.5 18571 38443 22505 19.8% 0.0% 23.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.99 142.46 142.46 0.0000 0.7559 3206158.91 3206158.91 0.00 29772.94 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.3 80.20% 18570.65 17006 32544 18574.21 17664 19864 2121731 2121731 0.00
crit 28.2 19.80% 38443.09 35032 67041 38448.37 35919 41718 1084428 1084428 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3396) 0.0% (3.7%) 11.3 41.46sec 135790 115073 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 1.1801 0.0000 0.00 0.00 0.00 115072.66 115072.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.04 80.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.26 19.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3396 3.7% 11.3 41.46sec 135790 0 112010 231665 135788 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 0.0000 0.0000 1533113.09 1533113.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.05 80.13% 112009.60 104363 133162 111998.04 104363 118762 1013287 1013287 0.00
crit 2.24 19.87% 231665.40 214987 274315 211415.21 0 274315 519826 519826 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.46sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.29 123.05 0.00 0.00 0.0000 0.0000 0.00 23949800.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.87 77.10% 0.00 0 0 0.00 0 0 0 14837731 100.00
crit 28.18 22.90% 0.00 0 0 0.00 0 0 0 9112069 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11445 12.4% 47.5 9.47sec 108850 88531 89840 186094 108851 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.48 47.48 0.00 0.00 1.2295 0.0000 5168628.27 5168628.27 0.00 88531.20 88531.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.11 80.25% 89840.08 82079 110390 89858.77 86295 93440 3423436 3423436 0.00
crit 9.38 19.75% 186094.47 169082 227403 186157.50 169082 209691 1745193 1745193 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16802 (22059) 18.2% (24.0%) 124.7 3.55sec 79766 46469 0 0 0 0.0% 0.0% 0.0% 0.0% 260.5 23959 49654 29086 20.0% 0.0% 42.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.69 124.69 260.47 260.47 1.7166 0.7406 7576012.50 7576012.50 0.00 46468.59 46468.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.5 80.05% 23959.04 21797 29181 23964.84 23299 24611 4995241 4995241 0.00
crit 52.0 19.95% 49653.52 44901 60113 49666.37 47791 52280 2580771 2580771 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5257 5.7% 81.6 5.36sec 29047 0 23952 49622 29062 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.58 81.54 0.00 0.00 0.0000 0.0000 2369799.17 2369799.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.31 80.09% 23951.76 21797 29181 23957.13 23026 25023 1564322 1564322 0.00
crit 16.23 19.91% 49622.16 44901 60113 49632.06 45441 55512 805477 805477 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1968 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3677 4.0% 15.2 4.96sec 109442 91547 89933 186629 109443 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.22 15.22 0.00 0.00 1.1955 0.0000 1665520.17 1665520.17 0.00 91547.31 91547.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.15 79.83% 89933.42 79678 107383 90022.00 83141 99713 1092515 1092515 0.00
crit 3.07 20.17% 186629.48 164137 221210 180157.65 0 221210 573005 573005 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9976 (13100) 10.9% (14.2%) 55.0 8.15sec 107558 90908 0 0 0 0.0% 0.0% 0.0% 0.0% 245.8 13905 28749 18328 29.8% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.01 55.01 245.83 245.83 1.1832 1.7680 4505648.72 4505648.72 0.00 11839.20 90907.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.6 70.20% 13905.12 12783 17110 13906.05 13475 14385 2399754 2399754 0.00
crit 73.3 29.80% 28748.65 26333 35247 28749.16 27485 29914 2105895 2105895 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3124 3.4% 76.9 5.80sec 18346 0 13940 28837 18362 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.89 76.82 0.00 0.00 0.0000 0.0000 1410623.76 1410623.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.02 70.32% 13940.24 12783 17110 13942.59 13423 14601 753041 753041 0.00
crit 22.80 29.68% 28836.79 26333 35247 28841.60 27256 30698 657582 657582 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3759 4.1% 82.7 5.41sec 20539 0 17402 34983 20891 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.66 81.27 0.00 0.00 0.0000 0.0000 1697761.52 1697761.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.14 80.16% 17401.90 15875 21413 17404.52 16820 17996 1133579 1133579 0.00
crit 16.13 19.84% 34983.48 31750 42826 34990.51 32387 38101 564183 564183 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7450 (9778) 8.1% (10.6%) 22.9 19.84sec 193146 159078 0 0 0 0.0% 0.0% 0.0% 0.0% 176.8 15688 32490 19022 19.8% 0.0% 86.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.85 22.85 176.79 176.79 1.2142 2.2197 3362839.43 3362839.43 0.00 10504.54 159078.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.7 80.16% 15687.89 14287 19397 15690.02 15172 16288 2223147 2223147 0.00
crit 35.1 19.84% 32489.73 29431 39957 32492.24 30441 35034 1139693 1139693 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2328 2.5% 55.3 7.92sec 19008 0 15691 32503 19024 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.28 55.23 0.00 0.00 0.0000 0.0000 1050780.82 1050780.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.28 80.17% 15691.17 14287 19397 15694.24 15004 16627 694850 694850 0.00
crit 10.95 19.83% 32503.30 29431 39957 32512.12 29431 38137 355930 355930 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37573 / 9730
melee 37573 10.6% 105.4 4.17sec 41614 39051 36382 73295 41613 20.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.36 105.36 0.00 0.00 1.0656 0.0000 4384581.48 4384581.48 0.00 39051.12 39051.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.97 55.97% 36382.00 29063 44745 36399.71 34447 38650 2145506 2145506 0.00
crit 21.12 20.05% 73295.36 58126 89490 73321.09 67749 82392 1548304 1548304 0.00
glance 25.27 23.98% 27337.56 21797 33559 27350.91 25116 29490 690772 690772 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 0.00 0.00 1.1903 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.35%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.4 0.7 27.6sec 26.3sec 6.04% 29.84%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:6.04%

Trigger Attempt Success

  • trigger_pct:4.98%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.00% 20.00%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.00%

    Trigger Attempt Success

    • trigger_pct:16.33%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.63% 44.01%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.63%

    Trigger Attempt Success

    • trigger_pct:2.32%
light_of_the_cosmos 9.5 0.0 49.1sec 49.1sec 41.36% 41.36%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.36%

    Trigger Attempt Success

    • trigger_pct:14.98%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.3sec 10.3sec 9.78% 49.40%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb
devouring_plague Shadow Orb 19.0 57.0 3.0 3.0 119338.9
halo Mana 11.3 457254.7 40500.0 40499.8 3.4
mind_blast Mana 47.5 280372.3 5904.6 5904.6 18.4
mind_flay Mana 124.7 374061.6 3000.0 3000.0 26.6
shadow_word_death Mana 15.2 118706.0 7800.0 7800.2 14.0
shadow_word_pain Mana 55.0 726073.9 13200.0 13200.0 8.1
vampiric_touch Mana 22.9 205660.8 9000.0 9000.0 21.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.36 415323.29 (20.24%) 3941.77 46274.18 10.02%
Shadow Orbs from Mind Blast Shadow Orb 47.48 47.48 (86.05%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.70 7.70 (13.95%) 1.00 0.00 0.00%
Devouring Plague Health Health 186.85 0.00 (-nan%) 0.00 2594747.52 100.00%
Vampiric Touch Mana Mana 232.02 1129719.34 (55.05%) 4869.00 96720.50 7.89%
mp5_regen Mana 1806.22 507012.04 (24.71%) 280.70 34853.52 6.43%
Resource RPS-Gain RPS-Loss
Mana 4543.17 4786.87
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 189920.05 4357.14 300000.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.5%
shadowfiend-Mana Cap 6.5%
lightwell-Mana Cap 6.5%

Procs

Count Interval
Shadowy Recall Extra Tick 258.0 1.7sec
Shadowy Apparition Procced 82.7 5.4sec
Divine Insight Mind Blast CD Reset 28.2 26.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_di_mb Damage Per Second
Count 49992
Mean 91989.67
Minimum 85688.04
Maximum 98899.73
Spread ( max - min ) 13211.69
Range [ ( max - min ) / 2 * 100% ] 7.18%
Standard Deviation 1988.4402
5th Percentile 88790.03
95th Percentile 95337.54
( 95th Percentile - 5th Percentile ) 6547.51
Mean Distribution
Standard Deviation 8.8933
95.00% Confidence Intervall ( 91972.24 - 92007.10 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1794
0.1 Scale Factor Error with Delta=300 33752
0.05 Scale Factor Error with Delta=300 135010
0.01 Scale Factor Error with Delta=300 3375271
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 91989.67
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37138521.87
Distribution Chart

DTPS

Sample Data priest_90_di_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 261.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.77 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.22 shadow_word_death,if=active_enemies<=5
F 50.90 mind_blast,if=active_enemies<=6&cooldown_react
G 18.99 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 25.06 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.29 halo,if=talent.halo.enabled
M 14.22 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.30 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 14.92 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.39 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.02 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGLWFHTFTHFGMTWWWWWFTFTHTLTFMTGFTHAWWFHTFDFTFGHLTWWWFMTFHTTFGTQQFMGAWHFTLTQFTHTFGMTWWWFTHFTTLTQFGMTHWAWFHTFTFGFHMLWWWWFTFHTFGMTGWAFHTFLTQFMTFGFHTWWWWFMTQFHHTFGFLMTWFAHTQFTTFGHMTWWWWWFLTFTHTTQFMTGQFTGWAFHTFEDELTFGEEHTWWWWEDEFTHEEFMTGEEFL9WWAEEFHMTPEEQFTPEDEFGWW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi : 87759 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87759.0 87759.0 27.77 / 0.03% 5397 / 6.2% 17.0 4925.7 4362.2 Mana 1.73% 41.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.35 0.00 2.63 2.31 1.40 1.33 1.53
Normalized 1.00 0.00 0.79 0.69 0.42 0.40 0.46
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.00 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_di_swi": Intellect=3.35, SpellDamage=2.63, HitRating=2.31, CritRating=1.40, HasteRating=1.33, MasteryRating=1.53 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_swi": Intellect=3.35, SpellDamage=2.63, HitRating=0.00, CritRating=1.40, HasteRating=1.33, MasteryRating=1.53 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:299501|161335|157823|114637|91275|88613|83598|46307&chds=0,599003&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++299501++devouring_plague,9482C9,0,0,15|t++161335++vampiric_touch,9482C9,1,0,15|t++157823++shadow_word_insanity,9482C9,2,0,15|t++114637++halo,9482C9,3,0,15|t++91275++shadow_word_death,9482C9,4,0,15|t++88613++mind_blast,9482C9,5,0,15|t++83598++shadow_word_pain,9482C9,6,0,15|t++46307++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,13,11,9,8,7,6,6,4,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_insanity|shadowfiend: melee|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.35,2.63,2.31,1.53,1.40,1.33|3.31,2.59,2.26,1.49,1.36,1.29|3.39,2.67,2.35,1.57,1.44,1.37&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.35++Int,FFFFFF,0,0,15,0.1,e|t++++2.63++SP,FFFFFF,0,1,15,0.1,e|t++++2.31++Hit,FFFFFF,0,2,15,0.1,e|t++++1.53++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.40++Crit,FFFFFF,0,4,15,0.1,e|t++++1.33++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.030&chtt=Scale Factors|priest_90_di_swi%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6777654445436866655520yxwuwvvutsrrrqpppoooppppqpoomllkjhhhhhhhhgfffffffhijjklmmllkjiihiihiiihggfffeffgijjkklllkihggfgghhhhhggffffffgijkkllkkjjihhfhhhhhhhhgfghiijklmmmnnnmlkjklllmmmmnnnnmmmmmmnprqpppooonmljjkkkklllkjijjjjjjklmmnmmmljhggfffeffgfeeddeeedfhikklmmmlkjiihiiiiiihhgfffffghijkklkkkjiihhhhhhhhhhggffgggghjkkklmmmllllkkllllmmmlkkkllmmnpppqqqqqomljkklmmnnoppqpqqrrrsuwxwwwvvusqpnmmmmmmmmllkkkllmnopqqrrrrqppppppppoooonnmmmmmmnpqqqqrsssssrsrssttuuuttssttttuuvvuvuutrponmkkjjihgfedccccbbdfffggghhhhhhhghgggggffeeeeeeeeefeeeeeecbcbcdeffghijmooprstuwz02234&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6370,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=87759|max=137766&chxp=1,1,64,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,40,16,40,32,56,88,144,168,224,320,264,376,448,528,504,504,608,792,784,872,992,1320,1728,1984,2416,2840,3040,3304,3560,3536,3472,2720,2616,2176,2048,1664,1176,976,528,424,280,200,72,56,8,8,8,8&chds=0,3560&chbh=5&chxt=x&chxl=0:|min=74337|avg=87759|max=97257&chxp=0,1,59,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.5,14.9,12.7,6.0,5.0,3.9,2.9,2.8,0.5,0.2,1.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 201.0s|shadow_word_pain 67.4s|mind_blast 57.3s|vampiric_touch 27.2s|devouring_plague 22.4s|shadow_word_death 17.5s|shadow_word_insanity 13.3s|halo 12.8s|shadowfiend 2.5s|dispersion 0.7s|waiting 7.8s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 87759
devouring_plague 5671 (14841) 6.5% (16.9%) 18.7 24.86sec 357200 299501 112334 232423 136408 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.75 18.75 0.00 0.00 1.1927 0.0000 2557643.36 2557643.36 0.00 299501.44 299501.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.99 79.95% 112334.17 102399 137090 112374.99 105317 120315 1684004 1684004 0.00
crit 3.76 20.05% 232423.24 210941 282405 228766.35 0 282405 873639 873639 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2185 2.5% 43.8 9.68sec 22501 0 18583 38490 22535 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.83 43.76 0.00 0.00 0.0000 0.0000 986210.07 986210.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.08 80.15% 18583.47 17006 22766 18589.13 17677 19889 651874 651874 0.00
crit 8.69 19.85% 38490.07 35032 46897 38492.60 35032 44495 334336 334336 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6985 8.0% 18.7 24.86sec 168193 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.4 18551 38402 22466 19.7% 0.0% 23.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.75 18.75 140.37 140.37 0.0000 0.7565 3153597.84 3153597.84 0.00 29699.65 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.7 80.28% 18550.89 17006 29577 18554.87 17553 19533 2090371 2090371 0.00
crit 27.7 19.72% 38402.19 35032 60928 38402.09 36144 41589 1063226 1063226 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3255) 0.0% (3.7%) 10.8 41.89sec 135214 114637 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 10.83 0.00 0.00 1.1795 0.0000 0.00 0.00 0.00 114636.66 114636.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.70 80.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.13 19.69% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3255 3.7% 10.8 41.89sec 135214 0 111840 231224 135212 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 10.83 0.00 0.00 0.0000 0.0000 1464024.80 1464024.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.71 80.42% 111840.39 104363 133162 111844.43 104363 118586 973865 973865 0.00
crit 2.12 19.58% 231223.98 214987 274315 209134.14 0 274315 490159 490159 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 41.89sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.83 117.05 0.00 0.00 0.0000 0.0000 0.00 22754230.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.26 77.11% 0.00 0 0 0.00 0 0 0 14101211 100.00
crit 26.79 22.89% 0.00 0 0 0.00 0 0 0 8653019 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11258 12.8% 46.6 9.55sec 108884 88613 89781 185770 108885 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.60 46.60 0.00 0.00 1.2288 0.0000 5074339.94 5074339.94 0.00 88613.09 88613.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.33 80.10% 89780.90 82079 110390 89800.04 86334 93550 3351354 3351354 0.00
crit 9.27 19.90% 185770.36 169082 227403 185808.01 0 210684 1722986 1722986 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15739 (20658) 17.9% (23.5%) 118.0 3.69sec 78864 46307 0 0 0 0.0% 0.0% 0.0% 0.0% 243.7 23966 49676 29095 19.9% 0.0% 39.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.03 118.03 243.74 243.74 1.7031 0.7396 7091414.43 7091414.43 0.00 46307.30 46307.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 195.1 80.05% 23965.93 21797 29181 23972.77 23315 24673 4676064 4676064 0.00
crit 48.6 19.95% 49675.52 44901 60113 49688.77 47219 52335 2415350 2415350 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4919 5.6% 76.2 5.64sec 29073 0 23960 49685 29085 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.24 76.21 0.00 0.00 0.0000 0.0000 2216491.59 2216491.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.02 80.08% 23959.53 21797 29181 23965.26 22982 25244 1462128 1462128 0.00
crit 15.18 19.92% 49684.78 44901 60113 49696.00 44901 56134 754363 754363 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3547 4.0% 14.7 5.15sec 109088 91275 89738 186160 109086 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 1.1952 0.0000 1600503.65 1600503.65 0.00 91274.80 91274.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.73 79.93% 89737.80 79678 107383 89813.97 82636 99671 1052367 1052367 0.00
crit 2.94 20.07% 186159.99 164137 221210 179634.45 0 221210 548137 548137 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4658 5.3% 11.2 38.04sec 186916 157823 154240 319218 186914 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 11.25 0.00 0.00 1.1844 0.0000 2102049.38 2102049.38 0.00 157823.36 157823.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.02 80.19% 154240.32 141188 190440 154241.20 142643 173409 1391020 1391020 0.00
crit 2.23 19.81% 319217.81 290847 392307 290167.08 0 392307 711029 711029 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9516 (12500) 10.8% (14.2%) 57.0 7.77sec 98826 83598 0 0 0 0.0% 0.0% 0.0% 0.0% 234.2 13897 28725 18317 29.8% 0.0% 89.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.02 57.02 234.19 234.19 1.1822 1.7184 4289663.03 4289663.03 0.00 11993.24 83598.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 164.4 70.19% 13896.50 12783 17110 13898.57 13421 14321 2284213 2284213 0.00
crit 69.8 29.81% 28725.29 26333 35247 28729.18 27459 29937 2005450 2005450 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2984 3.4% 73.2 6.02sec 18369 0 13932 28809 18382 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.23 73.18 0.00 0.00 0.0000 0.0000 1345205.45 1345205.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.29 70.09% 13932.08 12783 17110 13934.70 13391 14530 714583 714583 0.00
crit 21.89 29.91% 28809.27 26333 35247 28817.94 27151 31102 630622 630622 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2191 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3624 4.1% 79.4 5.57sec 20590 0 17386 34940 20879 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.37 78.28 0.00 0.00 0.0000 0.0000 1634347.25 1634347.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.70 80.10% 17385.96 15875 21413 17389.30 16742 18043 1090117 1090117 0.00
crit 15.58 19.90% 34940.24 31750 42826 34946.71 32143 38642 544230 544230 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7407 (9726) 8.4% (11.1%) 22.5 19.78sec 194900 161335 0 0 0 0.0% 0.0% 0.0% 0.0% 175.5 15675 32456 19012 19.9% 0.0% 86.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.48 22.48 175.52 175.52 1.2081 2.2189 3337061.71 3337061.71 0.00 10517.86 161335.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.6 80.11% 15675.20 14287 19397 15678.10 15155 16293 2204167 2204167 0.00
crit 34.9 19.89% 32456.45 29431 39957 32460.79 30259 35080 1132895 1132895 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2319 2.6% 55.0 7.82sec 18994 0 15679 32478 19005 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.02 54.98 0.00 0.00 0.0000 0.0000 1044961.84 1044961.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.10 80.20% 15678.87 14287 19397 15681.60 14990 16485 691369 691369 0.00
crit 10.89 19.80% 32478.18 29431 39957 32481.28 0 36494 353593 353593 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46398 / 3692
melee 46398 4.2% 31.3 12.68sec 52609 51718 45901 92541 52610 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.32 31.32 0.00 0.00 1.0173 0.0000 1647824.85 1647824.85 0.00 51717.56 51717.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.48 55.80% 45901.49 36329 55931 45917.00 41297 51635 802231 802231 0.00
crit 6.34 20.24% 92541.00 72658 111863 92337.29 0 111863 586775 586775 0.00
glance 7.50 23.96% 34489.74 27247 41949 34494.52 27247 41949 258819 258819 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.1972 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.51%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.7 0.6 28.2sec 27.0sec 5.65% 29.05%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.65%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.8sec 108.8sec 19.97% 19.97%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.97%

    Trigger Attempt Success

    • trigger_pct:16.40%
jade_serpent_potion 1.0 0.0 420.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.73% 44.12%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.73%

    Trigger Attempt Success

    • trigger_pct:2.39%
light_of_the_cosmos 9.5 0.0 49.2sec 49.2sec 41.15% 41.15%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.15%

    Trigger Attempt Success

    • trigger_pct:14.98%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.1sec 10.1sec 9.92% 46.74%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.92%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.6sec 74.6sec 83.38% 77.53%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi
devouring_plague Shadow Orb 18.8 56.3 3.0 3.0 119065.3
halo Mana 10.8 438508.1 40500.0 40499.5 3.3
mind_blast Mana 46.6 278498.9 5975.9 5976.0 18.2
mind_flay Mana 118.0 354074.4 3000.0 3000.0 26.3
shadow_word_death Mana 14.7 114442.8 7800.0 7800.3 14.0
shadow_word_insanity Mana 11.2 84342.0 7500.0 7499.8 24.9
shadow_word_pain Mana 57.0 752636.5 13200.0 13200.0 7.5
vampiric_touch Mana 22.5 202350.2 9000.0 9000.0 21.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.88 15765.12 (0.80%) 18000.00 0.00 0.00%
shadowfiend Mana 31.32 248635.58 (12.62%) 7938.03 33263.14 11.80%
Shadow Orbs from Mind Blast Shadow Orb 46.60 46.60 (85.62%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.83 7.83 (14.38%) 1.00 0.00 0.00%
Devouring Plague Health Health 184.14 0.00 (-nan%) 0.00 2557020.38 100.00%
Vampiric Touch Mana Mana 230.50 1178121.50 (59.79%) 5111.07 39950.50 3.28%
mp5_regen Mana 1806.22 527806.32 (26.79%) 292.22 14059.25 2.59%
Resource RPS-Gain RPS-Loss
Mana 4362.23 4925.74
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 45480.75 0.00 257100.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.6%
shadowfiend-Mana Cap 2.6%
lightwell-Mana Cap 2.6%

Procs

Count Interval
Shadowy Recall Extra Tick 248.1 1.8sec
Shadowy Apparition Procced 79.4 5.6sec
Divine Insight Mind Blast CD Reset 27.0 27.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_di_swi Damage Per Second
Count 49992
Mean 87758.97
Minimum 74336.66
Maximum 97257.40
Spread ( max - min ) 22920.74
Range [ ( max - min ) / 2 * 100% ] 13.06%
Standard Deviation 3167.8729
5th Percentile 81452.15
95th Percentile 92247.02
( 95th Percentile - 5th Percentile ) 10794.87
Mean Distribution
Standard Deviation 14.1683
95.00% Confidence Intervall ( 87731.20 - 87786.74 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 50
0.1% Error 5005
0.1 Scale Factor Error with Delta=300 85668
0.05 Scale Factor Error with Delta=300 342672
0.01 Scale Factor Error with Delta=300 8566810
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 87758.97
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37897514.36
Distribution Chart

DTPS

Sample Data priest_90_di_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 313.06
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.70 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.67 shadow_word_death,if=active_enemies<=5
F 50.04 mind_blast,if=active_enemies<=6&cooldown_react
G 18.75 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 24.46 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 11.25 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.83 halo,if=talent.halo.enabled
M 14.05 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 44.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 20.20 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 58.13 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 38.27 shadow_word_pain,moving=1
X 0.15 dispersion

Sample Sequence

DGLWFHTFTFHGMTWWWWFTHTFLTFGTHWWFHMTFTTFIGHTLTFWFMWTQFHTTFTIGTFGWWHTLFMTTFTHIGTFTWWWWQFMTHTFTLTIGFTBWWFHMTFTFGHTLWWWFMTFHTIGFTGWWFHTLTFMTHFGTWWWWFTHHFMTFTIGLTFWWWHTFTTFMTHIGFTWWWWWFLTHTFMTIFGTGBWFHTFMTEELFTFDFEEGHWWFDEEHTQFTEDETFGTHEELW9WWFDEETFHEDETIFGTEEW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl : 90572 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
90571.8 90571.8 18.78 / 0.02% 3517 / 3.9% 18.5 4683.3 4342.3 Mana 0.38% 37.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.45 0.00 2.74 2.24 1.47 1.23 1.41
Normalized 1.00 0.00 0.79 0.65 0.43 0.36 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=3.45, SpellDamage=2.74, HitRating=2.24, CritRating=1.47, HasteRating=1.23, MasteryRating=1.41 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=3.45, SpellDamage=2.74, HitRating=0.00, CritRating=1.47, HasteRating=1.23, MasteryRating=1.41 )

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309795|171400|120219|98779|94429|88640|79262|48743&chds=0,619590&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++309795++devouring_plague,9482C9,0,0,15|t++171400++vampiric_touch,9482C9,1,0,15|t++120219++halo,9482C9,2,0,15|t++98779++shadow_word_pain,9482C9,3,0,15|t++94429++shadow_word_death,9482C9,4,0,15|t++88640++mind_blast,9482C9,5,0,15|t++79262++mind_spike,4A79D3,6,0,15|t++48743++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,12,12,9,8,7,6,6,4,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.45,2.74,2.24,1.47,1.41,1.23|3.42,2.71,2.21,1.44,1.38,1.21|3.48,2.77,2.26,1.50,1.43,1.26&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.45++Int,FFFFFF,0,0,15,0.1,e|t++++2.74++SP,FFFFFF,0,1,15,0.1,e|t++++2.24++Hit,FFFFFF,0,2,15,0.1,e|t++++1.47++Crit,FFFFFF,0,3,15,0.1,e|t++++1.41++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.23++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.149&chtt=Scale Factors|priest_90_pi_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:678776665554675665531ywvusssrqpoooonmmlkjjjjjkkjjihghgfeeeeeeefeedddcccdeeeefggggfeeddeeeeeeeedddccccddeeffffgedccbbbdddefffgffgggghijkkllkjiihgfeffffeedeedeeffggghhiihhggfefffggggghijjiiiiiijklkkkjjjjihgeeffggghhhhggggggfgghhhhggfdcbbabaabcdeeedeeeffgijkkllllkjihgfgggffeeeeddddddeeeffgfffeddddcccccccccccccdddeffffgghhhhhggghhhhiiiiiiiijjjkkkkklkkkjhgffghiijkmnppppqqqqsuvwvvuttsqpnlkkkkjjjjjjiiiijjjkllmmmmmlkkllkkjkjjjjjjjjjjijkllllmmnooooooopqqrrssssrrrrrrrrrrrsrqqolkkjijiiiiijkkjkllmmoqrstuuuuuuutsstssrrrqqppoooooooooooooomlllllnnooqqrrtttssssuwwyyyx&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5885,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=90572|max=153906&chxp=1,1,59,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,80,56,24,88,72,184,264,248,512,680,984,1152,1488,1576,1968,2312,2472,2704,2984,2816,3136,3144,2952,2528,2328,2096,2080,1536,1456,1216,1160,920,672,592,520,264,184,200,104,64,72,32,24,16,8,8,0,8&chds=0,3144&chbh=5&chxt=x&chxl=0:|min=83247|avg=90572|max=99221&chxp=0,1,46,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:43.1,13.6,11.4,9.2,6.0,4.4,4.0,2.8,0.5,0.0,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 194.9s|shadow_word_pain 61.4s|mind_blast 51.4s|mind_spike 41.7s|vampiric_touch 27.2s|devouring_plague 19.9s|shadow_word_death 17.9s|halo 12.8s|shadowfiend 2.5s|dispersion 0.0s|waiting 1.7s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 90572
devouring_plague 5166 (13628) 5.7% (15.1%) 17.1 27.48sec 359561 309795 112444 232777 136208 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.12 17.12 0.00 0.00 1.1606 0.0000 2331911.38 2331911.38 0.00 309794.98 309794.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.74 80.25% 112443.64 102399 137090 112479.00 103168 120231 1544815 1544815 0.00
crit 3.38 19.75% 232776.58 210941 282405 225856.99 0 282405 787096 787096 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2022 2.2% 40.6 10.46sec 22512 0 18595 38498 22548 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.58 40.52 0.00 0.00 0.0000 0.0000 913551.97 913551.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.47 80.14% 18595.01 17006 22766 18599.77 17635 19955 603748 603748 0.00
crit 8.05 19.86% 38498.26 35032 46897 38490.60 0 46897 309804 309804 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6440 7.1% 17.1 27.48sec 169988 0 0 0 0 0.0% 0.0% 0.0% 0.0% 129.5 18550 38374 22480 19.8% 0.0% 21.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.12 17.12 129.45 129.45 0.0000 0.7375 2910162.96 2910162.96 0.00 30481.53 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.8 80.17% 18549.78 17006 22766 18554.04 17566 19825 1925240 1925240 0.00
crit 25.7 19.83% 38374.14 35032 46897 38377.20 35580 41247 984923 984923 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3404) 0.0% (3.8%) 11.3 41.34sec 135635 120219 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 1.1283 0.0000 0.00 0.00 0.00 120219.25 120219.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.09 80.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.23 19.71% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3404 3.8% 11.3 41.34sec 135635 0 112074 231932 135636 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 0.0000 0.0000 1535921.13 1535921.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.10 80.34% 112074.30 104363 133162 112065.62 105821 119434 1019644 1019644 0.00
crit 2.23 19.66% 231931.51 214987 274315 211898.55 0 274315 516278 516278 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.34sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.32 124.18 0.00 0.00 0.0000 0.0000 0.00 24198516.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.70 77.07% 0.00 0 0 0.00 0 0 0 14980344 100.00
crit 28.48 22.93% 0.00 0 0 0.00 0 0 0 9218173 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10088 11.1% 41.7 10.80sec 109088 88640 89968 186143 109087 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.74 41.74 0.00 0.00 1.2307 0.0000 4553246.68 4553246.68 0.00 88639.75 88639.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.44 80.12% 89967.66 82079 110390 89988.79 86437 93427 3008655 3008655 0.00
crit 8.30 19.88% 186143.19 169082 227403 186087.97 0 212147 1544591 1544591 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16040 (21062) 17.7% (23.2%) 117.7 3.76sec 80697 48743 0 0 0 0.0% 0.0% 0.0% 0.0% 247.8 24049 49859 29197 19.9% 0.0% 38.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.72 117.72 247.78 247.78 1.6556 0.7062 7234406.82 7234406.82 0.00 48742.54 48742.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.4 80.05% 24048.93 21797 29181 24057.33 23379 24735 4770138 4770138 0.00
crit 49.4 19.95% 49858.93 44901 60113 49879.18 47656 53304 2464269 2464269 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5022 5.5% 77.6 5.65sec 29188 0 24044 49840 29204 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.61 77.57 0.00 0.00 0.0000 0.0000 2265320.07 2265320.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.06 80.00% 24044.38 21797 29181 24051.51 22928 25187 1492094 1492094 0.00
crit 15.51 20.00% 49840.46 44901 60113 49858.86 45985 56369 773226 773226 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7319 8.1% 35.9 12.06sec 91893 79262 75730 156972 91893 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.95 35.95 0.00 0.00 1.1594 0.0000 3303487.03 3303487.03 0.00 79262.13 79262.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.80 80.11% 75730.28 68964 93036 75744.75 71576 81120 2180841 2180841 0.00
crit 7.15 19.89% 156971.60 142066 191655 156970.74 0 191655 1122646 1122646 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3729 4.1% 15.4 4.90sec 109508 94429 90003 186518 109512 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.42 15.42 0.00 0.00 1.1597 0.0000 1688960.78 1688960.78 0.00 94429.21 94429.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.31 79.79% 90002.88 79678 107383 90096.40 82266 99319 1107588 1107588 0.00
crit 3.12 20.21% 186517.85 164137 221210 181162.46 0 221210 581373 581373 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10228 (13438) 11.3% (14.8%) 52.7 8.51sec 115058 98779 0 0 0 0.0% 0.0% 0.0% 0.0% 251.6 13917 28762 18351 29.9% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.73 52.73 251.62 251.62 1.1648 1.7276 4617524.57 4617524.57 0.00 12228.64 98779.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.5 70.13% 13917.03 12783 17110 13918.83 13485 14414 2455802 2455802 0.00
crit 75.2 29.87% 28761.96 26333 35247 28764.04 27493 30052 2161723 2161723 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3210 3.5% 78.7 5.67sec 18405 0 13966 28891 18420 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.73 78.67 0.00 0.00 0.0000 0.0000 1449102.16 1449102.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.19 70.16% 13965.82 12783 17110 13969.34 13424 14628 770820 770820 0.00
crit 23.48 29.84% 28890.50 26333 35247 28897.43 26925 31122 678283 678283 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2201 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3852 4.3% 84.5 5.30sec 20587 0 17427 35047 20928 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.50 83.12 0.00 0.00 0.0000 0.0000 1739594.81 1739594.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.61 80.13% 17426.91 15875 21413 17430.09 16832 18043 1160805 1160805 0.00
crit 16.51 19.87% 35046.84 31750 42826 35047.28 31750 38076 578790 578790 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7875 (10345) 8.7% (11.4%) 23.4 19.35sec 199299 171400 0 0 0 0.0% 0.0% 0.0% 0.0% 186.4 15717 32550 19067 19.9% 0.0% 87.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.43 23.43 186.40 186.40 1.1628 2.1270 3554245.45 3554245.45 0.00 11018.26 171399.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 149.3 80.10% 15717.43 14287 19397 15720.52 15232 16307 2346735 2346735 0.00
crit 37.1 19.90% 32550.11 29431 39957 32555.80 30886 34568 1207510 1207510 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2470 2.7% 58.4 7.53sec 19080 0 15733 32607 19094 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.41 58.36 0.00 0.00 0.0000 0.0000 1114344.50 1114344.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.73 80.08% 15733.01 14287 19397 15736.58 14990 16569 735276 735276 0.00
crit 11.63 19.92% 32606.84 29431 39957 32615.55 29431 37070 379069 379069 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46587 / 3707
melee 46587 4.0% 31.3 12.68sec 52839 51999 46045 92925 52839 20.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.31 31.31 0.00 0.00 1.0162 0.0000 1654500.32 1654500.32 0.00 51998.88 51998.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.42 55.62% 46044.62 36329 55931 46057.77 41137 51850 801965 801965 0.00
crit 6.37 20.36% 92925.04 72658 111863 92814.60 0 111863 592308 592308 0.00
glance 7.52 24.02% 34600.40 27247 41949 34582.28 0 41949 260228 260228 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.1366 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.40%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.01% 20.01%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.01%

    Trigger Attempt Success

    • trigger_pct:16.38%
glyph_mind_spike 25.2 10.7 17.4sec 12.1sec 34.88% 49.81%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:27.37%
  • glyph_mind_spike_2:7.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.3sec 20.1sec 44.71% 45.33%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.71%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.6 0.0 49.1sec 49.1sec 41.40% 41.40%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.40%

    Trigger Attempt Success

    • trigger_pct:15.02%
power_infusion 4.3 0.0 121.4sec 121.0sec 18.55% 20.91%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.90% 49.40%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.90%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 31.4 5.3 13.9sec 11.9sec 18.58% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.07%
  • surge_of_darkness_2:1.51%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.6sec 74.6sec 83.39% 77.63%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl
devouring_plague Shadow Orb 17.1 51.4 3.0 3.0 119853.7
halo Mana 11.3 425066.0 37537.3 37537.1 3.6
mind_blast Mana 41.7 362093.5 8675.1 8675.1 12.6
mind_flay Mana 117.7 335488.7 2849.9 2849.9 28.3
shadow_word_death Mana 15.4 115712.6 7502.3 7502.5 14.6
shadow_word_pain Mana 52.7 675032.8 12802.4 12802.5 9.0
vampiric_touch Mana 23.4 201934.9 8620.5 8620.5 23.1
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.02 270.72 (0.01%) 18000.00 0.00 0.00%
shadowfiend Mana 31.31 228417.91 (11.65%) 7294.90 53390.09 18.95%
Shadow Orbs from Mind Blast Shadow Orb 41.74 41.74 (84.25%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.80 7.80 (15.75%) 1.00 0.00 0.00%
Devouring Plague Health Health 169.97 0.00 (-nan%) 0.00 2360303.77 100.00%
Vampiric Touch Mana Mana 244.76 1214132.62 (61.90%) 4960.44 79368.50 6.14%
mp5_regen Mana 1806.22 518485.67 (26.44%) 287.06 23379.90 4.31%
Resource RPS-Gain RPS-Loss
Mana 4342.26 4683.25
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 145981.68 0.00 299100.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.4%
shadowfiend-Mana Cap 4.4%
lightwell-Mana Cap 4.4%

Procs

Count Interval
Shadowy Recall Extra Tick 255.1 1.8sec
Shadowy Apparition Procced 84.5 5.3sec
FDCL Mind Spike proc 36.7 11.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl Damage Per Second
Count 49992
Mean 90571.84
Minimum 83246.58
Maximum 99221.05
Spread ( max - min ) 15974.48
Range [ ( max - min ) / 2 * 100% ] 8.82%
Standard Deviation 2142.7821
5th Percentile 87177.36
95th Percentile 94211.23
( 95th Percentile - 5th Percentile ) 7033.87
Mean Distribution
Standard Deviation 9.5836
95.00% Confidence Intervall ( 90553.05 - 90590.62 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2150
0.1 Scale Factor Error with Delta=300 39195
0.05 Scale Factor Error with Delta=300 156783
0.01 Scale Factor Error with Delta=300 3919581
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 90571.84
Distribution Chart

Damage

Sample Data
Count 49992
Mean 39211780.32
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 281.24
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.98 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.42 shadow_word_death,if=active_enemies<=5
F 46.07 mind_blast,if=active_enemies<=6&cooldown_react
G 19.04 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 25.27 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.41 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.32 halo,if=talent.halo.enabled
M 13.14 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.46 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.07 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 32.54 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.52 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 33.68 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGLWFHTQFRRRTFHMGRRTWFWWWTFHTLTFMRGTHWWWFHTRTFTFGHLMWRWFTFHTQFJGRTCFGMHTLFRTTRQFHTGTFMRWWWTHFTRTFTLRTGHFMBRWTFRTHFTFGMTWLWWFHRTQFRTRTQFGHMTCGRWFHTLFRTRRTHFTGTRWWFMTHTFTJRQFLGTWWWFHTQFMTRTHFGJRWWWWFLTFHHMTFTGTBCGWFHTQFEDELRTFHEEGRWWWWEDEFRHTTEEFMRTEEFG9LWHEDEFTRTEEFMHRTGEERF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb : 92517 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
92516.8 92516.8 16.29 / 0.02% 3038 / 3.3% 16.8 4912.9 4659.4 Mana 0.27% 32.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.37 0.00 2.74 2.35 1.36 0.47 1.27
Normalized 1.00 0.00 0.81 0.70 0.40 0.14 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.00 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=3.37, SpellDamage=2.74, HitRating=2.35, CritRating=1.36, HasteRating=0.47, MasteryRating=1.27 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=3.37, SpellDamage=2.74, HitRating=0.00, CritRating=1.36, HasteRating=0.47, MasteryRating=1.27 )

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:312662|171624|120484|94674|90314|87902|49726&chds=0,625324&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++312662++devouring_plague,9482C9,0,0,15|t++171624++vampiric_touch,9482C9,1,0,15|t++120484++halo,9482C9,2,0,15|t++94674++shadow_word_death,9482C9,3,0,15|t++90314++shadow_word_pain,9482C9,4,0,15|t++87902++mind_blast,9482C9,5,0,15|t++49726++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,13,12,12,9,8,7,6,5,5,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.37,2.74,2.35,1.36,1.27,0.47|3.35,2.71,2.33,1.34,1.25,0.44|3.39,2.76,2.38,1.39,1.29,0.49&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.37++Int,FFFFFF,0,0,15,0.1,e|t++++2.74++SP,FFFFFF,0,1,15,0.1,e|t++++2.35++Hit,FFFFFF,0,2,15,0.1,e|t++++1.36++Crit,FFFFFF,0,3,15,0.1,e|t++++1.27++Mastery,FFFFFF,0,4,15,0.1,e|t++++0.47++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.055&chtt=Scale Factors|priest_90_pi_mb%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024686555554675665531ywtqnponnmlkkkkjiihgggghiiggfecbbbabcddefhijijkkkllmnnnnmlkkihfdcccbbbbcbbaaaaZaabbcdeedecbaZZZbdfgijlmnmnnnonoqqsrrpolkigecbcbbbbaaabZbcceeffgghihggfeeddcecccbcddeefghhijkkllmlkkkjjhgfffedededdcdddeeeeeffggffecbaZZbbbcdfgghhjjllmopqrstrrrpolkigigfedccbbabaaabbcddefeddcccbbbcbccdeffgfhhjkklmnnoooonmlkkjijihggggggffggghhiiiijjiihfeddcdddeefgijjklmnoqstttvvvvutrpnlmlkjihhggfggggghiijjlkkkjiijjiihiiijkkllmmnooqsssstuvuutssrqrrrqqppppooopoppppppqpoomkjihggffgghijklnnpqrvxyzz1122110yxvwutsrqpoonnmmmmnnnnnonnnmklllklkkkllmmmnpooooprqqqst&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5875,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=92517|max=157479&chxp=1,1,59,100&chtt=priest_90_pi_mb DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,16,8,48,64,88,184,128,328,304,664,712,936,1064,1296,1616,1968,2112,2464,2664,2880,3032,2768,3104,2736,2536,2608,2176,2096,1760,1592,1328,1160,872,648,464,408,280,176,208,112,88,72,80,72,16,16,0,0,16&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=86258|avg=92517|max=99869&chxp=0,1,46,100&chtt=priest_90_pi_mb DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.7,15.1,11.1,5.9,4.3,3.9,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 224.6s|shadow_word_pain 68.3s|mind_blast 50.2s|vampiric_touch 26.8s|devouring_plague 19.3s|shadow_word_death 17.8s|halo 12.8s|mindbender 8.1s|waiting 1.2s&chtt=priest_90_pi_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb 92517
devouring_plague 5056 (13356) 5.5% (14.5%) 16.7 28.10sec 361781 312662 112688 233441 136879 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.69 16.69 0.00 0.00 1.1571 0.0000 2284260.59 2284260.59 0.00 312662.00 312662.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.35 79.97% 112688.29 102399 137090 112726.06 105639 120928 1503847 1503847 0.00
crit 3.34 20.03% 233441.38 210941 282405 227047.14 0 282405 780413 780413 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1976 2.1% 39.7 10.63sec 22517 0 18604 38468 22550 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.68 39.62 0.00 0.00 0.0000 0.0000 893470.09 893470.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.75 80.14% 18604.42 17006 22766 18606.45 17337 19755 590707 590707 0.00
crit 7.87 19.86% 38467.91 35032 46897 38460.59 0 44793 302764 302764 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6324 6.8% 16.7 28.10sec 171364 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.9 18589 38465 22541 19.9% 0.0% 20.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.69 16.69 126.87 126.87 0.0000 0.7338 2859772.44 2859772.44 0.00 30717.54 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.6 80.12% 18589.00 17006 22766 18592.35 17647 19591 1889455 1889455 0.00
crit 25.2 19.88% 38464.74 35032 46897 38467.30 35796 42031 970317 970317 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3407) 0.0% (3.7%) 11.3 41.41sec 135882 120484 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 1.1278 0.0000 0.00 0.00 0.00 120483.68 120483.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.10 80.39% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.61% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3407 3.7% 11.3 41.41sec 135882 0 111986 231850 135882 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 0.00 0.00 0.0000 0.0000 1537974.17 1537974.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.06 80.06% 111985.50 104363 133162 111978.79 105821 118896 1014804 1014804 0.00
crit 2.26 19.94% 231849.83 214987 274315 211272.35 0 274315 523170 523170 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.41sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.32 124.12 0.00 0.00 0.0000 0.0000 0.00 24167460.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.68 77.09% 0.00 0 0 0.00 0 0 0 14969123 100.00
crit 28.44 22.91% 0.00 0 0 0.00 0 0 0 9198338 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9766 10.6% 40.5 11.15sec 109060 87902 89898 186208 109059 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.47 40.47 0.00 0.00 1.2407 0.0000 4413898.62 4413898.62 0.00 87901.75 87901.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.42 80.10% 89898.43 82079 110390 89916.51 85707 93959 2914486 2914486 0.00
crit 8.05 19.90% 186207.88 169082 227403 186228.21 0 219044 1499413 1499413 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18866 (24775) 20.4% (26.7%) 132.3 3.35sec 84425 49726 0 0 0 0.0% 0.0% 0.0% 0.0% 291.0 24061 49868 29223 20.0% 0.0% 45.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.28 132.28 291.00 291.00 1.6978 0.7059 8503917.98 8503917.98 0.00 49725.94 49725.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 232.8 80.00% 24060.69 21797 29181 24067.82 23474 24629 5600960 5600960 0.00
crit 58.2 20.00% 49868.26 44901 60113 49882.77 47187 52264 2902958 2902958 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5909 6.4% 91.2 4.81sec 29218 0 24051 49845 29234 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.17 91.13 0.00 0.00 0.0000 0.0000 2663981.29 2663981.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.82 79.91% 24051.28 21797 29181 24056.73 23078 25177 1751318 1751318 0.00
crit 18.31 20.09% 49845.17 44901 60113 49863.03 45768 54189 912663 912663 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.74sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 1.1696 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.34sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3720 4.0% 15.3 4.92sec 109866 94674 90006 186590 109866 20.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.34 15.34 0.00 0.00 1.1605 0.0000 1684912.47 1684912.47 0.00 94673.96 94673.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.18 79.44% 90006.27 79678 107383 90095.91 82093 98030 1096510 1096510 0.00
crit 3.15 20.56% 186590.23 164137 221210 180845.48 0 221210 588402 588402 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10389 (13652) 11.2% (14.8%) 58.4 7.68sec 105661 90314 0 0 0 0.0% 0.0% 0.0% 0.0% 255.9 13906 28745 18332 29.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.35 58.35 255.90 255.90 1.1699 1.6970 4691310.32 4691310.32 0.00 12268.57 90314.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.6 70.17% 13906.46 12783 17110 13907.51 13474 14384 2497286 2497286 0.00
crit 76.3 29.83% 28744.68 26333 35247 28745.65 27622 30034 2194025 2194025 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3264 3.5% 80.1 5.57sec 18404 0 13967 28877 18419 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.10 80.04 0.00 0.00 0.0000 0.0000 1474246.01 1474246.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.13 70.14% 13966.73 12783 17110 13969.39 13432 14654 784006 784006 0.00
crit 23.90 29.86% 28876.75 26333 35247 28879.84 27186 31551 690240 690240 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3882 4.2% 85.2 5.26sec 20593 0 17428 35048 20937 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.16 83.76 0.00 0.00 0.0000 0.0000 1753745.48 1753745.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.08 80.09% 17427.71 15875 21413 17430.45 16803 18090 1169102 1169102 0.00
crit 16.68 19.91% 35047.67 31750 42826 35053.42 31750 38668 584644 584644 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7762 (10187) 8.4% (11.0%) 22.9 19.83sec 200811 171624 0 0 0 0.0% 0.0% 0.0% 0.0% 183.4 15737 32583 19100 20.0% 0.0% 85.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.90 22.90 183.42 183.42 1.1701 2.1143 3503273.07 3503273.07 0.00 11089.98 171623.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 146.8 80.04% 15736.64 14287 19397 15739.59 15173 16323 2310202 2310202 0.00
crit 36.6 19.96% 32583.04 29431 39957 32586.16 30897 34840 1193071 1193071 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2425 2.6% 57.4 7.67sec 19073 0 15739 32600 19089 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.39 57.34 0.00 0.00 0.0000 0.0000 1094531.30 1094531.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.95 80.13% 15739.01 14287 19397 15742.07 15079 16664 723155 723155 0.00
crit 11.39 19.87% 32600.31 29431 39957 32611.94 29431 36760 371376 371376 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37680 / 9770
melee 37680 10.5% 105.4 4.17sec 41770 39185 36468 73443 41769 20.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.43 105.43 0.00 0.00 1.0660 0.0000 4403972.75 4403972.75 0.00 39185.44 39185.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.93 55.89% 36468.36 29063 44745 36487.04 34328 38883 2148975 2148975 0.00
crit 21.30 20.20% 73442.62 58126 89490 73478.23 67362 80733 1564556 1564556 0.00
glance 25.20 23.91% 27393.53 21797 33559 27405.40 25151 30072 690442 690442 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.46 23.46 0.00 0.00 1.1330 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.40%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.02% 20.02%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.02%

    Trigger Attempt Success

    • trigger_pct:16.47%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.3sec 20.1sec 44.55% 45.27%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.55%

    Trigger Attempt Success

    • trigger_pct:2.34%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.48% 41.48%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.48%

    Trigger Attempt Success

    • trigger_pct:14.90%
power_infusion 4.3 0.0 121.8sec 121.3sec 18.47% 21.11%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.2sec 10.2sec 9.85% 49.47%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.5 0.0 19.3sec 19.3sec 85.39% 83.91%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb
devouring_plague Shadow Orb 16.7 50.1 3.0 3.0 120592.2
halo Mana 11.3 424810.7 37532.7 37532.6 3.6
mind_blast Mana 40.5 351694.9 8689.8 8689.8 12.6
mind_flay Mana 132.3 377391.6 2852.9 2852.9 29.6
shadow_word_death Mana 15.3 115200.6 7511.5 7511.8 14.6
shadow_word_pain Mana 58.4 753586.1 12914.6 12914.4 8.2
vampiric_touch Mana 22.9 196369.1 8576.4 8576.5 23.4
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.44 423744.02 (20.13%) 4018.99 38163.27 8.26%
Shadow Orbs from Mind Blast Shadow Orb 40.47 40.47 (83.93%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.75 7.75 (16.07%) 1.00 0.00 0.00%
Devouring Plague Health Health 166.49 0.00 (-nan%) 0.00 2312042.80 100.00%
Vampiric Touch Mana Mana 240.76 1169970.18 (55.59%) 4859.54 102561.18 8.06%
mp5_regen Mana 1806.22 510838.68 (24.27%) 282.82 31026.89 5.73%
Resource RPS-Gain RPS-Loss
Mana 4659.40 4912.89
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 185493.87 2701.90 295509.52
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.8%
shadowfiend-Mana Cap 5.8%
lightwell-Mana Cap 5.8%

Procs

Count Interval
Shadowy Recall Extra Tick 268.1 1.7sec
Shadowy Apparition Procced 85.2 5.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_pi_mb Damage Per Second
Count 49992
Mean 92516.78
Minimum 86258.34
Maximum 99869.14
Spread ( max - min ) 13610.80
Range [ ( max - min ) / 2 * 100% ] 7.36%
Standard Deviation 1858.5375
5th Percentile 89497.74
95th Percentile 95574.54
( 95th Percentile - 5th Percentile ) 6076.81
Mean Distribution
Standard Deviation 8.3123
95.00% Confidence Intervall ( 92500.49 - 92533.07 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1550
0.1 Scale Factor Error with Delta=300 29486
0.05 Scale Factor Error with Delta=300 117946
0.01 Scale Factor Error with Delta=300 2948671
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 92516.78
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37359293.85
Distribution Chart

DTPS

Sample Data priest_90_pi_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 246.16
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.94 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 4.07 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.34 shadow_word_death,if=active_enemies<=5
F 44.92 mind_blast,if=active_enemies<=6&cooldown_react
G 18.98 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 25.59 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.32 halo,if=talent.halo.enabled
M 12.62 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.23 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.90 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 53.59 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 39.37 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGLWFHTFTFHTGTWWWWWFMTHLQQFTFGTHAWWFHMTFTFGHLTWWWWFMTHFHTFGTACGWFHMLTQFTHFGTWWWWFTHTQFMTLTFGTHWAWFHTQFTQFHGMTLWWWFTHTFTGFMTGACWFHTLTFTHQFMTGTWWWWFTHTFTLQFGMTWWAFHTQQFTFGHMTWWWLWFTHFTFGTGWCWAFHMTLEEFTHEDEFGWWWTEEFTHTTEDEFTGLEEW9WWFADEEHTFTEDETQFGTHEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi : 87169 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87168.9 87168.9 29.11 / 0.03% 5595 / 6.4% 16.7 4973.0 4403.0 Mana 2.29% 43.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.33 0.00 2.69 2.22 1.46 0.90 1.53
Normalized 1.00 0.00 0.81 0.67 0.44 0.27 0.46
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.04 0.00 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=3.33, SpellDamage=2.69, HitRating=2.22, CritRating=1.46, HasteRating=0.90, MasteryRating=1.53 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=3.33, SpellDamage=2.69, HitRating=0.00, CritRating=1.46, HasteRating=0.90, MasteryRating=1.53 )

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:307772|171839|157337|119918|93828|86881|83379|50038&chds=0,615544&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++307772++devouring_plague,9482C9,0,0,15|t++171839++vampiric_touch,9482C9,1,0,15|t++157337++shadow_word_insanity,9482C9,2,0,15|t++119918++halo,9482C9,3,0,15|t++93828++shadow_word_death,9482C9,4,0,15|t++86881++mind_blast,9482C9,5,0,15|t++83379++shadow_word_pain,9482C9,6,0,15|t++50038++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,11,9,7,7,6,5,4,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_insanity|shadowy_apparition|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_swi Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.33,2.69,2.22,1.53,1.46,0.90|3.29,2.65,2.18,1.49,1.42,0.86|3.37,2.73,2.26,1.57,1.51,0.94&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.33++Int,FFFFFF,0,0,15,0.1,e|t++++2.69++SP,FFFFFF,0,1,15,0.1,e|t++++2.22++Hit,FFFFFF,0,2,15,0.1,e|t++++1.53++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.46++Crit,FFFFFF,0,4,15,0.1,e|t++++0.90++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.009&chtt=Scale Factors|priest_90_pi_swi%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57877555555356566432zwusqoqqpponmmmljkjjiijijjkiigfedcbaaaaabbcbbabbbbcdfgghiiihhgfeddeedddddcbbbbaabbeefghgggfdcbbaccdeeffeeddedeefghjjlkjihgfedceddddcbccaccdeeehiiikjiiihhiihjhihhhihgghghhhijlkkkjjjkjigffggfggggfeddeeeeefgghiihhgedccaccbcdeeccccccddeghjklkkkkihgfegffffeeddbcbbcccefffigggfeeeeddddcddccaacbbbccegfghihhihhhgfhggghghgeeeeffgghiijkjjjigfeffiiijklnnnnooopprsuvuutssrpomkjkkjjjjiiighhhhiijkllmmmmkkkkkjkjjiiiihggggggghjjjjkkkllkkkkklkkklkkkjijjjjjkkkkklkkjhgfeeddcbbaZYXXWWWWWWYZaaabbcccdddddedeedddddccccccddddddddcbaaabbcdeffhijkklllmnprsttuu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5659,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=87169|max=154040&chxp=1,1,57,100&chtt=priest_90_pi_swi DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,16,32,72,88,144,104,144,256,296,320,424,656,496,632,656,600,728,816,976,976,1040,1304,1408,1536,1600,1992,2192,2816,2696,3144,2912,2880,3016,2680,2328,1904,1632,1256,952,760,560,336,216,160,88,72,48,0,8&chds=0,3144&chbh=5&chxt=x&chxl=0:|min=75192|avg=87169|max=96094&chxp=0,1,57,100&chtt=priest_90_pi_swi DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.2,15.6,10.9,5.8,4.2,3.7,2.9,2.6,0.5,0.4,2.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 208.6s|shadow_word_pain 70.4s|mind_blast 49.3s|vampiric_touch 26.1s|devouring_plague 18.9s|shadow_word_death 16.7s|shadow_word_insanity 12.9s|halo 11.9s|shadowfiend 2.5s|dispersion 1.7s|waiting 10.4s&chtt=priest_90_pi_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi 87169
devouring_plague 4912 (12907) 5.6% (14.8%) 16.3 28.81sec 358126 307772 112394 232599 136225 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.26 16.26 0.00 0.00 1.1636 0.0000 2214853.60 2214853.60 0.00 307772.06 307772.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.04 80.18% 112394.05 102399 137090 112437.55 105963 121084 1465138 1465138 0.00
crit 3.22 19.82% 232599.18 210941 282405 225517.05 0 282405 749716 749716 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1902 2.2% 38.2 10.98sec 22448 0 18552 38401 22480 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.25 38.19 0.00 0.00 0.0000 0.0000 858607.70 858607.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.64 80.21% 18552.19 17006 22766 18554.81 17608 19855 568384 568384 0.00
crit 7.56 19.79% 38400.55 35032 46897 38385.47 0 44793 290224 290224 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6092 7.0% 16.3 28.81sec 169094 0 0 0 0 0.0% 0.0% 0.0% 0.0% 122.4 18531 38361 22455 19.8% 0.0% 20.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.26 16.26 122.43 122.43 0.0000 0.7401 2749278.26 2749278.26 0.00 30340.55 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.2 80.21% 18531.41 17006 22766 18536.11 17435 19558 1819876 1819876 0.00
crit 24.2 19.79% 38361.04 35032 46897 38367.76 36057 42624 929402 929402 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3187) 0.0% (3.6%) 10.6 42.75sec 135628 119918 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 1.1311 0.0000 0.00 0.00 0.00 119917.97 119917.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.46 80.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.10 19.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3187 3.6% 10.6 42.75sec 135628 0 111964 231531 135628 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 0.0000 0.0000 1432659.99 1432659.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.47 80.21% 111964.41 104363 133162 111976.46 105821 121085 948624 948624 0.00
crit 2.09 19.79% 231530.89 214987 274315 209366.63 0 274315 484036 484036 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.6 42.75sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.56 115.81 0.00 0.00 0.0000 0.0000 0.00 22543743.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.33 77.14% 0.00 0 0 0.00 0 0 0 13979991 100.00
crit 26.47 22.86% 0.00 0 0 0.00 0 0 0 8563753 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9499 10.9% 39.3 11.37sec 109050 86881 89829 186025 109049 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.28 39.28 0.00 0.00 1.2552 0.0000 4282983.63 4282983.63 0.00 86881.22 86881.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.43 80.02% 89828.59 82079 110390 89848.81 86584 93654 2823093 2823093 0.00
crit 7.85 19.98% 186024.85 169082 227403 186123.27 169082 215595 1459890 1459890 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17665 (23183) 20.3% (26.6%) 123.6 3.52sec 84431 50038 0 0 0 0.0% 0.0% 0.0% 0.0% 271.9 24078 49909 29248 20.0% 0.0% 42.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.61 123.61 271.91 271.91 1.6873 0.7023 7952723.11 7952723.11 0.00 50038.26 50038.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.5 79.98% 24077.70 21797 29181 24085.72 23426 24840 5236520 5236520 0.00
crit 54.4 20.02% 49908.64 44901 60113 49923.74 47809 52529 2716203 2716203 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5518 6.3% 85.0 5.05sec 29222 0 24063 49877 29234 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.99 84.95 0.00 0.00 0.0000 0.0000 2483556.53 2483556.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.94 79.97% 24063.04 21797 29181 24070.81 23243 25125 1634723 1634723 0.00
crit 17.02 20.03% 49877.44 44901 60113 49889.60 45287 56539 848834 848834 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 120.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3478 4.0% 14.4 5.25sec 109065 93828 89682 186142 109062 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.38 14.38 0.00 0.00 1.1624 0.0000 1568149.85 1568149.85 0.00 93828.15 93828.15
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.49 79.91% 89682.44 79678 107383 89750.66 81491 99713 1030367 1030367 0.00
crit 2.89 20.09% 186141.90 164137 221210 177764.46 0 221210 537783 537783 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4493 5.2% 10.9 38.19sec 186253 157337 153702 318187 186261 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.90 10.90 0.00 0.00 1.1838 0.0000 2030278.74 2030278.74 0.00 157337.16 157337.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.74 80.21% 153701.98 141188 190440 153708.07 141188 167882 1343862 1343862 0.00
crit 2.16 19.79% 318187.39 290847 392307 286790.50 0 392307 686417 686417 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9912 (13029) 11.4% (15.0%) 60.3 7.31sec 97289 83379 0 0 0 0.0% 0.0% 0.0% 0.0% 243.8 13900 28733 18318 29.8% 0.0% 88.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.33 60.33 243.79 243.79 1.1668 1.6399 4465813.85 4465813.85 0.00 12484.20 83378.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.33 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 171.2 70.21% 13899.83 12783 17110 13901.37 13374 14398 2379273 2379273 0.00
crit 72.6 29.79% 28732.87 26333 35247 28735.62 27545 30147 2086541 2086541 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3117 3.6% 76.3 5.77sec 18394 0 13952 28852 18405 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.33 76.29 0.00 0.00 0.0000 0.0000 1404055.08 1404055.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.49 70.11% 13951.84 12783 17110 13954.55 13455 14610 746223 746223 0.00
crit 22.80 29.89% 28851.87 26333 35247 28855.84 27118 30961 657832 657832 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.57sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2196 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3731 4.3% 81.5 5.43sec 20634 0 17411 35013 20911 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.50 80.42 0.00 0.00 0.0000 0.0000 1681685.78 1681685.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.43 80.12% 17410.54 15875 21413 17413.74 16798 18096 1121811 1121811 0.00
crit 15.99 19.88% 35013.20 31750 42826 35019.10 32241 38323 559875 559875 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7576 (9941) 8.7% (11.4%) 22.2 19.94sec 201346 171839 0 0 0 0.0% 0.0% 0.0% 0.0% 179.1 15722 32559 19056 19.8% 0.0% 84.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.24 22.24 179.06 179.06 1.1717 2.1252 3412185.84 3412185.84 0.00 11011.63 171838.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 143.6 80.20% 15721.51 14287 19397 15725.02 15221 16402 2257735 2257735 0.00
crit 35.5 19.80% 32559.39 29431 39957 32566.95 30597 34817 1154451 1154451 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2365 2.7% 55.9 7.69sec 19055 0 15717 32542 19067 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.90 55.87 0.00 0.00 0.0000 0.0000 1065240.53 1065240.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.75 80.09% 15717.16 14287 19397 15720.03 14961 16499 703291 703291 0.00
crit 11.12 19.91% 32541.76 29431 39957 32547.30 29431 36448 361949 361949 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46713 / 3721
melee 46713 4.2% 31.4 12.66sec 52943 52123 46064 92994 52943 20.5% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.36 31.36 0.00 0.00 1.0158 0.0000 1660434.15 1660434.15 0.00 52123.12 52123.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.47 55.69% 46063.50 36329 55931 46075.82 40911 51707 804593 804593 0.00
crit 6.42 20.46% 92994.41 72658 111863 92957.51 0 111863 596680 596680 0.00
glance 7.48 23.85% 34649.01 27247 41949 34665.71 0 41949 259161 259161 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.55sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.98 5.98 0.00 0.00 1.1364 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.69%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.9sec 108.9sec 19.95% 19.95%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.95%

    Trigger Attempt Success

    • trigger_pct:16.33%
jade_serpent_potion 1.0 0.0 420.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.4 36.1sec 20.1sec 44.71% 45.40%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.71%

    Trigger Attempt Success

    • trigger_pct:2.42%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.16% 41.16%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.16%

    Trigger Attempt Success

    • trigger_pct:15.05%
power_infusion 4.3 0.0 121.3sec 120.9sec 18.56% 20.48%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.3sec 10.3sec 9.74% 46.59%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.74%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.17% 14.17%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.5sec 74.5sec 83.39% 77.65%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi
devouring_plague Shadow Orb 16.3 48.8 3.0 3.0 119373.2
halo Mana 10.6 396465.8 37532.7 37533.0 3.6
mind_blast Mana 39.3 342434.3 8718.7 8718.8 12.5
mind_flay Mana 123.6 351734.5 2845.6 2845.6 29.7
shadow_word_death Mana 14.4 108077.5 7516.5 7516.8 14.5
shadow_word_insanity Mana 10.9 81400.8 7467.3 7467.5 24.9
shadow_word_pain Mana 60.3 774049.3 12829.4 12829.3 7.6
vampiric_touch Mana 22.2 192031.5 8635.4 8635.5 23.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 2.28 41014.08 (2.06%) 18000.00 0.00 0.00%
shadowfiend Mana 31.36 236542.61 (11.89%) 7542.16 45721.87 16.20%
Shadow Orbs from Mind Blast Shadow Orb 39.28 39.28 (83.67%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.66 7.66 (16.33%) 1.00 0.00 0.00%
Devouring Plague Health Health 160.63 0.00 (-nan%) 0.00 2230585.06 100.00%
Vampiric Touch Mana Mana 234.94 1185703.82 (59.62%) 5046.94 56297.14 4.53%
mp5_regen Mana 1806.22 525489.63 (26.42%) 290.93 16375.94 3.02%
Resource RPS-Gain RPS-Loss
Mana 4403.01 4972.98
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 42551.57 0.00 275880.00
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
shadowfiend-Mana Cap 3.1%
lightwell-Mana Cap 3.1%

Procs

Count Interval
Shadowy Recall Extra Tick 255.3 1.7sec
Shadowy Apparition Procced 81.5 5.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_pi_swi Damage Per Second
Count 49992
Mean 87168.89
Minimum 75192.44
Maximum 96093.68
Spread ( max - min ) 20901.24
Range [ ( max - min ) / 2 * 100% ] 11.99%
Standard Deviation 3320.2637
5th Percentile 80580.85
95th Percentile 91771.82
( 95th Percentile - 5th Percentile ) 11190.97
Mean Distribution
Standard Deviation 14.8499
95.00% Confidence Intervall ( 87139.78 - 87197.99 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5573
0.1 Scale Factor Error with Delta=300 94108
0.05 Scale Factor Error with Delta=300 376433
0.01 Scale Factor Error with Delta=300 9410849
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 87168.89
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37602072.51
Distribution Chart

DTPS

Sample Data priest_90_pi_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 325.49
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 3.94 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.38 shadow_word_death,if=active_enemies<=5
F 44.01 mind_blast,if=active_enemies<=6&cooldown_react
G 18.46 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 24.83 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 10.90 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.56 halo,if=talent.halo.enabled
M 12.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 58.90 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 26.97 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 50.66 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 41.88 shadow_word_pain,moving=1
X 0.37 dispersion

Sample Sequence

CDGLWFHTQFTHFIGMTWWWWWFTHTLFTFIGHTWWWFMTHFTIGFLTWWWHFMTQFTIGFHTCGWWFHLMTFTHFIGTWWWWFTHTFMLTIGFTHBWWFHTQFTIFGHMLWWWWFTFHTIGFTCGWWFHMTLTFTHFGTWWWWFTHTFMTLTIFGTWWWFHTQFMTIFGHTLWWWFTHFHMTIGFTBCGWFHTLTFEDETFGEEHWWWWFDEEHTFTEETIFGDHEEW9WWFPEDETFHPEETIFDGEEW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl : 89601 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
89600.8 89600.8 22.65 / 0.03% 4162 / 4.6% 17.8 4826.0 4333.8 Mana 0.80% 38.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.43 0.00 2.74 2.24 1.50 1.26 1.54
Normalized 1.00 0.00 0.80 0.65 0.44 0.37 0.45
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=3.43, SpellDamage=2.74, HitRating=2.24, CritRating=1.50, HasteRating=1.26, MasteryRating=1.54 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=3.43, SpellDamage=2.74, HitRating=0.00, CritRating=1.50, HasteRating=1.26, MasteryRating=1.54 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311507|164295|117401|105006|95711|88500|79305|46991&chds=0,623014&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311507++devouring_plague,9482C9,0,0,15|t++164295++vampiric_touch,9482C9,1,0,15|t++117401++halo,9482C9,2,0,15|t++105006++shadow_word_death,9482C9,3,0,15|t++95711++shadow_word_pain,9482C9,4,0,15|t++88500++mind_blast,9482C9,5,0,15|t++79305++mind_spike,4A79D3,6,0,15|t++46991++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,12,12,9,8,8,6,6,5,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowy_apparition|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.43,2.74,2.24,1.54,1.50,1.26|3.40,2.71,2.21,1.51,1.47,1.23|3.46,2.77,2.28,1.58,1.54,1.30&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.43++Int,FFFFFF,0,0,15,0.1,e|t++++2.74++SP,FFFFFF,0,1,15,0.1,e|t++++2.24++Hit,FFFFFF,0,2,15,0.1,e|t++++1.54++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.50++Crit,FFFFFF,0,4,15,0.1,e|t++++1.26++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.128&chtt=Scale Factors|priest_90_tof_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:35443222211z13111z00xvttsrsssrrqqqqqpponmmmmmmnmlkjiiigfffffgggggffffffghgghiiiiihgffefffggggggfffeeeefgghhhhhgeddcccddeeefffeeeeeefghiijihhggfeedfefffffffffgghhiijjjkjjjihfghhiijijjlmlllllllmnonmmllllkjigghhhiijjjjiiiiiiiiijkkjjjhfedcccccccddddccccccefghhiijjihggffgfffgggffeeeeeffgghhihhhgfeefeeeeefffffefffffgiiiijjjkkjjjjjkkklllmmmllmmnnnoooppoopnlkijjkllmnopqrrrssrrtvwxwwvvvutrpomnmmmnnnnnmmnnnoopqqrssssrpqqrqrqqqqqrqqqqqqqqrttttuuvvvvvwwwxyyz000000000000001010zzwtssrqqpoonnnmmlmmmmmoqrrrsstuuutttttssrrrrqqppppoooopooooonmllkllmnoppqrsuvwxxyz1346678&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6193,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=89601|max=144674&chxp=1,1,62,100&chtt=priest_90_tof_fdcl DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,0,8,16,8,24,32,40,64,72,56,136,104,160,208,200,160,136,336,352,456,504,760,1072,1288,1872,2376,2808,3464,3512,4104,3864,3840,3368,3328,2704,2192,1784,1536,872,712,544,376,336,80,48,24,24,8&chds=0,4104&chbh=5&chxt=x&chxl=0:|min=75490|avg=89601|max=97636&chxp=0,1,64,100&chtt=priest_90_tof_fdcl DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:42.3,13.8,11.6,8.9,6.1,4.5,4.0,2.9,0.5,0.0,0.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 191.1s|shadow_word_pain 62.4s|mind_blast 52.2s|mind_spike 40.4s|vampiric_touch 27.4s|devouring_plague 20.3s|shadow_word_death 18.1s|halo 13.2s|shadowfiend 2.5s|dispersion 0.2s|waiting 3.6s&chtt=priest_90_tof_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl 89601
devouring_plague 5369 (13993) 6.0% (15.6%) 17.0 27.56sec 371668 311507 117162 242764 142472 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.01 17.01 0.00 0.00 1.1932 0.0000 2422936.80 2422936.80 0.00 311506.94 311506.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.58 79.85% 117162.45 102399 157653 117189.54 106981 127733 1591035 1591035 0.00
crit 3.43 20.15% 242764.41 210941 324765 236520.07 0 324765 831902 831902 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2058 2.3% 39.6 10.68sec 23505 0 19406 40215 23541 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.57 39.51 0.00 0.00 0.0000 0.0000 930019.71 930019.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.66 80.13% 19405.68 17006 26181 19406.85 17808 21303 614304 614304 0.00
crit 7.85 19.87% 40215.44 35032 53932 40191.10 0 53932 315716 315716 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6567 7.3% 17.0 27.56sec 174511 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.6 19335 40062 23440 19.8% 0.0% 21.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.01 17.01 126.62 126.62 0.0000 0.7573 2967830.71 2967830.71 0.00 30950.37 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.5 80.20% 19335.40 17006 26181 19336.20 18347 20654 1963383 1963383 0.00
crit 25.1 19.80% 40062.09 35032 53932 40059.39 35949 45151 1004448 1004448 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3431) 0.0% (3.8%) 11.2 41.43sec 138467 117401 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 1.1795 0.0000 0.00 0.00 0.00 117401.13 117401.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3431 3.8% 11.2 41.43sec 138467 0 114444 237037 138463 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 0.0000 0.0000 1546290.25 1546290.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.40% 114443.76 104363 153137 114410.55 106065 126630 1027571 1027571 0.00
crit 2.19 19.60% 237036.53 214987 315462 216360.40 0 315462 518719 518719 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.43sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.17 121.96 0.00 0.00 0.0000 0.0000 0.00 24269335.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.92 77.01% 0.00 0 0 0.00 0 0 0 15003477 100.00
crit 28.04 22.99% 0.00 0 0 0.00 0 0 0 9265859 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10241 11.4% 41.4 10.84sec 111627 88500 92017 190576 111627 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.39 41.39 0.00 0.00 1.2613 0.0000 4620501.92 4620501.92 0.00 88500.10 88500.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.16 80.10% 92016.87 82079 126948 92035.98 87851 96612 3050938 3050938 0.00
crit 8.24 19.90% 190575.62 169082 261513 190598.62 169082 255565 1569564 1569564 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15171 (19919) 16.9% (22.2%) 111.8 3.93sec 80345 46991 0 0 0 0.0% 0.0% 0.0% 0.0% 232.2 24279 50323 29460 19.9% 0.0% 38.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.77 111.77 232.16 232.16 1.7098 0.7405 6839379.18 6839379.18 0.00 46991.44 46991.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.0 80.11% 24278.66 21797 33558 24285.80 23554 25075 4515207 4515207 0.00
crit 46.2 19.89% 50322.63 44901 69130 50340.51 47745 54284 2324172 2324172 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4748 5.3% 72.7 5.97sec 29457 0 24277 50284 29471 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.67 72.63 0.00 0.00 0.0000 0.0000 2140591.74 2140591.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.13 80.03% 24276.56 21797 33558 24283.28 23075 25660 1411163 1411163 0.00
crit 14.51 19.97% 50283.55 44901 69130 50295.94 44901 58061 729429 729429 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7093 7.9% 34.2 12.54sec 93664 79305 77136 159866 93663 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.17 34.17 0.00 0.00 1.1811 0.0000 3200115.16 3200115.16 0.00 79305.00 79305.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.34 80.02% 77135.99 68964 106992 77134.83 72394 83875 2108934 2108934 0.00
crit 6.83 19.98% 159865.85 142066 220403 159669.58 0 220403 1091181 1091181 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4205 4.7% 15.2 4.98sec 125516 105006 102983 213485 125514 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.16 15.16 0.00 0.00 1.1954 0.0000 1902283.68 1902283.68 0.00 105005.72 105005.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.07 79.61% 102983.42 79678 123491 103073.87 92664 113270 1242524 1242524 0.00
crit 3.09 20.39% 213485.07 164137 254391 205392.72 0 254391 659759 659759 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10068 (13235) 11.2% (14.8%) 52.8 8.46sec 113159 95711 0 0 0 0.0% 0.0% 0.0% 0.0% 243.2 14176 29319 18686 29.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.79 52.79 243.22 243.22 1.1823 1.7838 4544828.30 4544828.30 0.00 12036.94 95711.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 170.8 70.22% 14176.38 12783 19677 14175.54 13690 14740 2421188 2421188 0.00
crit 72.4 29.78% 29318.55 26333 40534 29317.20 27988 30936 2123640 2123640 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3166 3.5% 76.1 5.84sec 18776 0 14253 29488 18791 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.09 76.03 0.00 0.00 0.0000 0.0000 1428707.30 1428707.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.38 70.21% 14253.22 12783 19677 14255.21 13508 15037 760856 760856 0.00
crit 22.65 29.79% 29487.88 26333 40534 29494.22 27110 32564 667851 667851 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2189 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3814 4.3% 82.0 5.44sec 21004 0 17769 35735 21340 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.98 80.68 0.00 0.00 0.0000 0.0000 1721778.94 1721778.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.65 80.12% 17768.59 15875 24625 17769.18 16795 18854 1148655 1148655 0.00
crit 16.04 19.88% 35735.19 31750 49250 35739.15 32711 40523 573124 573124 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7592 (9973) 8.5% (11.1%) 22.7 19.78sec 197847 164295 0 0 0 0.0% 0.0% 0.0% 0.0% 176.8 15972 33072 19365 19.8% 0.0% 86.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.74 22.74 176.85 176.85 1.2043 2.2201 3424628.01 3424628.01 0.00 10711.74 164294.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.8 80.16% 15972.15 14287 22306 15973.09 15310 16632 2264121 2264121 0.00
crit 35.1 19.84% 33072.05 29431 45950 33071.77 31074 35619 1160507 1160507 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2381 2.7% 55.3 7.87sec 19430 0 16037 33186 19445 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.29 55.24 0.00 0.00 0.0000 0.0000 1074251.28 1074251.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.26 80.12% 16037.18 14287 22306 16037.34 15150 17050 709869 709869 0.00
crit 10.98 19.88% 33185.93 29431 45950 33188.29 29431 38624 364382 364382 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46485 / 3697
melee 46485 4.1% 31.3 12.68sec 52688 51799 45916 92730 52689 20.3% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.32 31.32 0.00 0.00 1.0172 0.0000 1650121.12 1650121.12 0.00 51799.38 51799.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 55.56% 45916.10 36329 55931 45924.37 40496 51860 798907 798907 0.00
crit 6.37 20.33% 92729.89 72658 111863 92608.12 0 111863 590392 590392 0.00
glance 7.55 24.12% 34533.53 27247 41949 34547.51 0 41949 260823 260823 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.63sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.1972 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.45%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.98% 19.98%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.98%

    Trigger Attempt Success

    • trigger_pct:16.48%
glyph_mind_spike 24.3 9.9 17.8sec 12.5sec 33.83% 48.70%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:26.79%
  • glyph_mind_spike_2:7.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.54% 43.89%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.54%

    Trigger Attempt Success

    • trigger_pct:2.37%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.17% 41.17%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.17%

    Trigger Attempt Success

    • trigger_pct:14.97%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.1sec 10.1sec 9.92% 48.50%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.92%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 30.1 4.7 14.3sec 12.3sec 17.99% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:16.61%
  • surge_of_darkness_2:1.39%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 109.2 0.0sec 0.7sec 16.43% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.19% 14.19%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.6sec 74.6sec 83.39% 77.53%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl
devouring_plague Shadow Orb 17.0 51.0 3.0 3.0 123889.2
halo Mana 11.2 452271.6 40500.0 40499.9 3.4
mind_blast Mana 41.4 372529.4 9000.0 9000.0 12.4
mind_flay Mana 111.8 335302.6 3000.0 3000.0 26.8
shadow_word_death Mana 15.2 118218.0 7800.0 7800.2 16.1
shadow_word_pain Mana 52.8 696820.6 13200.0 13200.2 8.6
vampiric_touch Mana 22.7 204652.8 9000.0 9000.0 22.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.22 4020.48 (0.21%) 18000.00 0.00 0.00%
shadowfiend Mana 31.32 250571.28 (12.80%) 8000.65 31298.64 11.10%
Shadow Orbs from Mind Blast Shadow Orb 41.39 41.39 (84.11%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.82 7.82 (15.89%) 1.00 0.00 0.00%
Devouring Plague Health Health 166.12 0.00 (-nan%) 0.00 2306883.65 100.00%
Vampiric Touch Mana Mana 232.09 1177312.08 (60.14%) 5072.64 49497.36 4.03%
mp5_regen Mana 1806.22 525574.22 (26.85%) 290.98 16291.34 3.01%
Resource RPS-Gain RPS-Loss
Mana 4333.78 4825.98
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 77687.95 0.00 270000.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
shadowfiend-Mana Cap 3.1%
lightwell-Mana Cap 3.1%

Procs

Count Interval
Shadowy Recall Extra Tick 243.4 1.8sec
Shadowy Apparition Procced 82.0 5.4sec
FDCL Mind Spike proc 34.8 12.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl Damage Per Second
Count 49992
Mean 89600.75
Minimum 75490.01
Maximum 97635.64
Spread ( max - min ) 22145.62
Range [ ( max - min ) / 2 * 100% ] 12.36%
Standard Deviation 2584.0941
5th Percentile 85132.07
95th Percentile 93455.75
( 95th Percentile - 5th Percentile ) 8323.69
Mean Distribution
Standard Deviation 11.5573
95.00% Confidence Intervall ( 89578.10 - 89623.40 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 31
0.1% Error 3195
0.1 Scale Factor Error with Delta=300 57003
0.05 Scale Factor Error with Delta=300 228013
0.01 Scale Factor Error with Delta=300 5700334
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 89600.75
Distribution Chart

Damage

Sample Data
Count 49992
Mean 38764142.98
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 287.68
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.00 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.16 shadow_word_death,if=active_enemies<=5
F 45.62 mind_blast,if=active_enemies<=6&cooldown_react
G 18.94 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 24.62 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.10 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.17 halo,if=talent.halo.enabled
M 13.01 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 17.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.04 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 31.07 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.51 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 33.85 shadow_word_pain,moving=1
X 0.04 dispersion

Sample Sequence

DGLWFHTFTHFMGTWWWRWFRRTHTLFTFGMRHRWFWTRQFTTHTFMRGLRRTFWRWRHTFTTFMTRTGHFTGWWHLFTRFMRTHTGFTWWWWFTHRTFMLRTFGTRBWWFHTFRTFGHMLTWWWWFTHQFTFGTGWWFHMLTFTRTFGHRTWWWRFTFHTLTFGMRTRFRHRTFJRGTFMTHRTFWLWWTFTHRTFMTGQFTBGRHFTLRTEDEFTGHTEEFRWWWTEDEFHRTTPEEFMLRTGEER9FWHREDEFRTTEEFHMGRTEEW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb : 91839 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
91838.7 91838.7 16.18 / 0.02% 3041 / 3.3% 16.1 5083.9 4701.1 Mana 0.29% 31.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.48 0.00 2.80 2.04 1.46 1.09 1.36
Normalized 1.00 0.00 0.80 0.59 0.42 0.31 0.39
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.00 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=3.48, SpellDamage=2.80, HitRating=2.04, CritRating=1.46, HasteRating=1.09, MasteryRating=1.36 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=3.48, SpellDamage=2.80, HitRating=0.00, CritRating=1.46, HasteRating=1.09, MasteryRating=1.36 )

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:312705|162578|117728|104949|87909|87902|47882&chds=0,625411&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++312705++devouring_plague,9482C9,0,0,15|t++162578++vampiric_touch,9482C9,1,0,15|t++117728++halo,9482C9,2,0,15|t++104949++shadow_word_death,9482C9,3,0,15|t++87909++shadow_word_pain,9482C9,4,0,15|t++87902++mind_blast,9482C9,5,0,15|t++47882++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,13,12,12,9,8,7,6,5,5,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.48,2.80,2.04,1.46,1.36,1.09|3.45,2.77,2.01,1.44,1.34,1.07|3.50,2.82,2.06,1.49,1.39,1.11&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.48++Int,FFFFFF,0,0,15,0.1,e|t++++2.80++SP,FFFFFF,0,1,15,0.1,e|t++++2.04++Hit,FFFFFF,0,2,15,0.1,e|t++++1.46++Crit,FFFFFF,0,3,15,0.1,e|t++++1.36++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.09++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,4.182&chtt=Scale Factors|priest_90_tof_mb%20Damage%20Per%20Second&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:xz134221211012002z00ywurpmpoooonmnnnmllkjjjjkkliihfeddccddffghjjlklmmmnopqppqponmljhgeeedddddddbcbbabbccdfgfffecbaabdegijklnonnonnnopqqqrpnljigfdbcccccdddccccdefffgghihhhgfedeeffffffghihjjkkklmmnnnnmmmmlkihiihghghhggggghgggghhiihhgedbbacccdegghihijkllmopqqsrqponkjighgfeedddcbcbcccdeffghgffeddccccdeefghhiijkmnnoqqrrsssrqponmlmmlkjjjjjjjjkklmmmmnonnnljihhgggghhijjkklmnoprtuvvwxyxvvtsqpoonmlkkkkjkklkmmnoppqrrrqopppooooopqrrsrtuuvwy0001223332100z0zzzzyyyyxxxyyyyzzzz0zyxvsrqpoonmmmnoopprstvwz23446778776543310zyxwwvuuuuuvvvvvwwwvvusttsrrrqqrrsttstutuuwyxxxz0&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6255,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=91839|max=146827&chxp=1,1,63,100&chtt=priest_90_tof_mb DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,8,24,48,48,64,96,144,264,376,368,488,776,1048,1040,1232,1560,1984,1856,2400,2584,2728,2992,2888,2808,2600,2880,2616,2184,1856,1624,1512,1376,1176,920,816,624,464,384,248,200,248,120,88,88,56,32,24,8&chds=0,2992&chbh=5&chxt=x&chxl=0:|min=85297|avg=91839|max=98291&chxp=0,1,50,100&chtt=priest_90_tof_mb DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:48.5,15.5,11.4,6.1,4.4,4.0,3.0,1.8,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 219.2s|shadow_word_pain 69.8s|mind_blast 51.6s|vampiric_touch 27.4s|devouring_plague 19.9s|shadow_word_death 18.3s|halo 13.3s|mindbender 8.3s|dispersion 0.0s|waiting 1.3s&chtt=priest_90_tof_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb 91839
devouring_plague 5283 (13764) 5.8% (15.0%) 16.7 27.97sec 372191 312705 117567 243273 142741 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 0.00 0.00 1.1902 0.0000 2387051.68 2387051.68 0.00 312705.38 312705.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.37 79.97% 117567.30 102399 157653 117599.49 107562 127344 1572326 1572326 0.00
crit 3.35 20.03% 243273.42 210941 324765 237694.34 0 324765 814725 814725 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2025 2.2% 38.9 10.83sec 23583 0 19440 40273 23621 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.86 38.80 0.00 0.00 0.0000 0.0000 916406.70 916406.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.01 79.93% 19439.53 17006 26181 19443.15 17837 21306 602825 602825 0.00
crit 7.79 20.07% 40272.87 35032 53932 40236.50 0 51512 313582 313582 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6456 7.0% 16.7 27.97sec 174649 0 0 0 0 0.0% 0.0% 0.0% 0.0% 124.2 19401 40193 23514 19.8% 0.0% 20.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.72 16.72 124.21 124.21 0.0000 0.7553 2920629.56 2920629.56 0.00 31132.13 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.6 80.22% 19400.90 17006 26181 19402.14 18224 20478 1933100 1933100 0.00
crit 24.6 19.78% 40193.34 35032 53932 40191.89 36890 44315 987530 987530 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3476) 0.0% (3.8%) 11.3 41.45sec 138989 117728 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 1.1806 0.0000 0.00 0.00 0.00 117728.02 117728.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.08 80.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.60% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3476 3.8% 11.3 41.45sec 138989 0 114686 237141 138991 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.29 11.29 0.00 0.00 0.0000 0.0000 1568961.26 1568961.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.05 80.15% 114686.22 104363 153137 114636.70 105092 124400 1037674 1037674 0.00
crit 2.24 19.85% 237140.90 214987 315462 216888.08 0 315462 531288 531288 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.45sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.29 123.25 0.00 0.00 0.0000 0.0000 0.00 24552631.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.03 77.10% 0.00 0 0 0.00 0 0 0 15207029 100.00
crit 28.22 22.90% 0.00 0 0 0.00 0 0 0 9345602 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10043 10.9% 40.6 11.09sec 111736 87902 92133 190924 111737 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.62 40.62 0.00 0.00 1.2712 0.0000 4539166.70 4539166.70 0.00 87901.91 87901.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.56 80.16% 92133.38 82079 126948 92151.08 87505 96396 3000126 3000126 0.00
crit 8.06 19.84% 190923.84 169082 261513 190937.79 0 225971 1539041 1539041 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17740 (23285) 19.3% (25.3%) 124.3 3.56sec 84413 47882 0 0 0 0.0% 0.0% 0.0% 0.0% 271.4 24300 50377 29468 19.8% 0.0% 44.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 124.34 124.34 271.38 271.38 1.7629 0.7409 7996856.77 7996856.77 0.00 47881.93 47881.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 217.6 80.18% 24300.42 21797 33558 24305.86 23766 25111 5287784 5287784 0.00
crit 53.8 19.82% 50376.65 44901 69130 50388.93 47927 53219 2709073 2709073 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5544 6.0% 84.8 5.16sec 29464 0 24286 50369 29478 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.82 84.78 0.00 0.00 0.0000 0.0000 2499150.41 2499150.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 67.90 80.09% 24286.11 21797 33558 24290.89 23322 25520 1649145 1649145 0.00
crit 16.88 19.91% 50368.53 44901 69130 50382.10 45980 56523 850006 850006 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1967 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4228 4.6% 15.3 4.94sec 125451 104949 103046 213771 125449 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.27 15.27 0.00 0.00 1.1954 0.0000 1915527.20 1915527.20 0.00 104948.89 104948.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.18 79.77% 103046.18 79678 123491 103136.81 92541 113498 1255051 1255051 0.00
crit 3.09 20.23% 213771.16 164137 254391 205737.75 0 254391 660477 660477 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10329 (13580) 11.3% (14.8%) 59.0 7.59sec 103972 87909 0 0 0 0.0% 0.0% 0.0% 0.0% 249.6 14183 29333 18695 29.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.01 59.01 249.61 249.61 1.1827 1.7397 4666384.41 4666384.41 0.00 12171.75 87909.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.3 70.22% 14183.43 12783 19677 14181.48 13641 14633 2486078 2486078 0.00
crit 74.3 29.78% 29332.67 26333 40534 29328.12 28100 31131 2180306 2180306 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3252 3.5% 78.1 5.71sec 18799 0 14263 29517 18813 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.12 78.06 0.00 0.00 0.0000 0.0000 1468553.52 1468553.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.78 70.17% 14263.45 12783 19677 14263.81 13597 15164 781322 781322 0.00
crit 23.28 29.83% 29516.75 26333 40534 29520.86 27241 32822 687232 687232 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3872 4.2% 83.3 5.37sec 21002 0 17785 35764 21362 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.27 81.87 0.00 0.00 0.0000 0.0000 1748821.09 1748821.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.58 80.11% 17784.62 15875 24625 17784.01 16995 18648 1166325 1166325 0.00
crit 16.29 19.89% 35763.88 31750 49250 35760.63 32187 44465 582496 582496 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7504 (9858) 8.2% (10.7%) 22.5 20.15sec 197778 162578 0 0 0 0.0% 0.0% 0.0% 0.0% 174.6 16002 33139 19399 19.8% 0.0% 85.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.50 22.50 174.62 174.62 1.2165 2.2185 3387513.64 3387513.64 0.00 10729.69 162577.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 140.0 80.17% 16001.93 14287 22306 16001.12 15350 16754 2240258 2240258 0.00
crit 34.6 19.83% 33138.58 29431 45950 33139.69 30816 35952 1147255 1147255 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2354 2.6% 54.6 8.02sec 19454 0 16044 33249 19470 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.63 54.58 0.00 0.00 0.0000 0.0000 1062732.74 1062732.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.72 80.09% 16044.08 14287 22306 16045.11 15109 17314 701392 701392 0.00
crit 10.87 19.91% 33249.25 29431 45950 33246.03 29431 39824 361340 361340 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37593 / 9733
melee 37593 10.6% 105.4 4.17sec 41628 39081 36406 73331 41628 20.0% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.39 105.39 0.00 0.00 1.0652 0.0000 4387029.03 4387029.03 0.00 39080.92 39080.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.00 55.98% 36405.91 29063 44745 36424.31 34697 38449 2147848 2147848 0.00
crit 21.11 20.03% 73331.25 58126 89490 73363.82 66479 80295 1547844 1547844 0.00
glance 25.28 23.99% 27345.18 21797 33559 27356.63 25118 30542 691336 691336 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1899 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.52%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.99% 19.99%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.99%

    Trigger Attempt Success

    • trigger_pct:16.44%
jade_serpent_potion 1.0 0.0 420.8sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.73% 44.10%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.73%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.5 0.0 49.2sec 49.2sec 41.28% 41.28%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.28%

    Trigger Attempt Success

    • trigger_pct:14.88%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.3sec 10.3sec 9.82% 49.41%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.82%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.0 112.7 0.0sec 0.7sec 16.44% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.95%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb
devouring_plague Shadow Orb 16.7 50.2 3.0 3.0 124062.1
halo Mana 11.3 457177.0 40500.0 40499.8 3.4
mind_blast Mana 40.6 365618.9 9000.0 9000.1 12.4
mind_flay Mana 124.3 373023.4 3000.0 3000.0 28.1
shadow_word_death Mana 15.3 119102.9 7800.0 7800.2 16.1
shadow_word_pain Mana 59.0 778869.7 13200.0 13199.9 7.9
vampiric_touch Mana 22.5 202511.5 9000.0 9000.0 22.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.02 336.96 (0.02%) 18000.00 0.00 0.00%
mindbender Mana 105.39 443260.93 (20.88%) 4206.01 18436.78 3.99%
Shadow Orbs from Mind Blast Shadow Orb 40.62 40.62 (84.02%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.73 7.73 (15.98%) 1.00 0.00 0.00%
Devouring Plague Health Health 163.01 0.00 (-nan%) 0.00 2263635.19 100.00%
Vampiric Touch Mana Mana 229.20 1157276.85 (54.50%) 5049.16 54186.03 4.47%
mp5_regen Mana 1806.22 522529.00 (24.61%) 289.29 19336.57 3.57%
Resource RPS-Gain RPS-Loss
Mana 4701.13 5083.92
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 127102.11 61.90 258504.76
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.6%
shadowfiend-Mana Cap 3.6%
lightwell-Mana Cap 3.6%

Procs

Count Interval
Shadowy Recall Extra Tick 256.2 1.7sec
Shadowy Apparition Procced 83.3 5.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_tof_mb Damage Per Second
Count 49992
Mean 91838.69
Minimum 85297.27
Maximum 98290.78
Spread ( max - min ) 12993.51
Range [ ( max - min ) / 2 * 100% ] 7.07%
Standard Deviation 1845.5349
5th Percentile 88862.55
95th Percentile 94944.59
( 95th Percentile - 5th Percentile ) 6082.04
Mean Distribution
Standard Deviation 8.2541
95.00% Confidence Intervall ( 91822.52 - 91854.87 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1551
0.1 Scale Factor Error with Delta=300 29075
0.05 Scale Factor Error with Delta=300 116302
0.01 Scale Factor Error with Delta=300 2907556
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 91838.69
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37077755.68
Distribution Chart

DTPS

Sample Data priest_90_tof_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 240.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.07 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.27 shadow_word_death,if=active_enemies<=5
F 44.87 mind_blast,if=active_enemies<=6&cooldown_react
G 18.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 25.30 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.29 halo,if=talent.halo.enabled
M 12.66 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.01 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.79 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 50.80 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.03 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGLWFHTFTHFGTWWWWWFMTHTLFTFGTHAWWFHMTFTFGHLTWWWWFMTHFHTQFGTAGWFHMLTFTFGHTWWWWFTHQQFMTLTFGTWAWFHTQQFMTHFGTLWWWWFTHHFMTFGTGWAFHTLTFMTGFHTWWWWFTHFMTLTGFTWWAFHTFMTGFHTWLWWFTHFHMTGFTGWWAFHTLTEDEFTEEFGWWWWEDEFHTTEEFMTLTEEFG9WWHAEEFMTTEEFTHTGEDEW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi : 84579 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
84578.6 84578.6 37.05 / 0.04% 6834 / 8.1% 16.2 4988.5 4393.5 Mana 3.86% 49.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 3.29 0.00 2.74 1.95 1.47 1.01 1.67
Normalized 1.00 0.00 0.83 0.59 0.45 0.31 0.51
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.05 0.00 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Mastery > Crit > Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=3.29, SpellDamage=2.74, HitRating=1.95, CritRating=1.47, HasteRating=1.01, MasteryRating=1.67 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=3.29, SpellDamage=2.74, HitRating=0.00, CritRating=1.47, HasteRating=1.01, MasteryRating=1.67 )

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309426|163705|161092|116453|104340|86956|81730|47698&chds=0,618852&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309426++devouring_plague,9482C9,0,0,15|t++163705++vampiric_touch,9482C9,1,0,15|t++161092++shadow_word_insanity,9482C9,2,0,15|t++116453++halo,9482C9,3,0,15|t++104340++shadow_word_death,9482C9,4,0,15|t++86956++mind_blast,9482C9,5,0,15|t++81730++shadow_word_pain,9482C9,6,0,15|t++47698++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,12,9,8,6,6,5,5,5,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_insanity|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:3.29,2.74,1.95,1.67,1.47,1.01|3.23,2.68,1.89,1.62,1.41,0.96|3.34,2.79,2.00,1.72,1.52,1.07&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++3.29++Int,FFFFFF,0,0,15,0.1,e|t++++2.74++SP,FFFFFF,0,1,15,0.1,e|t++++1.95++Hit,FFFFFF,0,2,15,0.1,e|t++++1.67++Mastery,FFFFFF,0,3,15,0.1,e|t++++1.47++Crit,FFFFFF,0,4,15,0.1,e|t++++1.01++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,3.954&chtt=Scale Factors|priest_90_tof_swi%20Damage%20Per%20Second&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:68776444443246344232zxvtsrtttsssqrqqpponmnonoopmmljhhgedddedeefdeceffffhjjkkmmmllkjihgihghhhhfeeeedddehhijkjjkigfeedffggghhfgeeeeeefhhijkjiihgfeecfffffggffeffghiikkmlnmllkjiijjlkllklmmmlmmmmmnprqqqpooonmliijkjjkkkjiihiijiikklmnmlmkihffdeeeeegfddcdddddeghiilkkkkjhhgfhhgghgggfefeeffghjjjlkkjjhhggggggggggfdddddddeghhhijiiihhhgfhhhhhhhggggghiijlmmnoonomkjijjkllmnopqrqrssstvxy0zzzyxwvtrqopoooooonmmmmmnnoqrssttttsqqqqqqqqppppnmmmmmmmnpqpqrrrrrrqqqprqqrrrrqpppppppqrrrrrrrqomllkjjihgfedcbabaaZZaccccddddeeeeeeeeeeefffeeeefffffgggggffecdcdeeghhijmoqrsstuvx013345&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6185,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=84579|max=136750&chxp=1,1,62,100&chtt=priest_90_tof_swi DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,24,32,48,56,104,136,160,200,272,272,496,520,504,608,712,672,888,1040,1144,984,1304,1096,1120,1296,1176,1416,1544,1608,1816,2296,2640,2784,2664,3064,2976,2744,2376,1848,1824,1168,928,560,448,184,72,72,56,32&chds=0,3064&chbh=5&chxt=x&chxl=0:|min=69292|avg=84579|max=94220&chxp=0,1,61,100&chtt=priest_90_tof_swi DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.6,15.4,10.9,5.7,4.3,3.7,2.6,2.6,0.8,0.5,3.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=mind_flay 201.3s|shadow_word_pain 69.5s|mind_blast 49.4s|vampiric_touch 25.9s|devouring_plague 19.3s|shadow_word_death 16.7s|halo 11.9s|shadow_word_insanity 11.7s|dispersion 3.6s|shadowfiend 2.4s|waiting 17.4s&chtt=priest_90_tof_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi 84579
devouring_plague 5100 (13253) 6.0% (15.7%) 16.2 28.86sec 369093 309426 117017 242209 141942 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 0.00 0.00 1.1928 0.0000 2301236.77 2301236.77 0.00 309425.93 309425.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.99 80.09% 117017.10 102399 157653 117047.70 107735 128170 1519476 1519476 0.00
crit 3.23 19.91% 242209.25 210941 324765 235990.47 0 324765 781761 781761 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1938 2.3% 37.4 11.22sec 23421 0 19355 40101 23454 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.38 37.33 0.00 0.00 0.0000 0.0000 875489.24 875489.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.95 80.24% 19355.15 17006 26181 19356.65 17580 21210 579739 579739 0.00
crit 7.38 19.76% 40100.62 35032 53932 40070.67 0 53932 295750 295750 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6215 7.4% 16.2 28.86sec 173152 0 0 0 0 0.0% 0.0% 0.0% 0.0% 119.9 19311 39998 23412 19.8% 0.0% 20.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 119.91 119.91 0.0000 0.7578 2807262.05 2807262.05 0.00 30893.17 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.1 80.17% 19310.57 17006 26181 19312.51 18272 20455 1856436 1856436 0.00
crit 23.8 19.83% 39998.26 35032 53932 39996.64 36500 44187 950826 950826 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3089) 0.0% (3.6%) 10.1 43.83sec 137580 116453 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 10.09 0.00 0.00 1.1814 0.0000 0.00 0.00 0.00 116452.95 116452.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.09 80.24% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.99 19.76% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3089 3.6% 10.1 43.83sec 137580 0 113558 234996 137585 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.09 10.09 0.00 0.00 0.0000 0.0000 1387536.85 1387536.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.09 80.22% 113557.62 104363 153137 113527.11 104363 126355 918709 918709 0.00
crit 2.00 19.78% 234996.35 214987 315462 209241.81 0 315462 468827 468827 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.1 43.83sec 0 0 0 0 0 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.09 110.88 0.00 0.00 0.0000 0.0000 0.00 21903073.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 85.56 77.17% 0.00 0 0 0.00 0 0 0 13589114 100.00
crit 25.32 22.83% 0.00 0 0 0.00 0 0 0 8313960 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9541 11.3% 38.8 11.31sec 110899 86956 91519 189599 110899 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.76 38.76 0.00 0.00 1.2754 0.0000 4298480.61 4298480.61 0.00 86955.69 86955.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.10 80.24% 91518.73 82079 126948 91523.95 86657 96244 2846370 2846370 0.00
crit 7.66 19.76% 189599.45 169082 261513 189675.19 169082 235175 1452111 1452111 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16254 (21329) 19.2% (25.2%) 115.1 3.71sec 83393 47698 0 0 0 0.0% 0.0% 0.0% 0.0% 249.0 24210 50168 29384 19.9% 0.0% 40.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.14 115.14 249.02 249.02 1.7484 0.7391 7317151.45 7317151.45 0.00 47697.56 47697.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 199.4 80.07% 24209.93 21797 33558 24215.16 23467 24980 4827184 4827184 0.00
crit 49.6 19.93% 50168.09 44901 69130 50181.29 47239 53694 2489968 2489968 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5075 6.0% 77.8 5.42sec 29374 0 24201 50163 29384 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.79 77.76 0.00 0.00 0.0000 0.0000 2284939.91 2284939.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.24 80.04% 24200.83 21797 33558 24205.87 23094 25449 1506227 1506227 0.00
crit 15.52 19.96% 50163.18 44901 69130 50183.40 44901 55935 778713 778713 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3853 4.6% 13.9 5.43sec 124847 104340 102590 212621 124848 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.92 13.92 0.00 0.00 1.1966 0.0000 1738408.95 1738408.95 0.00 104340.01 104340.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.11 79.77% 102589.89 79678 123491 102658.70 91547 115750 1139539 1139539 0.00
crit 2.82 20.23% 212621.44 164137 254391 201556.69 0 254391 598870 598870 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4168 4.9% 9.9 42.74sec 190461 161092 157612 326081 190458 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.88 9.88 0.00 0.00 1.1823 0.0000 1882357.35 1882357.35 0.00 161091.77 161091.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.96 80.50% 157611.68 141188 219006 157524.79 141188 180698 1253984 1253984 0.00
crit 1.93 19.50% 326081.04 290847 451153 283820.76 0 451153 628373 628373 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9593 (12606) 11.3% (14.9%) 58.7 7.40sec 96701 81730 0 0 0 0.0% 0.0% 0.0% 0.0% 232.6 14100 29147 18573 29.7% 0.0% 87.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.72 58.72 232.65 232.65 1.1832 1.6994 4320935.27 4320935.27 0.00 12214.93 81730.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.5 70.27% 14099.65 12783 19677 14099.30 13439 14725 2305094 2305094 0.00
crit 69.2 29.73% 29146.73 26333 40534 29145.43 27807 30752 2015841 2015841 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3013 3.6% 72.7 5.97sec 18652 0 14169 29303 18664 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.75 72.70 0.00 0.00 0.0000 0.0000 1356931.15 1356931.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.11 70.30% 14169.06 12783 19677 14169.44 13337 15171 724208 724208 0.00
crit 21.59 29.70% 29302.58 26333 40534 29304.74 27191 32252 632724 632724 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 1.2172 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3630 4.3% 78.0 5.59sec 20978 0 17674 35559 21225 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.96 77.06 0.00 0.00 0.0000 0.0000 1635551.96 1635551.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.76 80.14% 17673.52 15875 24625 17673.90 16868 18660 1091496 1091496 0.00
crit 15.30 19.86% 35559.08 31750 49250 35552.78 32860 40132 544056 544056 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7160 (9403) 8.5% (11.1%) 21.4 20.31sec 197706 163705 0 0 0 0.0% 0.0% 0.0% 0.0% 167.3 15901 32936 19267 19.8% 0.0% 82.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.41 21.41 167.30 167.30 1.2077 2.2140 3223343.83 3223343.83 0.00 10682.68 163704.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.3 80.24% 15901.22 14287 22306 15900.01 15229 16592 2134758 2134758 0.00
crit 33.1 19.76% 32935.86 29431 45950 32935.37 30893 35889 1088586 1088586 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2243 2.7% 52.3 8.05sec 19327 0 15947 33017 19338 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.25 52.22 0.00 0.00 0.0000 0.0000 1009893.63 1009893.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.85 80.13% 15947.34 14287 22306 15946.71 15012 17296 667363 667363 0.00
crit 10.37 19.87% 33016.56 29431 45950 33010.32 0 41880 342531 342531 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46575 / 3706
melee 46575 4.3% 31.4 12.67sec 52749 51902 45936 92599 52749 20.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.36 31.36 0.00 0.00 1.0163 0.0000 1654262.22 1654262.22 0.00 51901.68 51901.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.41 55.53% 45935.51 36329 55931 45942.16 41272 51716 799927 799927 0.00
crit 6.42 20.48% 92599.19 72658 111863 92483.04 0 111863 594758 594758 0.00
glance 7.52 23.99% 34500.37 27247 41949 34491.93 0 41949 259577 259577 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.61sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.97 5.97 0.00 0.00 1.1962 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.84%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.5 0.0 109.3sec 109.3sec 19.88% 19.88%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.88%

    Trigger Attempt Success

    • trigger_pct:16.48%
jade_serpent_potion 1.0 0.0 420.7sec 0.0sec 10.12% 10.12%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.12%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.6sec 20.7sec 43.59% 44.03%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.59%

    Trigger Attempt Success

    • trigger_pct:2.48%
light_of_the_cosmos 9.4 0.0 49.6sec 49.6sec 40.78% 40.78%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:40.78%

    Trigger Attempt Success

    • trigger_pct:14.99%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.1 0.0 9.8sec 9.8sec 10.19% 41.75%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.19%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.0 89.5 0.0sec 0.8sec 16.42% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.6sec 74.6sec 83.39% 77.55%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 123030.1
halo Mana 10.1 408447.4 40500.0 40499.3 3.4
mind_blast Mana 38.8 348841.4 9000.0 9000.0 12.3
mind_flay Mana 115.1 345424.3 3000.0 3000.0 27.8
shadow_word_death Mana 13.9 108610.9 7800.0 7800.1 16.0
shadow_word_insanity Mana 9.9 74122.8 7500.0 7499.9 25.4
shadow_word_pain Mana 58.7 775044.9 13200.0 13199.9 7.3
vampiric_touch Mana 21.4 192702.2 9000.0 8999.8 22.0
Resource Gains Type Count Total Average Overflow
dispersion Mana 4.43 79784.64 (4.02%) 18000.00 0.00 0.00%
shadowfiend Mana 31.36 251482.42 (12.67%) 8018.96 30766.22 10.90%
Shadow Orbs from Mind Blast Shadow Orb 38.76 38.76 (82.77%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.07 8.07 (17.23%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.24 0.00 (-nan%) 0.00 2183517.23 100.00%
Vampiric Touch Mana Mana 219.52 1124852.74 (56.68%) 5124.09 35614.94 3.07%
mp5_regen Mana 1806.22 528334.70 (26.62%) 292.51 13530.86 2.50%
Resource RPS-Gain RPS-Loss
Mana 4393.50 4988.48
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 31265.19 0.00 238200.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.5%
shadowfiend-Mana Cap 2.5%
lightwell-Mana Cap 2.5%

Procs

Count Interval
Shadowy Recall Extra Tick 240.0 1.8sec
Shadowy Apparition Procced 78.0 5.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data priest_90_tof_swi Damage Per Second
Count 49992
Mean 84578.63
Minimum 69292.22
Maximum 94219.71
Spread ( max - min ) 24927.48
Range [ ( max - min ) / 2 * 100% ] 14.74%
Standard Deviation 4226.5071
5th Percentile 76501.59
95th Percentile 90169.16
( 95th Percentile - 5th Percentile ) 13667.57
Mean Distribution
Standard Deviation 18.9030
95.00% Confidence Intervall ( 84541.58 - 84615.68 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 95
0.1% Error 9592
0.1 Scale Factor Error with Delta=300 152491
0.05 Scale Factor Error with Delta=300 609967
0.01 Scale Factor Error with Delta=300 15249193
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 84578.63
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36439519.02
Distribution Chart

DTPS

Sample Data priest_90_tof_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 370.09
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.01 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.02 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 13.92 shadow_word_death,if=active_enemies<=5
F 43.08 mind_blast,if=active_enemies<=6&cooldown_react
G 18.15 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 23.65 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 9.88 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.09 halo,if=talent.halo.enabled
M 12.19 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 109.84 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 33.17 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 47.90 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.57 shadow_word_pain,moving=1
X 0.66 dispersion

Sample Sequence

DGLWFHTFTHFGTWWWWWFMTHTFLTFGTHWWWFHTQQFMTIFGHLTWWWWFTFHMTIGFTGWWFHTLTFMTHFGTWWWWFTHTFMTLIGFTBWWFHTQFMTIFGHTLWWWFTHHFMTIGTFTGWWHFTLTQFMTHIGFTWWWWQFTHTFMTIGLFTWWWFHTFMTIGHFTWWWTFTHTFMTIGTQFTGBWFHTLTQEDEFTHIEEFGWWWTEDEFTHHTEEFIGMTPEEW9WWQQQQQQFPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEDPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPEPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPIPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 350 - 558 ( 451.7 )

Performance:

Total Events Processed: 1116025048
Max Event Queue: 161
Sim Seconds: 22583966
CPU Seconds: 2461.8600
Speed Up: 9174

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Standard Deviation 57.0857
5th Percentile 368.42
95th Percentile 542.27
( 95th Percentile - 5th Percentile ) 173.85
Mean Distribution
Standard Deviation 0.2553
95.00% Confidence Intervall ( 451.18 - 452.18 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 613
0.1% Error 61360
0.1 Scale Factor Error with Delta=300 27
0.05 Scale Factor Error with Delta=300 111
0.01 Scale Factor Error with Delta=300 2781
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl priest_90_di_fdcl devouring_plague 2944 2687612 5950 2.62 112347 232475 19.7 19.7 20.0% 0.0% 0.0% 0.0% 23.63sec 2687612 451.68sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_mastery 124467 1042909 2309 6.15 18587 38456 46.4 46.3 19.8% 0.0% 0.0% 0.0% 9.19sec 1042909 451.68sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_tick ticks -2944 3338826 7420 19.79 18558 38429 19.7 148.4 19.8% 0.0% 0.0% 0.0% 23.63sec 3338826 451.68sec
priest_90_di_fdcl priest_90_di_fdcl dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.68sec
priest_90_di_fdcl priest_90_di_fdcl halo 120644 0 0 1.50 0 0 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.42sec 0 451.68sec
priest_90_di_fdcl priest_90_di_fdcl halo_damage 120696 1534308 3397 1.50 112007 231657 11.3 11.3 20.0% 0.0% 0.0% 0.0% 41.42sec 1534308 451.68sec
priest_90_di_fdcl priest_90_di_fdcl halo_heal 120696 0 0 16.35 0 0 11.3 123.1 22.9% 0.0% 0.0% 0.0% 41.42sec 23956830 451.68sec
priest_90_di_fdcl priest_90_di_fdcl mind_blast 8092 5403698 11964 6.59 89846 186102 49.6 49.6 19.9% 0.0% 0.0% 0.0% 9.06sec 5403698 451.68sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay ticks -15407 6400986 14224 29.36 23962 49654 108.8 220.2 19.9% 0.0% 0.0% 0.0% 4.06sec 6400986 451.68sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay_mastery 124468 2007323 4444 9.15 23956 49670 68.9 68.9 20.2% 0.0% 0.0% 0.0% 6.33sec 2007323 451.68sec
priest_90_di_fdcl priest_90_di_fdcl mind_spike 73510 3149757 6973 4.57 75556 156422 34.4 34.4 19.8% 0.0% 0.0% 0.0% 12.55sec 3149757 451.68sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_death 32379 1677697 3714 2.03 89946 186370 15.3 15.3 20.3% 0.0% 0.0% 0.0% 4.93sec 1677697 451.68sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain ticks -589 4420335 9823 32.15 13909 28746 50.1 241.1 29.8% 0.0% 0.0% 0.0% 8.97sec 4420335 451.68sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain_mastery 124464 1382780 3061 9.99 13944 28830 75.3 75.2 29.8% 0.0% 0.0% 0.0% 5.92sec 1382780 451.68sec
priest_90_di_fdcl priest_90_di_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 451.68sec
priest_90_di_fdcl priest_90_di_fdcl shadowy_apparition 87532 1682258 3724 10.69 17396 34965 81.8 80.5 19.9% 0.0% 0.0% 0.0% 5.46sec 1682258 451.68sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch ticks -34914 3399165 7554 23.83 15687 32484 23.0 178.7 19.9% 0.0% 0.0% 0.0% 19.66sec 3399165 451.68sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch_mastery 124465 1063122 2354 7.42 15689 32490 55.9 55.9 19.8% 0.0% 0.0% 0.0% 7.83sec 1063122 451.68sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend melee 0 1647804 46392 52.90 45898 92770 31.3 31.3 20.2% 0.0% 24.0% 0.0% 12.68sec 1647804 35.52sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.60sec 0 35.52sec
priest_90_di_mb priest_90_di_mb devouring_plague 2944 2589849 5734 2.52 112422 232617 19.0 19.0 19.9% 0.0% 0.0% 0.0% 24.57sec 2589849 451.68sec
priest_90_di_mb priest_90_di_mb devouring_plague_mastery 124467 1001787 2218 5.90 18597 38509 44.5 44.4 19.9% 0.0% 0.0% 0.0% 9.58sec 1001787 451.68sec
priest_90_di_mb priest_90_di_mb devouring_plague_tick ticks -2944 3206159 7125 18.99 18571 38443 19.0 142.5 19.8% 0.0% 0.0% 0.0% 24.57sec 3206159 451.68sec
priest_90_di_mb priest_90_di_mb halo 120644 0 0 1.50 0 0 11.3 11.3 20.0% 0.0% 0.0% 0.0% 41.46sec 0 451.68sec
priest_90_di_mb priest_90_di_mb halo_damage 120696 1533113 3394 1.50 112010 231665 11.3 11.3 19.9% 0.0% 0.0% 0.0% 41.46sec 1533113 451.68sec
priest_90_di_mb priest_90_di_mb halo_heal 120696 0 0 16.35 0 0 11.3 123.0 22.9% 0.0% 0.0% 0.0% 41.46sec 23949800 451.68sec
priest_90_di_mb priest_90_di_mb mind_blast 8092 5168628 11443 6.31 89840 186094 47.5 47.5 19.7% 0.0% 0.0% 0.0% 9.47sec 5168628 451.68sec
priest_90_di_mb priest_90_di_mb mind_flay ticks -15407 7576012 16836 34.73 23959 49654 124.7 260.5 20.0% 0.0% 0.0% 0.0% 3.55sec 7576012 451.68sec
priest_90_di_mb priest_90_di_mb mind_flay_mastery 124468 2369799 5247 10.83 23952 49622 81.6 81.5 19.9% 0.0% 0.0% 0.0% 5.36sec 2369799 451.68sec
priest_90_di_mb priest_90_di_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.82sec 0 451.68sec
priest_90_di_mb priest_90_di_mb shadow_word_death 32379 1665520 3687 2.02 89933 186629 15.2 15.2 20.2% 0.0% 0.0% 0.0% 4.96sec 1665520 451.68sec
priest_90_di_mb priest_90_di_mb shadow_word_pain ticks -589 4505649 10013 32.78 13905 28749 55.0 245.8 29.8% 0.0% 0.0% 0.0% 8.15sec 4505649 451.68sec
priest_90_di_mb priest_90_di_mb shadow_word_pain_mastery 124464 1410624 3123 10.20 13940 28837 76.9 76.8 29.7% 0.0% 0.0% 0.0% 5.80sec 1410624 451.68sec
priest_90_di_mb priest_90_di_mb shadowy_apparition 87532 1697762 3759 10.80 17402 34983 82.7 81.3 19.8% 0.0% 0.0% 0.0% 5.41sec 1697762 451.68sec
priest_90_di_mb priest_90_di_mb vampiric_touch ticks -34914 3362839 7473 23.57 15688 32490 22.9 176.8 19.8% 0.0% 0.0% 0.0% 19.84sec 3362839 451.68sec
priest_90_di_mb priest_90_di_mb vampiric_touch_mastery 124465 1050781 2326 7.34 15691 32503 55.3 55.2 19.8% 0.0% 0.0% 0.0% 7.92sec 1050781 451.68sec
priest_90_di_mb priest_90_di_mb_mindbender melee 0 4384581 37531 54.11 36382 73295 105.4 105.4 20.0% 0.0% 24.0% 0.0% 4.17sec 4384581 116.83sec
priest_90_di_mb priest_90_di_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.30sec 0 116.83sec
priest_90_di_swi priest_90_di_swi devouring_plague 2944 2557643 5663 2.49 112334 232423 18.7 18.7 20.0% 0.0% 0.0% 0.0% 24.86sec 2557643 451.68sec
priest_90_di_swi priest_90_di_swi devouring_plague_mastery 124467 986210 2183 5.81 18583 38490 43.8 43.8 19.8% 0.0% 0.0% 0.0% 9.68sec 986210 451.68sec
priest_90_di_swi priest_90_di_swi devouring_plague_tick ticks -2944 3153598 7008 18.72 18551 38402 18.7 140.4 19.7% 0.0% 0.0% 0.0% 24.86sec 3153598 451.68sec
priest_90_di_swi priest_90_di_swi dispersion 47585 0 0 0.02 0 0 0.1 0.1 0.0% 0.0% 0.0% 0.0% 165.80sec 0 451.68sec
priest_90_di_swi priest_90_di_swi halo 120644 0 0 1.44 0 0 10.8 10.8 19.7% 0.0% 0.0% 0.0% 41.89sec 0 451.68sec
priest_90_di_swi priest_90_di_swi halo_damage 120696 1464025 3241 1.44 111840 231224 10.8 10.8 19.6% 0.0% 0.0% 0.0% 41.89sec 1464025 451.68sec
priest_90_di_swi priest_90_di_swi halo_heal 120696 0 0 15.55 0 0 10.8 117.1 22.9% 0.0% 0.0% 0.0% 41.89sec 22754230 451.68sec
priest_90_di_swi priest_90_di_swi mind_blast 8092 5074340 11234 6.19 89781 185770 46.6 46.6 19.9% 0.0% 0.0% 0.0% 9.55sec 5074340 451.68sec
priest_90_di_swi priest_90_di_swi mind_flay ticks -15407 7091414 15759 32.50 23966 49676 118.0 243.7 19.9% 0.0% 0.0% 0.0% 3.69sec 7091414 451.68sec
priest_90_di_swi priest_90_di_swi mind_flay_mastery 124468 2216492 4907 10.12 23960 49685 76.2 76.2 19.9% 0.0% 0.0% 0.0% 5.64sec 2216492 451.68sec
priest_90_di_swi priest_90_di_swi shadow_word_death 32379 1600504 3543 1.95 89738 186160 14.7 14.7 20.1% 0.0% 0.0% 0.0% 5.15sec 1600504 451.68sec
priest_90_di_swi priest_90_di_swi shadow_word_insanity 129249 2102049 4654 1.49 154240 319218 11.2 11.2 19.8% 0.0% 0.0% 0.0% 38.04sec 2102049 451.68sec
priest_90_di_swi priest_90_di_swi shadow_word_pain ticks -589 4289663 9533 31.23 13897 28725 57.0 234.2 29.8% 0.0% 0.0% 0.0% 7.77sec 4289663 451.68sec
priest_90_di_swi priest_90_di_swi shadow_word_pain_mastery 124464 1345205 2978 9.72 13932 28809 73.2 73.2 29.9% 0.0% 0.0% 0.0% 6.02sec 1345205 451.68sec
priest_90_di_swi priest_90_di_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 451.68sec
priest_90_di_swi priest_90_di_swi shadowy_apparition 87532 1634347 3618 10.40 17386 34940 79.4 78.3 19.9% 0.0% 0.0% 0.0% 5.57sec 1634347 451.68sec
priest_90_di_swi priest_90_di_swi vampiric_touch ticks -34914 3337062 7416 23.40 15675 32456 22.5 175.5 19.9% 0.0% 0.0% 0.0% 19.78sec 3337062 451.68sec
priest_90_di_swi priest_90_di_swi vampiric_touch_mastery 124465 1044962 2314 7.30 15679 32478 55.0 55.0 19.8% 0.0% 0.0% 0.0% 7.82sec 1044962 451.68sec
priest_90_di_swi priest_90_di_swi_shadowfiend melee 0 1647825 46370 52.88 45901 92541 31.3 31.3 20.2% 0.0% 24.0% 0.0% 12.68sec 1647825 35.54sec
priest_90_di_swi priest_90_di_swi_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.61sec 0 35.54sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague 2944 2331911 5163 2.27 112444 232777 17.1 17.1 19.8% 0.0% 0.0% 0.0% 27.48sec 2331911 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_mastery 124467 913552 2023 5.38 18595 38498 40.6 40.5 19.9% 0.0% 0.0% 0.0% 10.46sec 913552 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_tick ticks -2944 2910163 6467 17.26 18550 38374 17.1 129.5 19.8% 0.0% 0.0% 0.0% 27.48sec 2910163 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl halo 120644 0 0 1.50 0 0 11.3 11.3 19.7% 0.0% 0.0% 0.0% 41.34sec 0 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_damage 120696 1535921 3400 1.50 112074 231932 11.3 11.3 19.7% 0.0% 0.0% 0.0% 41.34sec 1535921 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_heal 120696 0 0 16.50 0 0 11.3 124.2 22.9% 0.0% 0.0% 0.0% 41.34sec 24198517 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_blast 8092 4553247 10081 5.54 89968 186143 41.7 41.7 19.9% 0.0% 0.0% 0.0% 10.80sec 4553247 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay ticks -15407 7234407 16076 33.04 24049 49859 117.7 247.8 19.9% 0.0% 0.0% 0.0% 3.76sec 7234407 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay_mastery 124468 2265320 5015 10.30 24044 49840 77.6 77.6 20.0% 0.0% 0.0% 0.0% 5.65sec 2265320 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_spike 73510 3303487 7314 4.78 75730 156972 35.9 35.9 19.9% 0.0% 0.0% 0.0% 12.06sec 3303487 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.03sec 0 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_death 32379 1688961 3739 2.05 90003 186518 15.4 15.4 20.2% 0.0% 0.0% 0.0% 4.90sec 1688961 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain ticks -589 4617525 10261 33.55 13917 28762 52.7 251.6 29.9% 0.0% 0.0% 0.0% 8.51sec 4617525 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain_mastery 124464 1449102 3208 10.45 13966 28891 78.7 78.7 29.8% 0.0% 0.0% 0.0% 5.67sec 1449102 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowy_apparition 87532 1739595 3851 11.04 17427 35047 84.5 83.1 19.9% 0.0% 0.0% 0.0% 5.30sec 1739595 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch ticks -34914 3554245 7898 24.85 15717 32550 23.4 186.4 19.9% 0.0% 0.0% 0.0% 19.35sec 3554245 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch_mastery 124465 1114345 2467 7.75 15733 32607 58.4 58.4 19.9% 0.0% 0.0% 0.0% 7.53sec 1114345 451.68sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend melee 0 1654500 46562 52.87 46045 92925 31.3 31.3 20.4% 0.0% 24.0% 0.0% 12.68sec 1654500 35.53sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.61sec 0 35.53sec
priest_90_pi_mb priest_90_pi_mb devouring_plague 2944 2284261 5057 2.22 112688 233441 16.7 16.7 20.0% 0.0% 0.0% 0.0% 28.10sec 2284261 451.68sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_mastery 124467 893470 1978 5.26 18604 38468 39.7 39.6 19.9% 0.0% 0.0% 0.0% 10.63sec 893470 451.68sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_tick ticks -2944 2859772 6355 16.92 18589 38465 16.7 126.9 19.9% 0.0% 0.0% 0.0% 28.10sec 2859772 451.68sec
priest_90_pi_mb priest_90_pi_mb halo 120644 0 0 1.50 0 0 11.3 11.3 19.6% 0.0% 0.0% 0.0% 41.41sec 0 451.68sec
priest_90_pi_mb priest_90_pi_mb halo_damage 120696 1537974 3405 1.50 111986 231850 11.3 11.3 19.9% 0.0% 0.0% 0.0% 41.41sec 1537974 451.68sec
priest_90_pi_mb priest_90_pi_mb halo_heal 120696 0 0 16.49 0 0 11.3 124.1 22.9% 0.0% 0.0% 0.0% 41.41sec 24167460 451.68sec
priest_90_pi_mb priest_90_pi_mb mind_blast 8092 4413899 9772 5.38 89898 186208 40.5 40.5 19.9% 0.0% 0.0% 0.0% 11.15sec 4413899 451.68sec
priest_90_pi_mb priest_90_pi_mb mind_flay ticks -15407 8503918 18898 38.80 24061 49868 132.3 291.0 20.0% 0.0% 0.0% 0.0% 3.35sec 8503918 451.68sec
priest_90_pi_mb priest_90_pi_mb mind_flay_mastery 124468 2663981 5898 12.10 24051 49845 91.2 91.1 20.1% 0.0% 0.0% 0.0% 4.81sec 2663981 451.68sec
priest_90_pi_mb priest_90_pi_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.74sec 0 451.68sec
priest_90_pi_mb priest_90_pi_mb power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.34sec 0 451.68sec
priest_90_pi_mb priest_90_pi_mb shadow_word_death 32379 1684912 3730 2.04 90006 186590 15.3 15.3 20.6% 0.0% 0.0% 0.0% 4.92sec 1684912 451.68sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain ticks -589 4691310 10425 34.12 13906 28745 58.4 255.9 29.8% 0.0% 0.0% 0.0% 7.68sec 4691310 451.68sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain_mastery 124464 1474246 3264 10.63 13967 28877 80.1 80.0 29.9% 0.0% 0.0% 0.0% 5.57sec 1474246 451.68sec
priest_90_pi_mb priest_90_pi_mb shadowy_apparition 87532 1753745 3883 11.13 17428 35048 85.2 83.8 19.9% 0.0% 0.0% 0.0% 5.26sec 1753745 451.68sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch ticks -34914 3503273 7785 24.46 15737 32583 22.9 183.4 20.0% 0.0% 0.0% 0.0% 19.83sec 3503273 451.68sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch_mastery 124465 1094531 2423 7.62 15739 32600 57.4 57.3 19.9% 0.0% 0.0% 0.0% 7.67sec 1094531 451.68sec
priest_90_pi_mb priest_90_pi_mb_mindbender melee 0 4403973 37648 54.08 36468 73443 105.4 105.4 20.2% 0.0% 23.9% 0.0% 4.17sec 4403973 116.98sec
priest_90_pi_mb priest_90_pi_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.28sec 0 116.98sec
priest_90_pi_swi priest_90_pi_swi devouring_plague 2944 2214854 4904 2.16 112394 232599 16.3 16.3 19.8% 0.0% 0.0% 0.0% 28.81sec 2214854 451.68sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_mastery 124467 858608 1901 5.07 18552 38401 38.2 38.2 19.8% 0.0% 0.0% 0.0% 10.98sec 858608 451.68sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_tick ticks -2944 2749278 6110 16.32 18531 38361 16.3 122.4 19.8% 0.0% 0.0% 0.0% 28.81sec 2749278 451.68sec
priest_90_pi_swi priest_90_pi_swi dispersion 47585 0 0 0.05 0 0 0.4 0.4 0.0% 0.0% 0.0% 0.0% 156.88sec 0 451.68sec
priest_90_pi_swi priest_90_pi_swi halo 120644 0 0 1.40 0 0 10.6 10.6 19.9% 0.0% 0.0% 0.0% 42.75sec 0 451.68sec
priest_90_pi_swi priest_90_pi_swi halo_damage 120696 1432660 3172 1.40 111964 231531 10.6 10.6 19.8% 0.0% 0.0% 0.0% 42.75sec 1432660 451.68sec
priest_90_pi_swi priest_90_pi_swi halo_heal 120696 0 0 15.38 0 0 10.6 115.8 22.9% 0.0% 0.0% 0.0% 42.75sec 22543743 451.68sec
priest_90_pi_swi priest_90_pi_swi mind_blast 8092 4282984 9482 5.22 89829 186025 39.3 39.3 20.0% 0.0% 0.0% 0.0% 11.37sec 4282984 451.68sec
priest_90_pi_swi priest_90_pi_swi mind_flay ticks -15407 7952723 17673 36.25 24078 49909 123.6 271.9 20.0% 0.0% 0.0% 0.0% 3.52sec 7952723 451.68sec
priest_90_pi_swi priest_90_pi_swi mind_flay_mastery 124468 2483557 5498 11.29 24063 49877 85.0 85.0 20.0% 0.0% 0.0% 0.0% 5.05sec 2483557 451.68sec
priest_90_pi_swi priest_90_pi_swi power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.94sec 0 451.68sec
priest_90_pi_swi priest_90_pi_swi shadow_word_death 32379 1568150 3472 1.91 89682 186142 14.4 14.4 20.1% 0.0% 0.0% 0.0% 5.25sec 1568150 451.68sec
priest_90_pi_swi priest_90_pi_swi shadow_word_insanity 129249 2030279 4495 1.45 153702 318187 10.9 10.9 19.8% 0.0% 0.0% 0.0% 38.19sec 2030279 451.68sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain ticks -589 4465814 9924 32.51 13900 28733 60.3 243.8 29.8% 0.0% 0.0% 0.0% 7.31sec 4465814 451.68sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain_mastery 124464 1404055 3109 10.13 13952 28852 76.3 76.3 29.9% 0.0% 0.0% 0.0% 5.77sec 1404055 451.68sec
priest_90_pi_swi priest_90_pi_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.57sec 0 451.68sec
priest_90_pi_swi priest_90_pi_swi shadowy_apparition 87532 1681686 3723 10.68 17411 35013 81.5 80.4 19.9% 0.0% 0.0% 0.0% 5.43sec 1681686 451.68sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch ticks -34914 3412186 7583 23.88 15722 32559 22.2 179.1 19.8% 0.0% 0.0% 0.0% 19.94sec 3412186 451.68sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch_mastery 124465 1065241 2358 7.42 15717 32542 55.9 55.9 19.9% 0.0% 0.0% 0.0% 7.69sec 1065241 451.68sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend melee 0 1660434 46677 52.90 46064 92994 31.4 31.4 20.5% 0.0% 23.8% 0.0% 12.66sec 1660434 35.57sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.55sec 0 35.57sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague 2944 2422937 5364 2.26 117162 242764 17.0 17.0 20.1% 0.0% 0.0% 0.0% 27.56sec 2422937 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_mastery 124467 930020 2059 5.25 19406 40215 39.6 39.5 19.9% 0.0% 0.0% 0.0% 10.68sec 930020 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_tick ticks -2944 2967831 6595 16.88 19335 40062 17.0 126.6 19.8% 0.0% 0.0% 0.0% 27.56sec 2967831 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl dispersion 47585 0 0 0.01 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl halo 120644 0 0 1.48 0 0 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.43sec 0 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_damage 120696 1546290 3423 1.48 114444 237037 11.2 11.2 19.6% 0.0% 0.0% 0.0% 41.43sec 1546290 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_heal 120696 0 0 16.20 0 0 11.2 122.0 23.0% 0.0% 0.0% 0.0% 41.43sec 24269336 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_blast 8092 4620502 10230 5.50 92017 190576 41.4 41.4 19.9% 0.0% 0.0% 0.0% 10.84sec 4620502 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay ticks -15407 6839379 15199 30.95 24279 50323 111.8 232.2 19.9% 0.0% 0.0% 0.0% 3.93sec 6839379 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay_mastery 124468 2140592 4739 9.65 24277 50284 72.7 72.6 20.0% 0.0% 0.0% 0.0% 5.97sec 2140592 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_spike 73510 3200115 7085 4.54 77136 159866 34.2 34.2 20.0% 0.0% 0.0% 0.0% 12.54sec 3200115 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_death 32379 1902284 4212 2.01 102983 213485 15.2 15.2 20.4% 0.0% 0.0% 0.0% 4.98sec 1902284 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain ticks -589 4544828 10100 32.43 14176 29319 52.8 243.2 29.8% 0.0% 0.0% 0.0% 8.46sec 4544828 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain_mastery 124464 1428707 3163 10.10 14253 29488 76.1 76.0 29.8% 0.0% 0.0% 0.0% 5.84sec 1428707 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowy_apparition 87532 1721779 3812 10.72 17769 35735 82.0 80.7 19.9% 0.0% 0.0% 0.0% 5.44sec 1721779 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch ticks -34914 3424628 7610 23.58 15972 33072 22.7 176.8 19.8% 0.0% 0.0% 0.0% 19.78sec 3424628 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch_mastery 124465 1074251 2378 7.34 16037 33186 55.3 55.2 19.9% 0.0% 0.0% 0.0% 7.87sec 1074251 451.68sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend melee 0 1650121 46452 52.90 45916 92730 31.3 31.3 20.3% 0.0% 24.1% 0.0% 12.68sec 1650121 35.52sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.63sec 0 35.52sec
priest_90_tof_mb priest_90_tof_mb devouring_plague 2944 2387052 5285 2.22 117567 243273 16.7 16.7 20.0% 0.0% 0.0% 0.0% 27.97sec 2387052 451.68sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_mastery 124467 916407 2029 5.15 19440 40273 38.9 38.8 20.1% 0.0% 0.0% 0.0% 10.83sec 916407 451.68sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_tick ticks -2944 2920630 6490 16.56 19401 40193 16.7 124.2 19.8% 0.0% 0.0% 0.0% 27.97sec 2920630 451.68sec
priest_90_tof_mb priest_90_tof_mb dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 451.68sec
priest_90_tof_mb priest_90_tof_mb halo 120644 0 0 1.50 0 0 11.3 11.3 19.6% 0.0% 0.0% 0.0% 41.45sec 0 451.68sec
priest_90_tof_mb priest_90_tof_mb halo_damage 120696 1568961 3474 1.50 114686 237141 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.45sec 1568961 451.68sec
priest_90_tof_mb priest_90_tof_mb halo_heal 120696 0 0 16.37 0 0 11.3 123.3 22.9% 0.0% 0.0% 0.0% 41.45sec 24552631 451.68sec
priest_90_tof_mb priest_90_tof_mb mind_blast 8092 4539167 10050 5.40 92133 190924 40.6 40.6 19.8% 0.0% 0.0% 0.0% 11.09sec 4539167 451.68sec
priest_90_tof_mb priest_90_tof_mb mind_flay ticks -15407 7996857 17771 36.18 24300 50377 124.3 271.4 19.8% 0.0% 0.0% 0.0% 3.56sec 7996857 451.68sec
priest_90_tof_mb priest_90_tof_mb mind_flay_mastery 124468 2499150 5533 11.26 24286 50369 84.8 84.8 19.9% 0.0% 0.0% 0.0% 5.16sec 2499150 451.68sec
priest_90_tof_mb priest_90_tof_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.84sec 0 451.68sec
priest_90_tof_mb priest_90_tof_mb shadow_word_death 32379 1915527 4241 2.03 103046 213771 15.3 15.3 20.2% 0.0% 0.0% 0.0% 4.94sec 1915527 451.68sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain ticks -589 4666384 10370 33.28 14183 29333 59.0 249.6 29.8% 0.0% 0.0% 0.0% 7.59sec 4666384 451.68sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain_mastery 124464 1468554 3251 10.37 14263 29517 78.1 78.1 29.8% 0.0% 0.0% 0.0% 5.71sec 1468554 451.68sec
priest_90_tof_mb priest_90_tof_mb shadowy_apparition 87532 1748821 3872 10.88 17785 35764 83.3 81.9 19.9% 0.0% 0.0% 0.0% 5.37sec 1748821 451.68sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch ticks -34914 3387514 7528 23.28 16002 33139 22.5 174.6 19.8% 0.0% 0.0% 0.0% 20.15sec 3387514 451.68sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch_mastery 124465 1062733 2353 7.25 16044 33249 54.6 54.6 19.9% 0.0% 0.0% 0.0% 8.02sec 1062733 451.68sec
priest_90_tof_mb priest_90_tof_mb_mindbender melee 0 4387029 37558 54.13 36406 73331 105.4 105.4 20.0% 0.0% 24.0% 0.0% 4.17sec 4387029 116.81sec
priest_90_tof_mb priest_90_tof_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.31sec 0 116.81sec
priest_90_tof_swi priest_90_tof_swi devouring_plague 2944 2301237 5095 2.15 117017 242209 16.2 16.2 19.9% 0.0% 0.0% 0.0% 28.86sec 2301237 451.68sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_mastery 124467 875489 1938 4.96 19355 40101 37.4 37.3 19.8% 0.0% 0.0% 0.0% 11.22sec 875489 451.68sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_tick ticks -2944 2807262 6238 15.99 19311 39998 16.2 119.9 19.8% 0.0% 0.0% 0.0% 28.86sec 2807262 451.68sec
priest_90_tof_swi priest_90_tof_swi dispersion 47585 0 0 0.09 0 0 0.7 0.7 0.0% 0.0% 0.0% 0.0% 158.00sec 0 451.68sec
priest_90_tof_swi priest_90_tof_swi halo 120644 0 0 1.34 0 0 10.1 10.1 19.8% 0.0% 0.0% 0.0% 43.83sec 0 451.68sec
priest_90_tof_swi priest_90_tof_swi halo_damage 120696 1387537 3072 1.34 113558 234996 10.1 10.1 19.8% 0.0% 0.0% 0.0% 43.83sec 1387537 451.68sec
priest_90_tof_swi priest_90_tof_swi halo_heal 120696 0 0 14.73 0 0 10.1 110.9 22.8% 0.0% 0.0% 0.0% 43.83sec 21903074 451.68sec
priest_90_tof_swi priest_90_tof_swi mind_blast 8092 4298481 9517 5.15 91519 189599 38.8 38.8 19.8% 0.0% 0.0% 0.0% 11.31sec 4298481 451.68sec
priest_90_tof_swi priest_90_tof_swi mind_flay ticks -15407 7317151 16260 33.20 24210 50168 115.1 249.0 19.9% 0.0% 0.0% 0.0% 3.71sec 7317151 451.68sec
priest_90_tof_swi priest_90_tof_swi mind_flay_mastery 124468 2284940 5059 10.33 24201 50163 77.8 77.8 20.0% 0.0% 0.0% 0.0% 5.42sec 2284940 451.68sec
priest_90_tof_swi priest_90_tof_swi shadow_word_death 32379 1738409 3849 1.85 102590 212621 13.9 13.9 20.2% 0.0% 0.0% 0.0% 5.43sec 1738409 451.68sec
priest_90_tof_swi priest_90_tof_swi shadow_word_insanity 129249 1882357 4167 1.31 157612 326081 9.9 9.9 19.5% 0.0% 0.0% 0.0% 42.74sec 1882357 451.68sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain ticks -589 4320935 9602 31.02 14100 29147 58.7 232.6 29.7% 0.0% 0.0% 0.0% 7.40sec 4320935 451.68sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain_mastery 124464 1356931 3004 9.66 14169 29303 72.7 72.7 29.7% 0.0% 0.0% 0.0% 5.97sec 1356931 451.68sec
priest_90_tof_swi priest_90_tof_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 451.68sec
priest_90_tof_swi priest_90_tof_swi shadowy_apparition 87532 1635552 3621 10.24 17674 35559 78.0 77.1 19.9% 0.0% 0.0% 0.0% 5.59sec 1635552 451.68sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch ticks -34914 3223344 7163 22.31 15901 32936 21.4 167.3 19.8% 0.0% 0.0% 0.0% 20.31sec 3223344 451.68sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch_mastery 124465 1009894 2236 6.94 15947 33017 52.3 52.2 19.9% 0.0% 0.0% 0.0% 8.05sec 1009894 451.68sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend melee 0 1654262 46548 52.95 45936 92599 31.4 31.4 20.5% 0.0% 24.0% 0.0% 12.67sec 1654262 35.54sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.61sec 0 35.54sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|&chxp=1,1,-nan,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.12% 8.12%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.43% 8.43%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.96% 10.96%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.02% 11.02%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.04% 11.04%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.85% 10.85%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.30% 11.30%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 805162.34
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 451.68
Minimum 350.20
Maximum 558.16
Spread ( max - min ) 207.96
Range [ ( max - min ) / 2 * 100% ] 23.02%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 49992
Mean 806524.41
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 435339934 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.