close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

priest_90_di_fdcl_no2PT14 : 87257 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87257.1 87257.1 19.94 / 0.02% 3666 / 4.2% 17.7 4723.2 4303.1 Mana 0.67% 40.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:301354|124303|115245|91452|89280|88981|77529|45410&chds=0,602708&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++301354++devouring_plague,9482C9,0,0,15|t++124303++vampiric_touch,9482C9,1,0,15|t++115245++halo,9482C9,2,0,15|t++91452++shadow_word_death,9482C9,3,0,15|t++89280++shadow_word_pain,9482C9,4,0,15|t++88981++mind_blast,9482C9,5,0,15|t++77529++mind_spike,4A79D3,6,0,15|t++45410++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,11,9,9,8,7,5,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6877655454313544545420yxwvuttssttuttsrqpnnnnnnoooonllkjhgffgghhhhghgggfghhhijkllkkjiihhgggghhhhhgfffffgghhijkkjhgffeffffghhhihhggfeghijjkkkjjiihgfffffgghhihhiiiiiiijkkllmkjijjjkkkllmnpooooonmnoponnnnonmlkjiiiijjkkklllkkkjjijjjklllkihgfddcccdefffeeeeddeghiikllllkjiihhggghhhhhhhgggffgghhijjjihhhhggfggghhhihhhhhghiiiijkllllkkkjkkkklmmnnnnnnnnnnnnoppppomkijjjkklmnoqrrrrrqqrtuvvvuuutsqpnmmlllllmmmmmmmmmmmnnoppqqpopppoooonnooopooooonoqpppqrssttttttutuuvvwwxxxxxwwwwwwwwwwvtrppommlkkjkkkkkkkkkkmoppqrrtttutttttttssttttssssrrrrrqqqqqqpoonnopqqrsttvwwwvvwwy001221&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6348,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=87257|max=137463&chxp=1,1,63,100&chtt=priest_90_di_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,16,16,56,56,32,72,72,64,120,152,168,344,360,616,760,936,1368,1672,1920,2456,2592,3152,3192,3256,3184,3288,3096,3232,2872,2352,1848,1648,1392,1064,720,544,408,272,248,112,96,48,16,32,24,16,8,8&chds=0,3288&chbh=5&chxt=x&chxl=0:|min=77374|avg=87257|max=96094&chxp=0,1,53,100&chtt=priest_90_di_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:38.8,13.4,13.3,8.9,7.9,5.2,4.0,2.9,0.5,0.0,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 175.5s|mind_blast 60.6s|shadow_word_pain 60.1s|mind_spike 40.3s|vampiric_touch 35.6s|devouring_plague 23.5s|shadow_word_death 18.3s|halo 13.2s|shadowfiend 2.5s|dispersion 0.1s|waiting 3.0s&chtt=priest_90_di_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no2PT14 87257
devouring_plague 5930 (15649) 6.8% (18.0%) 19.7 23.67sec 359343 301354 112275 232358 136078 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.70 19.70 0.00 0.00 1.1924 0.0000 2680645.65 2680645.65 0.00 301354.05 301354.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.79 80.18% 112275.27 102399 137090 112318.55 105606 119907 1773343 1773343 0.00
crit 3.90 19.82% 232357.77 210941 282405 229467.74 0 282405 907303 907303 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2315 2.7% 46.6 9.16sec 22482 0 18586 38495 22516 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.59 46.52 0.00 0.00 0.0000 0.0000 1047498.81 1047498.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.34 80.26% 18585.85 17006 22766 18591.01 17613 19815 694011 694011 0.00
crit 9.18 19.74% 38494.80 35032 46897 38500.77 0 44346 353488 353488 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7404 8.5% 19.7 23.67sec 170090 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.0 18548 38397 22491 19.9% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.70 19.70 148.98 148.98 0.0000 0.7558 3350662.24 3350662.24 0.00 29759.33 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.4 80.13% 18547.73 17006 24415 18551.98 17718 19536 2214200 2214200 0.00
crit 29.6 19.87% 38396.68 35032 50295 38406.65 36122 42079 1136462 1136462 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3375) 0.0% (3.9%) 11.2 41.62sec 135836 115245 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 0.00 0.00 1.1787 0.0000 0.00 0.00 0.00 115245.42 115245.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 80.16% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.23 19.84% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3375 3.9% 11.2 41.62sec 135836 0 112028 231808 135838 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 0.00 0.00 0.0000 0.0000 1524696.90 1524696.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.99 80.12% 112027.97 104363 133162 112023.23 105214 119434 1007519 1007519 0.00
crit 2.23 19.88% 231808.50 214987 274315 212403.79 0 274315 517177 517177 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.62sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.22 242.12 0.00 0.00 0.0000 0.0000 0.00 47156882.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.61 77.07% 0.00 0 0 0.00 0 0 0 29196577 100.00
crit 55.51 22.93% 0.00 0 0 0.00 0 0 0 17960305 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11939 13.7% 49.5 9.07sec 108913 88981 89826 186031 108912 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.55 49.55 0.00 0.00 1.2240 0.0000 5396500.60 5396500.60 0.00 88980.69 88980.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.72 80.16% 89825.51 82079 110390 89846.81 86281 93673 3567690 3567690 0.00
crit 9.83 19.84% 186030.62 169082 227403 186104.36 169082 209691 1828811 1828811 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13443 (17646) 15.4% (20.2%) 106.6 4.15sec 74749 45410 0 0 0 0.0% 0.0% 0.0% 0.0% 208.9 23948 49622 29063 19.9% 0.0% 34.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.60 106.60 208.88 208.88 1.6461 0.7393 6070458.05 6070458.05 0.00 45409.60 45409.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.3 80.08% 23948.42 21797 29181 23955.36 23262 24671 4005879 4005879 0.00
crit 41.6 19.92% 49622.47 44901 60113 49636.94 47259 52653 2064579 2064579 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4202 4.8% 65.3 6.66sec 29065 0 23960 49658 29078 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.29 65.26 0.00 0.00 0.0000 0.0000 1897563.94 1897563.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.26 80.08% 23960.40 21797 29181 23965.41 22626 25287 1252180 1252180 0.00
crit 13.00 19.92% 49657.79 44901 60113 49672.92 44901 56134 645384 645384 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6916 7.9% 34.1 12.65sec 91533 77529 75557 156405 91533 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.15 34.15 0.00 0.00 1.1806 0.0000 3125509.32 3125509.32 0.00 77529.13 77529.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.40 80.24% 75557.30 68964 93036 75569.75 71155 80515 2070175 2070175 0.00
crit 6.75 19.76% 156404.55 142066 191655 156077.39 0 191655 1055335 1055335 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3691 4.2% 15.3 4.96sec 109331 91452 89875 186495 109330 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.32 15.32 0.00 0.00 1.1955 0.0000 1675120.56 1675120.56 0.00 91451.69 91451.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.24 79.86% 89874.72 79678 107383 89973.06 82197 100169 1099728 1099728 0.00
crit 3.09 20.14% 186495.23 164137 221210 180055.38 0 221210 575392 575392 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9042 (11873) 10.4% (13.6%) 50.9 8.85sec 105566 89280 0 0 0 0.0% 0.0% 0.0% 0.0% 242.1 13930 28821 16884 19.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.85 50.85 242.14 242.14 1.1824 1.7960 4088240.39 4088240.39 0.00 10844.20 89280.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.1 80.16% 13929.55 12783 17110 13931.52 13559 14374 2703829 2703829 0.00
crit 48.0 19.84% 28821.10 26333 35247 28823.88 27536 30308 1384412 1384412 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2830 3.2% 75.8 5.89sec 16894 0 13949 28883 16908 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.76 75.69 0.00 0.00 0.0000 0.0000 1279824.10 1279824.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.69 80.19% 13949.32 12783 17110 13952.82 13485 14566 846648 846648 0.00
crit 15.00 19.81% 28882.52 26333 35247 28890.70 26333 32065 433176 433176 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2182 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2695 3.1% 59.2 7.52sec 20577 0 17413 34992 20918 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.24 58.27 0.00 0.00 0.0000 0.0000 1218869.56 1218869.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.65 80.06% 17412.92 15875 21413 17415.79 16661 18379 812315 812315 0.00
crit 11.62 19.94% 34991.54 31750 42826 34995.03 31750 42826 406555 406555 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7443 (9781) 8.5% (11.2%) 30.0 15.04sec 147321 124303 0 0 0 0.0% 0.0% 0.0% 0.0% 177.1 15673 32460 19003 19.8% 0.0% 87.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.01 30.01 177.06 177.06 1.1852 2.2384 3364662.13 3364662.13 0.00 10237.87 124302.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.9 80.17% 15673.40 14287 19397 15675.89 15253 16253 2224722 2224722 0.00
crit 35.1 19.83% 32460.23 29431 39957 32461.90 30358 34344 1139940 1139940 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2338 2.7% 55.5 7.90sec 19035 0 15700 32523 19051 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.53 55.48 0.00 0.00 0.0000 0.0000 1057041.25 1057041.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.43 80.08% 15699.98 14287 19397 15704.21 14926 16688 697576 697576 0.00
crit 11.05 19.92% 32523.02 29431 39957 32524.93 29431 37559 359465 359465 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46429 / 3692
melee 46429 4.2% 31.4 12.74sec 52631 51750 45920 92772 52630 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.37 31.37 0.00 0.00 1.0170 0.0000 1651084.83 1651084.83 0.00 51750.03 51750.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.49 55.74% 45920.46 36329 55931 45929.84 40595 52111 802932 802932 0.00
crit 6.33 20.19% 92771.79 72658 111863 92681.54 0 111863 587598 587598 0.00
glance 7.55 24.07% 34502.36 27247 41949 34503.14 27247 41167 260555 260555 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1969 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.34%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.4 0.6 27.4sec 26.4sec 5.38% 28.99%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.38%

Trigger Attempt Success

  • trigger_pct:5.03%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.98% 19.98%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.98%

    Trigger Attempt Success

    • trigger_pct:16.51%
glyph_mind_spike 25.1 9.0 17.4sec 12.6sec 32.12% 47.54%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:25.77%
  • glyph_mind_spike_2:6.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.77% 44.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.77%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.20% 41.20%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.20%

    Trigger Attempt Success

    • trigger_pct:15.03%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.3sec 10.3sec 9.86% 49.24%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 29.9 5.1 14.6sec 12.4sec 18.97% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.44%
  • surge_of_darkness_2:1.53%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.58%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no2PT14
devouring_plague Shadow Orb 19.7 59.1 3.0 3.0 119781.6
halo Mana 11.2 454591.4 40500.0 40499.9 3.4
mind_blast Mana 49.5 301311.4 6081.2 6081.1 17.9
mind_flay Mana 106.6 319790.9 3000.0 3000.0 24.9
shadow_word_death Mana 15.3 119511.0 7800.0 7800.2 14.0
shadow_word_pain Mana 50.8 671216.8 13200.0 13199.9 8.0
vampiric_touch Mana 30.0 270126.7 9000.0 9000.0 16.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.07 1218.24 (0.06%) 18000.00 0.00 0.00%
shadowfiend Mana 31.37 246257.52 (12.65%) 7849.84 36081.84 12.78%
Shadow Orbs from Mind Blast Shadow Orb 49.55 49.55 (86.43%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.78 7.78 (13.57%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.50 0.00 (-nan%) 0.00 2714825.59 100.00%
Vampiric Touch Mana Mana 232.54 1174072.66 (60.32%) 5048.83 54740.30 4.45%
mp5_regen Mana 1808.89 524943.70 (26.97%) 290.20 17723.18 3.27%
Resource RPS-Gain RPS-Loss
Mana 4303.09 4723.24
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 109938.65 300.00 300000.00
Shadow Orb 1.23 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.3%
shadowfiend-Mana Cap 3.3%
lightwell-Mana Cap 3.3%

Procs

Count Interval
Shadowy Recall Extra Tick 243.0 1.8sec
Shadowy Apparition Procced 59.2 7.5sec
Divine Insight Mind Blast CD Reset 28.1 26.4sec
FDCL Mind Spike proc 35.0 12.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 87257.08
Minimum 77374.16
Maximum 96094.18
Spread ( max - min ) 18720.02
Range [ ( max - min ) / 2 * 100% ] 10.73%
Standard Deviation 2275.1038
5th Percentile 83541.03
95th Percentile 90873.69
( 95th Percentile - 5th Percentile ) 7332.66
Mean Distribution
Standard Deviation 10.1754
95.00% Confidence Intervall ( 87237.14 - 87277.03 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2611
0.1 Scale Factor Error with Delta=300 44186
0.05 Scale Factor Error with Delta=300 176744
0.01 Scale Factor Error with Delta=300 4418614
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 87257.08
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37777293.48
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 301.88
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.88 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.32 shadow_word_death,if=active_enemies<=5
F 52.51 mind_blast,if=active_enemies<=6&cooldown_react
G 19.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.11 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.41 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.22 halo,if=talent.halo.enabled
M 14.82 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 5.08 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.58 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 30.74 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.32 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 31.22 shadow_word_pain,moving=1
X 0.01 dispersion

Sample Sequence

DGLWFHTFTTQFMHRTGTQFTWWRFHFMJRTFLTGHJQFRTFMRHGTQFTRTTFHRTGLFMWWWHTFTFRHTGFMTGWFFHTLTQFMTHTGFTRTWWRFHTQFMTHGFLJRTFBWFHDFTTFHTGFDFTWWLWFHTQFTHTGQFMRTGWWFHTLFTHFTGRTFRWWWHTFMTRTTFHTGLFTWWWHFMTTFHTGRTFTWWWHFLMTQFTHTGTFTRGBWFHMTQFTREEHLFGDFEEWWFMHREETFTTPEDEFGHQQQQQQQQFTEDE9JLFFHGEDEFJRTEEFHMRGRE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_fdcl_no4PT14 : 89337 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
89336.9 89336.9 20.13 / 0.02% 3676 / 4.1% 18.1 4724.6 4302.8 Mana 0.67% 40.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:301304|124220|115580|97125|91433|89016|77560|45438&chds=0,602608&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++301304++devouring_plague,9482C9,0,0,15|t++124220++vampiric_touch,9482C9,1,0,15|t++115580++halo,9482C9,2,0,15|t++97125++shadow_word_pain,9482C9,3,0,15|t++91433++shadow_word_death,9482C9,4,0,15|t++89016++mind_blast,9482C9,5,0,15|t++77560++mind_spike,4A79D3,6,0,15|t++45438++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,11,9,9,8,7,5,4,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6877655554313644645530yxwvvuuttttuuutsqpooonooooppnmlljhhggghhhhihhhhgghiiijkllllkjjihhhgghhhiihgggffggghijkkljihggefggghiiijiihhgfgijkklkkkkjihhggggghhiiiiiiiiiijjjkllmmlkijkjkkllmnoppoooonnnpqooooooonmljjjjjjklllmllllkjjjjjkllmmkjhgfeedddefffgfffeedfghijklmmllkjiiihhhiiiiiihhhggggghiijjkjihhhggggghiiiihiiihhijjjjkllmmllllkllllmmnnonooonnnnooopppqomljkjkkklmopqrrrrrrqstuwvvvvutsrpommlllmmmnnnnnnmmmnnoopqqrqopppopoooooppppppooopqqpqrrstttttttuuuvvwxxxxxxxxxxxxwwwwwwurqponmllkkkkkkklllkkmopqqrstuuuuuuuutttttttttttssrrrrqqqqrrpooooopqqrrtuvxxxxxyy0223443&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6431,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=89337|max=138919&chxp=1,1,64,100&chtt=priest_90_di_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,24,0,0,16,0,8,24,16,32,24,40,88,88,88,152,240,432,576,992,1344,1848,2440,3200,3640,3592,4136,4368,3760,3832,3176,2848,2368,1984,1464,1000,864,440,336,184,112,72,72,24,8,24,8&chds=0,4368&chbh=5&chxt=x&chxl=0:|min=75237|avg=89337|max=98353&chxp=0,1,61,100&chtt=priest_90_di_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:38.8,13.4,13.3,8.9,7.9,5.2,4.1,2.9,0.5,0.0,0.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 175.6s|mind_blast 60.6s|shadow_word_pain 60.1s|mind_spike 40.3s|vampiric_touch 35.6s|devouring_plague 23.5s|shadow_word_death 18.3s|halo 13.2s|shadowfiend 2.5s|dispersion 0.1s|waiting 3.0s&chtt=priest_90_di_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no4PT14 89337
devouring_plague 5926 (15633) 6.6% (17.5%) 19.7 23.70sec 359275 301304 112284 232344 136106 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.68 19.68 0.00 0.00 1.1924 0.0000 2679000.79 2679000.79 0.00 301304.16 301304.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.78 80.16% 112284.10 102399 137090 112318.92 105993 119394 1771558 1771558 0.00
crit 3.91 19.84% 232343.94 210941 282405 229268.69 0 282405 907443 907443 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2309 2.6% 46.5 9.19sec 22493 0 18588 38450 22523 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.46 46.40 0.00 0.00 0.0000 0.0000 1044995.13 1044995.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.20 80.19% 18587.94 17006 22766 18592.74 17614 19648 691556 691556 0.00
crit 9.19 19.81% 38449.87 35032 46897 38462.85 35032 43794 353439 353439 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7398 8.3% 19.7 23.70sec 170076 0 0 0 0 0.0% 0.0% 0.0% 0.0% 148.8 18549 38402 22490 19.9% 0.0% 24.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.68 19.68 148.85 148.85 0.0000 0.7558 3347612.71 3347612.71 0.00 29757.88 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.3 80.15% 18548.83 17006 30092 18552.68 17670 19540 2212846 2212846 0.00
crit 29.5 19.85% 38401.60 35032 61990 38404.77 35928 41948 1134767 1134767 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3385) 0.0% (3.8%) 11.2 41.62sec 136216 115580 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 0.00 0.00 1.1786 0.0000 0.00 0.00 0.00 115579.56 115579.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 80.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.82% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3385 3.8% 11.2 41.62sec 136216 0 112023 231657 136214 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.22 11.22 0.00 0.00 0.0000 0.0000 1528655.22 1528655.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.95 79.78% 112022.81 104363 133162 112017.11 105092 120186 1002916 1002916 0.00
crit 2.27 20.22% 231656.57 214987 274315 212930.37 0 274315 525739 525739 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.62sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.22 242.11 0.00 0.00 0.0000 0.0000 0.00 47116672.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 186.76 77.14% 0.00 0 0 0.00 0 0 0 29214836 100.00
crit 55.35 22.86% 0.00 0 0 0.00 0 0 0 17901836 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11933 13.4% 49.5 9.08sec 108973 89016 89849 185938 108973 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.51 49.51 0.00 0.00 1.2242 0.0000 5394827.58 5394827.58 0.00 89016.21 89016.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.65 80.10% 89848.92 82079 110390 89871.36 87041 93327 3562830 3562830 0.00
crit 9.85 19.90% 185938.07 169082 227403 185910.72 0 207598 1831997 1831997 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13454 (17666) 15.0% (19.8%) 106.7 4.14sec 74792 45438 0 0 0 0.0% 0.0% 0.0% 0.0% 209.0 23948 49620 29069 19.9% 0.0% 34.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.67 106.67 209.00 209.00 1.6460 0.7392 6075380.66 6075380.66 0.00 45437.59 45437.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 106.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.3 80.05% 23947.92 21797 29181 23954.50 23223 24763 4006688 4006688 0.00
crit 41.7 19.95% 49619.70 44901 60113 49632.70 47312 52629 2068693 2068693 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4212 4.7% 65.5 6.64sec 29051 0 23961 49641 29064 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.48 65.45 0.00 0.00 0.0000 0.0000 1902323.92 1902323.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.45 80.13% 23961.13 21797 29181 23967.90 22766 25221 1256706 1256706 0.00
crit 13.01 19.87% 49640.81 44901 60113 49654.54 45351 56032 645618 645618 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6909 7.7% 34.1 12.65sec 91581 77560 75515 156407 91581 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.11 34.11 0.00 0.00 1.1808 0.0000 3123661.13 3123661.13 0.00 77560.24 77560.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 27.33 80.14% 75515.13 68964 93036 75526.85 70360 80720 2064109 2064109 0.00
crit 6.77 19.86% 156406.84 142066 191655 156193.21 0 191655 1059552 1059552 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3692 4.2% 15.3 4.95sec 109303 91433 89880 186281 109302 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 15.33 0.00 0.00 1.1955 0.0000 1676067.09 1676067.09 0.00 91433.48 91433.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.24 79.85% 89879.96 79678 107383 89985.04 82527 99239 1100534 1100534 0.00
crit 3.09 20.15% 186280.86 164137 221210 179233.70 0 221210 575533 575533 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9833 (12913) 11.0% (14.5%) 50.8 8.86sec 114849 97125 0 0 0 0.0% 0.0% 0.0% 0.0% 242.1 13924 28787 18360 29.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.83 50.83 242.12 242.12 1.1825 1.7961 4445285.85 4445285.85 0.00 11794.48 97125.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.9 70.15% 13924.26 12783 17110 13926.18 13489 14357 2365091 2365091 0.00
crit 72.3 29.85% 28786.96 26333 35247 28790.48 27635 29930 2080195 2080195 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3080 3.4% 75.7 5.89sec 18388 0 13944 28837 18404 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.73 75.67 0.00 0.00 0.0000 0.0000 1392532.06 1392532.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.01 70.06% 13944.43 12783 17110 13947.19 13367 14579 739194 739194 0.00
crit 22.66 29.94% 28836.55 26333 35247 28841.86 27151 30779 653338 653338 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2184 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3737 4.2% 82.2 5.44sec 20550 0 17399 34985 20889 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 82.24 80.91 0.00 0.00 0.0000 0.0000 1690112.03 1690112.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.86 80.16% 17398.55 15875 21413 17401.16 16795 17979 1128399 1128399 0.00
crit 16.06 19.84% 34984.93 31750 42826 34994.82 32279 37896 561713 561713 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7441 (9775) 8.3% (10.9%) 30.0 15.04sec 147217 124220 0 0 0 0.0% 0.0% 0.0% 0.0% 177.1 15676 32445 18993 19.8% 0.0% 87.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.01 30.01 177.07 177.07 1.1852 2.2383 3363115.48 3363115.48 0.00 10229.16 124219.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.01 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 142.0 80.22% 15675.56 14287 19397 15677.76 15148 16180 2226543 2226543 0.00
crit 35.0 19.78% 32445.21 29431 39957 32448.57 30650 34462 1136573 1136573 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2335 2.6% 55.4 7.91sec 19029 0 15697 32506 19046 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.44 55.39 0.00 0.00 0.0000 0.0000 1054889.95 1054889.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.35 80.08% 15696.76 14287 19397 15699.31 14927 16555 696196 696196 0.00
crit 11.03 19.92% 32505.67 29431 39957 32509.64 0 37957 358694 358694 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46440 / 3693
melee 46440 4.1% 31.4 12.75sec 52660 51775 45891 92701 52661 20.3% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.36 31.36 0.00 0.00 1.0171 0.0000 1651203.53 1651203.53 0.00 51774.85 51774.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.42 55.55% 45890.57 36329 55931 45905.18 41220 51538 799297 799297 0.00
crit 6.37 20.33% 92701.34 72658 111863 92595.06 0 111863 590930 590930 0.00
glance 7.56 24.12% 34501.79 27247 41949 34499.09 0 41949 260976 260976 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1971 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.34%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.3 0.6 27.7sec 26.6sec 5.34% 28.79%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.34%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.99% 19.99%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.99%

    Trigger Attempt Success

    • trigger_pct:16.46%
glyph_mind_spike 25.1 9.0 17.4sec 12.7sec 32.12% 47.43%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:25.79%
  • glyph_mind_spike_2:6.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.66% 43.96%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.66%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.17% 41.17%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.17%

    Trigger Attempt Success

    • trigger_pct:14.89%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.3sec 10.3sec 9.86% 49.25%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.86%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 29.9 5.0 14.6sec 12.4sec 18.96% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.45%
  • surge_of_darkness_2:1.51%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.59%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no4PT14
devouring_plague Shadow Orb 19.7 59.0 3.0 3.0 119757.1
halo Mana 11.2 454500.7 40500.0 40499.9 3.4
mind_blast Mana 49.5 302029.9 6100.8 6100.8 17.9
mind_flay Mana 106.7 319995.8 3000.0 3000.0 24.9
shadow_word_death Mana 15.3 119609.6 7800.0 7800.2 14.0
shadow_word_pain Mana 50.8 670952.8 13200.0 13199.9 8.7
vampiric_touch Mana 30.0 270090.7 9000.0 9000.0 16.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.08 1451.52 (0.07%) 18000.00 0.00 0.00%
shadowfiend Mana 31.36 246177.94 (12.65%) 7851.02 36027.50 12.77%
Shadow Orbs from Mind Blast Shadow Orb 49.51 49.51 (86.41%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.79 7.79 (13.59%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.24 0.00 (-nan%) 0.00 2711288.39 100.00%
Vampiric Touch Mana Mana 232.46 1173798.34 (60.31%) 5049.49 54788.06 4.46%
mp5_regen Mana 1808.89 524948.06 (26.97%) 290.20 17718.82 3.27%
Resource RPS-Gain RPS-Loss
Mana 4302.83 4724.64
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 109189.10 0.00 288600.00
Shadow Orb 1.24 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.3%
shadowfiend-Mana Cap 3.3%
lightwell-Mana Cap 3.3%

Procs

Count Interval
Shadowy Recall Extra Tick 242.9 1.8sec
Shadowy Apparition Procced 82.2 5.4sec
Divine Insight Mind Blast CD Reset 27.9 26.6sec
FDCL Mind Spike proc 34.9 12.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 89336.90
Minimum 75236.89
Maximum 98353.09
Spread ( max - min ) 23116.20
Range [ ( max - min ) / 2 * 100% ] 12.94%
Standard Deviation 2295.8556
5th Percentile 85729.40
95th Percentile 93081.47
( 95th Percentile - 5th Percentile ) 7352.07
Mean Distribution
Standard Deviation 10.2682
95.00% Confidence Intervall ( 89316.77 - 89357.03 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 25
0.1% Error 2537
0.1 Scale Factor Error with Delta=300 44995
0.05 Scale Factor Error with Delta=300 179983
0.01 Scale Factor Error with Delta=300 4499588
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 89336.90
Distribution Chart

Damage

Sample Data
Count 49992
Mean 38718459.62
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 301.83
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.86 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.33 shadow_word_death,if=active_enemies<=5
F 52.48 mind_blast,if=active_enemies<=6&cooldown_react
G 19.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.11 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.36 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.22 halo,if=talent.halo.enabled
M 14.82 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 5.05 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.56 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 30.75 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.40 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 31.20 shadow_word_pain,moving=1
X 0.02 dispersion

Sample Sequence

DGLWFHTRQQQQQFTTRTFHMTGTFWWWWWHTFTLRQFHMRGTFTWWWFHTFMTTHFTGLTWWWWFHTFMRHTGFTGWWFHLQQFMTTFHRRTGTFTWWWWHFMJRTFTTHLTFGTBWRFHMTQQQQQFRRTHFGTRTLWWFDFHJRTFTRTHGFMTRTGWWFHTLTFRTHTGFMTWFWWHTQFRTTFHJLMFGRTWWWFHTQFMTHTGFTWLWWWFHFMTTFTHJRGTFTGBRFHMQQQQFTLTTEEFGHJMREEFWWWWHEDEFTTEEFHGLMTE9EFWHTEDEFTHTEEFGRRTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no2PT14 : 88777 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
88776.9 88776.9 17.00 / 0.02% 3176 / 3.6% 16.0 4931.3 4649.8 Mana 0.54% 36.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:300770|123974|115254|91478|88553|83012|45955&chds=0,601539&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++300770++devouring_plague,9482C9,0,0,15|t++123974++vampiric_touch,9482C9,1,0,15|t++115254++halo,9482C9,2,0,15|t++91478++shadow_word_death,9482C9,3,0,15|t++88553++mind_blast,9482C9,4,0,15|t++83012++shadow_word_pain,9482C9,5,0,15|t++45955++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,14,12,12,9,9,7,6,5,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no2PT14 Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:12578665554246446566410xussrqqpqrrrqponmlklkllmmmmljiihgghhijlmnooppppopqrqqrrqqpnlkiggfeeeffffeeeddddeefghiijigfdedfghiklmnooppponoqrsssrppomljhffeddefffgffgggggghhijjkkjihgfffffghiijkklmmmlmnnooopppponmkjjihghiiijiiiiihhghhijjkkihfeccccdefhijkkllmnmnpqrsttttrqomkjihgfffgggfffeeddeefghhhihgffedeeefhijklkmmooopqrrrstttsrponmmllkjkkllllllllllmmmnnnomkjihffeffghjjklmnnooqsttuvwxwvusrqoommkkkjkkkkklkkllmmnoopponnnnmmllmmoppqqsstuuwyyyyz01100zzyxxwwwvvvvvvvvvvvvvvuuvuuusponmlkjijjkllmnopqrsuxz00123433210zzxxvvuutssssssrrssrsssssrqqqqpppoooppqrrrqqqqrtssstt&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6458,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=88777|max=137460&chxp=1,1,65,100&chtt=priest_90_di_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,8,8,32,32,32,40,160,192,408,440,600,832,1056,1296,1520,1904,2024,2376,2480,2776,2768,3016,3072,3184,2872,2512,2264,2360,1904,1584,1392,1192,808,696,520,472,296,256,240,56,80,64,24,40,32,24,8,8&chds=0,3184&chbh=5&chxt=x&chxl=0:|min=81646|avg=88777|max=96284&chxp=0,1,49,100&chtt=priest_90_di_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:45.5,14.6,12.9,7.9,5.0,4.1,2.9,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 205.9s|shadow_word_pain 66.1s|mind_blast 58.2s|vampiric_touch 35.6s|devouring_plague 22.6s|shadow_word_death 18.3s|halo 13.3s|mindbender 8.3s|waiting 2.4s&chtt=priest_90_di_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no2PT14 88777
devouring_plague 5716 (15021) 6.4% (16.9%) 18.9 24.68sec 358804 300770 112377 232689 136486 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.95 18.95 0.00 0.00 1.1930 0.0000 2585779.03 2585779.03 0.00 300769.67 300769.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.15 79.96% 112377.30 102399 137090 112412.69 106454 120024 1702420 1702420 0.00
crit 3.80 20.04% 232688.97 210941 282405 228414.11 0 282405 883359 883359 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2219 2.5% 44.6 9.55sec 22512 0 18604 38518 22544 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.61 44.55 0.00 0.00 0.0000 0.0000 1004304.95 1004304.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.74 80.22% 18604.44 17006 22766 18607.96 17634 19991 664859 664859 0.00
crit 8.81 19.78% 38518.24 35032 46897 38518.50 35032 44346 339446 339446 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7086 8.0% 18.9 24.68sec 169308 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.6 18566 38434 22490 19.8% 0.0% 23.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.95 18.95 142.62 142.62 0.0000 0.7561 3207611.27 3207611.27 0.00 29745.55 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.5 80.25% 18565.56 17006 24930 18568.72 17660 19670 2124873 2124873 0.00
crit 28.2 19.75% 38433.76 35032 51357 38439.13 36004 42385 1082738 1082738 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3391) 0.0% (3.8%) 11.3 41.58sec 135884 115254 0 0 0 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 1.1791 0.0000 0.00 0.00 0.00 115253.52 115253.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 79.84% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.27 20.16% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3391 3.8% 11.3 41.58sec 135884 0 111982 231558 135884 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 0.0000 0.0000 1532410.78 1532410.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.02 80.01% 111981.59 104363 133162 111976.12 105214 119626 1010411 1010411 0.00
crit 2.25 19.99% 231557.68 214987 274315 211903.67 0 274315 522000 522000 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.58sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.28 243.49 0.00 0.00 0.0000 0.0000 0.00 47375561.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.76 77.11% 0.00 0 0 0.00 0 0 0 29359886 100.00
crit 55.73 22.89% 0.00 0 0 0.00 0 0 0 18015675 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11398 12.8% 47.3 9.52sec 109050 88553 89840 186133 109050 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 0.00 0.00 1.2315 0.0000 5155140.64 5155140.64 0.00 88553.48 88553.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.84 80.05% 89840.14 82079 110390 89863.92 86705 93607 3399778 3399778 0.00
crit 9.43 19.95% 186132.66 169082 227403 186187.57 0 227403 1755362 1755362 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15959 (20954) 18.0% (23.6%) 123.5 3.59sec 76604 45955 0 0 0 0.0% 0.0% 0.0% 0.0% 248.0 23943 49614 29053 19.9% 0.0% 40.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.49 123.49 247.98 247.98 1.6669 0.7390 7204712.11 7204712.11 0.00 45955.45 45955.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.6 80.09% 23942.97 21797 29181 23949.09 23338 24574 4755464 4755464 0.00
crit 49.4 19.91% 49613.66 44901 60113 49626.99 47149 52373 2449248 2449248 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4995 5.6% 77.5 5.64sec 29091 0 23960 49636 29103 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.53 77.50 0.00 0.00 0.0000 0.0000 2255401.39 2255401.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.98 79.97% 23960.31 21797 29181 23965.97 22914 25166 1484968 1484968 0.00
crit 15.52 20.03% 49635.74 44901 60113 49648.53 44901 54177 770433 770433 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 1.1968 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3691 4.2% 15.3 4.96sec 109369 91478 89900 186345 109369 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.32 15.32 0.00 0.00 1.1956 0.0000 1675963.16 1675963.16 0.00 91477.71 91477.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.23 79.81% 89899.60 79678 107383 89992.06 83141 100871 1099513 1099513 0.00
crit 3.09 20.19% 186344.55 164137 221210 179177.45 0 221210 576450 576450 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9235 (12128) 10.4% (13.7%) 55.8 8.07sec 98253 83012 0 0 0 0.0% 0.0% 0.0% 0.0% 247.5 13929 28822 16879 19.8% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.83 55.83 247.47 247.47 1.1836 1.7604 4177069.18 4177069.18 0.00 10933.28 83011.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.4 80.19% 13929.38 12783 17110 13931.06 13527 14369 2764206 2764206 0.00
crit 49.0 19.81% 28821.76 26333 35247 28821.76 27448 30130 1412863 1412863 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2893 3.3% 77.5 5.77sec 16891 0 13948 28880 16906 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.45 77.39 0.00 0.00 0.0000 0.0000 1308256.19 1308256.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.05 80.19% 13947.64 12783 17110 13949.59 13404 14466 865515 865515 0.00
crit 15.33 19.81% 28879.52 26333 35247 28884.25 26795 31720 442741 442741 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2730 3.1% 60.1 7.41sec 20542 0 17411 35012 20893 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.13 59.12 0.00 0.00 0.0000 0.0000 1235254.16 1235254.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.43 80.22% 17410.97 15875 21413 17412.40 16708 18201 825753 825753 0.00
crit 11.70 19.78% 35011.57 31750 42826 35016.37 31750 39954 409501 409501 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7425 (9750) 8.4% (11.0%) 30.0 15.08sec 146917 123974 0 0 0 0.0% 0.0% 0.0% 0.0% 176.7 15673 32446 18998 19.8% 0.0% 87.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 176.71 176.71 1.1851 2.2379 3357082.09 3357082.09 0.00 10227.35 123973.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.7 80.18% 15672.82 14287 19397 15675.00 15219 16236 2220485 2220485 0.00
crit 35.0 19.82% 32445.57 29431 39957 32447.71 30404 34368 1136597 1136597 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2324 2.6% 55.3 7.94sec 19004 0 15698 32533 19020 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.31 55.26 0.00 0.00 0.0000 0.0000 1051059.48 1051059.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.36 80.27% 15698.31 14287 19397 15700.89 14926 16446 696333 696333 0.00
crit 10.90 19.73% 32533.49 29431 39957 32537.74 29431 37400 354726 354726 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37555 / 9714
melee 37555 10.9% 105.3 4.18sec 41618 39046 36384 73258 41618 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.34 105.34 0.00 0.00 1.0659 0.0000 4384119.56 4384119.56 0.00 39045.61 39045.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.85 55.87% 36384.24 29063 44745 36402.73 34643 38424 2141352 2141352 0.00
crit 21.16 20.09% 73257.98 58126 89490 73295.86 66182 81870 1550087 1550087 0.00
glance 25.33 24.04% 27346.82 21797 33559 27361.27 25281 30006 692681 692681 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 1.1906 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.27%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.5 0.7 27.3sec 26.0sec 6.06% 30.17%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:6.06%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.99% 19.99%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.99%

    Trigger Attempt Success

    • trigger_pct:16.47%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.77% 44.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.77%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.5 0.0 49.1sec 49.1sec 41.30% 41.30%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.30%

    Trigger Attempt Success

    • trigger_pct:14.86%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.3sec 10.3sec 9.81% 49.46%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.94%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no2PT14
devouring_plague Shadow Orb 18.9 56.8 3.0 3.0 119601.3
halo Mana 11.3 456729.8 40500.0 40499.8 3.4
mind_blast Mana 47.3 276926.4 5858.0 5858.0 18.6
mind_flay Mana 123.5 370482.7 3000.0 3000.0 25.5
shadow_word_death Mana 15.3 119529.7 7800.0 7800.2 14.0
shadow_word_pain Mana 55.8 736935.9 13200.0 13200.0 7.4
vampiric_touch Mana 30.0 270038.9 9000.0 9000.0 16.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.34 424722.76 (20.19%) 4031.81 36780.08 7.97%
Shadow Orbs from Mind Blast Shadow Orb 47.27 47.27 (85.92%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.74 7.74 (14.08%) 1.00 0.00 0.00%
Devouring Plague Health Health 187.17 0.00 (-nan%) 0.00 2599209.01 100.00%
Vampiric Touch Mana Mana 231.97 1160092.76 (55.16%) 5001.02 65946.76 5.38%
mp5_regen Mana 1808.89 518506.64 (24.65%) 286.64 24160.24 4.45%
Resource RPS-Gain RPS-Loss
Mana 4649.79 4931.26
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 172671.17 4228.57 289671.43
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.5%
shadowfiend-Mana Cap 4.5%
lightwell-Mana Cap 4.5%

Procs

Count Interval
Shadowy Recall Extra Tick 254.7 1.8sec
Shadowy Apparition Procced 60.1 7.4sec
Divine Insight Mind Blast CD Reset 28.6 26.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no2PT14 Damage Per Second
Count 49992
Mean 88776.86
Minimum 81646.18
Maximum 96284.21
Spread ( max - min ) 14638.03
Range [ ( max - min ) / 2 * 100% ] 8.24%
Standard Deviation 1939.7504
5th Percentile 85642.64
95th Percentile 91993.81
( 95th Percentile - 5th Percentile ) 6351.18
Mean Distribution
Standard Deviation 8.6755
95.00% Confidence Intervall ( 88759.86 - 88793.86 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1833
0.1 Scale Factor Error with Delta=300 32119
0.05 Scale Factor Error with Delta=300 128479
0.01 Scale Factor Error with Delta=300 3211998
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 88776.86
Distribution Chart

Damage

Sample Data
Count 49992
Mean 35750044.42
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 271.93
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.94 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.72 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.32 shadow_word_death,if=active_enemies<=5
F 50.88 mind_blast,if=active_enemies<=6&cooldown_react
G 19.22 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.10 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.28 halo,if=talent.halo.enabled
M 14.23 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.82 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.47 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.61 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGLWFHTFQQQQQQQFMTHTGFTFWWFMHTFTLTTHGQFTFAWWHTFMTTFHTGLFTWWWWFHMTFTHTFGTAGLFHTFMTTQFHTGTFTWWWWFHMTLFTHTGQFTFMAWHFTQFTHTFGDFLTWWWWFHTQQFMTTFHTGTFTGAWHTFLMTTFHTGTFWWWWHTFTTFHLGMTFTWWAHTFTQQQFMTTHTFGTFLFMHTFGTTHTFTGGWWAFHMTLTFEEHTGTFDEEWWWHFTEDETTFTHEEFGLMT9EEWAFHTPEDETFTHEEGTFMTWE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no4PT14 : 90858 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
90858.5 90858.5 17.49 / 0.02% 3283 / 3.6% 16.4 4932.4 4650.4 Mana 0.54% 36.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:300891|123871|115113|91397|90243|88426|45934&chds=0,601782&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++300891++devouring_plague,9482C9,0,0,15|t++123871++vampiric_touch,9482C9,1,0,15|t++115113++halo,9482C9,2,0,15|t++91397++shadow_word_death,9482C9,3,0,15|t++90243++shadow_word_pain,9482C9,4,0,15|t++88426++mind_blast,9482C9,5,0,15|t++45934++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,14,12,12,9,9,7,6,5,5,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no4PT14 Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:02578665554246456566420xvstsrrqrrssrqponlllllmmmmmlkiihghhhiklmnoopqqpppqrrrrsrqpnmkjhgfeeffgggfeeeedefffghijkigfeeeghijkmnoppppppopqrtstrqponljiggfeeffgghgggghghhhiijkkkjihgggggghhijklklmnmmmnooopppqppomljkjihiijjkjjjjihhhhhijjkkjhfedcdddefhjklklmnnnopqrsttttsqonljjihggggghggffeeeffgghiiihggffeeefghjklmlmnoppqrrrsstutsrqpomnmlkkkllllmmmmlmmmmnoooonljihggffghijkllmnopprstuuvwxwvutsqponmlkkklkkllllllmmmnoppqpnonnmmmmmnopqrrsttuuwyyyyz01100zzyxyxwwwvvvvvvvwvvvvvvvvvuusppnnllkjjjklmmnpqrrsvyz0012344332100yxwwvuutttttsssssssssssrqqqqqqppoppqrrrsssssuvvvvww&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6541,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=90858|max=138899&chxp=1,1,65,100&chtt=priest_90_di_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,56,32,56,56,64,144,272,368,416,688,872,1112,1408,1592,1992,2088,2400,3024,3032,2952,2800,3008,3000,2720,2608,2104,2192,1984,1472,1304,856,784,704,488,384,240,216,104,152,104,64,0,8,8,8,8,8,24&chds=0,3032&chbh=5&chxt=x&chxl=0:|min=83885|avg=90858|max=99074&chxp=0,1,46,100&chtt=priest_90_di_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:45.5,14.6,12.9,7.9,5.0,4.0,2.9,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 205.7s|shadow_word_pain 66.1s|mind_blast 58.2s|vampiric_touch 35.6s|devouring_plague 22.6s|shadow_word_death 18.3s|halo 13.3s|mindbender 8.3s|waiting 2.4s&chtt=priest_90_di_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no4PT14 90858
devouring_plague 5711 (15027) 6.3% (16.6%) 18.9 24.67sec 359016 300891 112363 232777 136363 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.94 18.94 0.00 0.00 1.1932 0.0000 2583134.28 2583134.28 0.00 300891.00 300891.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.17 80.07% 112363.42 102399 137090 112405.28 105993 122179 1704212 1704212 0.00
crit 3.78 19.93% 232776.84 210941 282405 229026.55 0 282405 878922 878922 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2226 2.5% 44.7 9.53sec 22528 0 18611 38507 22564 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.72 44.65 0.00 0.00 0.0000 0.0000 1007561.58 1007561.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.78 80.13% 18610.63 17006 22766 18614.23 17424 20325 665916 665916 0.00
crit 8.87 19.87% 38506.87 35032 46897 38506.92 0 46897 341646 341646 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7090 7.8% 18.9 24.67sec 169461 0 0 0 0 0.0% 0.0% 0.0% 0.0% 142.7 18563 38421 22499 19.8% 0.0% 23.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.94 18.94 142.67 142.67 0.0000 0.7562 3210042.48 3210042.48 0.00 29752.92 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.4 80.18% 18563.29 17006 30704 18567.13 17756 19420 2123460 2123460 0.00
crit 28.3 19.82% 38420.56 35032 63250 38423.86 35809 41845 1086582 1086582 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3388) 0.0% (3.7%) 11.3 41.58sec 135735 115113 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 1.1792 0.0000 0.00 0.00 0.00 115112.50 115112.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.02 80.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.25 19.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3388 3.7% 11.3 41.58sec 135735 0 111973 231627 135735 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 11.28 0.00 0.00 0.0000 0.0000 1530766.06 1530766.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.04 80.14% 111972.74 104363 133162 111964.53 104363 119770 1012021 1012021 0.00
crit 2.24 19.86% 231626.58 214987 274315 211934.09 0 274315 518745 518745 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.58sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.28 243.52 0.00 0.00 0.0000 0.0000 0.00 47398564.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.69 77.07% 0.00 0 0 0.00 0 0 0 29347611 100.00
crit 55.83 22.93% 0.00 0 0 0.00 0 0 0 18050954 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11387 12.5% 47.3 9.52sec 108859 88426 89854 186018 108860 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.31 47.31 0.00 0.00 1.2311 0.0000 5149867.17 5149867.17 0.00 88426.44 88426.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.96 80.24% 89853.84 82079 110390 89872.55 86200 94088 3410691 3410691 0.00
crit 9.35 19.76% 186018.08 169082 227403 186082.62 169082 209691 1739176 1739176 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15948 (20936) 17.5% (23.0%) 123.4 3.59sec 76590 45934 0 0 0 0.0% 0.0% 0.0% 0.0% 247.8 23943 49618 29049 19.9% 0.0% 40.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.39 123.39 247.82 247.82 1.6674 0.7390 7198965.38 7198965.38 0.00 45934.16 45934.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.5 80.12% 23943.48 21797 29181 23949.85 23409 24653 4753811 4753811 0.00
crit 49.3 19.88% 49618.44 44901 60113 49632.24 47250 52193 2445154 2445154 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4988 5.5% 77.5 5.64sec 29064 0 23955 49645 29077 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.47 77.43 0.00 0.00 0.0000 0.0000 2251575.41 2251575.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.00 80.06% 23955.23 21797 29181 23961.49 22951 25138 1485152 1485152 0.00
crit 15.44 19.94% 49645.24 44901 60113 49666.36 46046 54776 766424 766424 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.94 6.94 0.00 0.00 1.1966 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3682 4.1% 15.3 4.96sec 109274 91397 89918 186201 109278 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.30 15.30 0.00 0.00 1.1956 0.0000 1672299.18 1672299.18 0.00 91397.45 91397.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.23 79.90% 89918.30 79678 107383 90015.81 82786 98000 1099453 1099453 0.00
crit 3.08 20.10% 186200.55 164137 221210 180113.54 0 221210 572846 572846 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10039 (13198) 11.1% (14.5%) 55.9 8.06sec 106800 90243 0 0 0 0.0% 0.0% 0.0% 0.0% 247.5 13928 28784 18341 29.7% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.89 55.89 247.54 247.54 1.1835 1.7598 4540082.50 4540082.50 0.00 11895.51 90242.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.0 70.30% 13928.18 12783 17110 13929.69 13512 14377 2423691 2423691 0.00
crit 73.5 29.70% 28783.69 26333 35247 28784.88 27699 29886 2116392 2116392 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3159 3.5% 77.6 5.75sec 18403 0 13947 28842 18418 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.64 77.58 0.00 0.00 0.0000 0.0000 1428761.49 1428761.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.29 69.98% 13946.53 12783 17110 13949.23 13459 14575 757153 757153 0.00
crit 23.29 30.02% 28841.58 26333 35247 28849.27 27133 30929 671608 671608 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3782 4.2% 83.2 5.38sec 20548 0 17402 34998 20897 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.24 81.85 0.00 0.00 0.0000 0.0000 1710485.63 1710485.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.59 80.14% 17402.25 15875 21413 17404.57 16743 18128 1141474 1141474 0.00
crit 16.26 19.86% 34997.96 31750 42826 35001.85 32623 38582 569011 569011 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7422 (9742) 8.2% (10.7%) 30.0 15.08sec 146821 123871 0 0 0 0.0% 0.0% 0.0% 0.0% 176.7 15673 32457 18993 19.8% 0.0% 87.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.00 30.00 176.70 176.70 1.1853 2.2379 3355997.18 3355997.18 0.00 10220.89 123871.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.7 80.22% 15673.46 14287 19397 15675.49 15201 16399 2221698 2221698 0.00
crit 34.9 19.78% 32457.18 29431 39957 32461.14 30770 34440 1134299 1134299 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2320 2.6% 55.2 7.96sec 19008 0 15695 32508 19024 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.19 55.15 0.00 0.00 0.0000 0.0000 1049103.35 1049103.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.23 80.20% 15695.32 14287 19397 15698.07 14777 16584 694177 694177 0.00
crit 10.92 19.80% 32507.66 29431 39957 32516.18 29431 37773 354927 354927 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37565 / 9716
melee 37565 10.7% 105.3 4.18sec 41631 39058 36383 73308 41631 20.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.34 105.34 0.00 0.00 1.0659 0.0000 4385280.61 4385280.61 0.00 39057.69 39057.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.79 55.81% 36383.17 29063 44745 36402.75 34376 38563 2138920 2138920 0.00
crit 21.18 20.11% 73308.18 58126 89490 73340.86 67032 81607 1552784 1552784 0.00
glance 25.37 24.08% 27341.41 21797 33559 27355.98 25008 30246 693577 693577 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.31sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 1.1906 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.27%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 15.6 0.7 27.3sec 26.1sec 6.04% 30.22%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:6.04%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.98% 19.98%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.98%

    Trigger Attempt Success

    • trigger_pct:16.49%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.4sec 20.6sec 43.71% 44.10%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.71%

    Trigger Attempt Success

    • trigger_pct:2.36%
light_of_the_cosmos 9.6 0.0 49.1sec 49.1sec 41.35% 41.35%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.35%

    Trigger Attempt Success

    • trigger_pct:14.99%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.3sec 10.3sec 9.81% 49.44%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no4PT14
devouring_plague Shadow Orb 18.9 56.8 3.0 3.0 119672.0
halo Mana 11.3 456742.8 40500.0 40499.8 3.4
mind_blast Mana 47.3 277146.7 5858.4 5858.4 18.6
mind_flay Mana 123.4 370171.7 3000.0 3000.0 25.5
shadow_word_death Mana 15.3 119372.4 7800.0 7800.2 14.0
shadow_word_pain Mana 55.9 737713.2 13200.0 13199.9 8.1
vampiric_touch Mana 30.0 270028.8 9000.0 9000.0 16.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.34 424782.43 (20.19%) 4032.56 36698.68 7.95%
Shadow Orbs from Mind Blast Shadow Orb 47.31 47.31 (85.94%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.74 7.74 (14.06%) 1.00 0.00 0.00%
Devouring Plague Health Health 187.33 0.00 (-nan%) 0.00 2601324.22 100.00%
Vampiric Touch Mana Mana 231.84 1160210.43 (55.15%) 5004.33 65402.85 5.34%
mp5_regen Mana 1808.89 518589.24 (24.65%) 286.69 24077.64 4.44%
Resource RPS-Gain RPS-Loss
Mana 4650.36 4932.43
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 172397.98 6842.86 294071.43
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.5%
shadowfiend-Mana Cap 4.5%
lightwell-Mana Cap 4.5%

Procs

Count Interval
Shadowy Recall Extra Tick 254.8 1.8sec
Shadowy Apparition Procced 83.2 5.4sec
Divine Insight Mind Blast CD Reset 28.6 26.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no4PT14 Damage Per Second
Count 49992
Mean 90858.48
Minimum 83885.48
Maximum 99073.79
Spread ( max - min ) 15188.31
Range [ ( max - min ) / 2 * 100% ] 8.36%
Standard Deviation 1995.7588
5th Percentile 87653.88
95th Percentile 94220.07
( 95th Percentile - 5th Percentile ) 6566.20
Mean Distribution
Standard Deviation 8.9260
95.00% Confidence Intervall ( 90840.98 - 90875.97 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1853
0.1 Scale Factor Error with Delta=300 34001
0.05 Scale Factor Error with Delta=300 136006
0.01 Scale Factor Error with Delta=300 3400163
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 90858.48
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36688641.67
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 272.14
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.94 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.70 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.30 shadow_word_death,if=active_enemies<=5
F 50.89 mind_blast,if=active_enemies<=6&cooldown_react
G 19.23 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.10 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.28 halo,if=talent.halo.enabled
M 14.24 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.99 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.46 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.66 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGLFHTFTTHGTFMTWWWWWFHTLFTHTFGTAWWFHMTFTHTGFLTFMWWFHTFTHGFTAGWFHLMTFTHTGFTFMTWWWWFHTFTTHFLGMTWAWFHTQQFTHTGFMTWWLFHTQFTTHGTFMTGWAFHTLFTFGHMTFTWWWWHQFTTFMHTGTLFTWWWAFHTFMTFHGTWWWWWFHLTQFTHTGFMTGWWFAHQQQFTTEDEFHGLTPEEWWWFHDEEFTTEDEFGHTEE9FMTAHLEEFGTEDEFHTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no2PT14 : 83312 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
83312.1 83312.1 32.41 / 0.04% 6073 / 7.3% 16.0 4961.3 4377.6 Mana 2.84% 47.3 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://6.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:300289|136444|124964|114814|91110|88236|76446|46089&chds=0,600578&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++300289++devouring_plague,9482C9,0,0,15|t++136444++shadow_word_insanity,9482C9,1,0,15|t++124964++vampiric_touch,9482C9,2,0,15|t++114814++halo,9482C9,3,0,15|t++91110++shadow_word_death,9482C9,4,0,15|t++88236++mind_blast,9482C9,5,0,15|t++76446++shadow_word_pain,9482C9,6,0,15|t++46089++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,14,11,9,9,7,6,6,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_insanity|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no2PT14 Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6877644444325644655520xwvuutssrsrrsrqpommmmmmmnnnnmlkjhfeeeeeeeffffffffghhiiklllkkjihghgffgfffgeeeeeefgghhjjkljihgfeffgggggghggffedfhijjkkjjjihgfefeeffgffgfgggghhiijklllmljiijijkjkllmnnmmmmmmooponoooonmlkjiiiiijiijjjjjjiijjjjjlllmkihffdddccdccdedddddcehiijllmmmlkjjhhgggghgfgfffeeefffghiijjihhggffffffffggffffffhhhhijkklkkjjihiiiiiiiijijjjjjkkkllmmmnljihhhiijjklmopppqqpprtuvvvvuutrqonlllkkklkklklllllmmmmnoopponnnmmmllllllllllllllmnnnnoppppppppopppppppppooooooooooooonnljjihgfeddcbaaZZZZYYXZaaaabbbccccccccbbbbbbbbbbbbbbbbbbbbaaaZYYYZabccdefhjmnnnopqsuvwwxx&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6101,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=83312|max=136553&chxp=1,1,61,100&chtt=priest_90_di_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,16,32,24,24,48,56,40,104,88,224,168,336,304,384,464,576,600,696,888,1000,920,1064,1096,1368,1776,1840,2112,2784,2704,3072,3456,3400,3456,3024,2952,2352,1896,1632,1008,624,512,376,184,136,48,32,56,8&chds=0,3456&chbh=5&chxt=x&chxl=0:|min=67102|avg=83312|max=93340&chxp=0,1,62,100&chtt=priest_90_di_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.8,14.7,12.5,7.5,4.9,3.8,3.3,2.7,0.5,0.5,2.8&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 189.1s|shadow_word_pain 66.7s|mind_blast 56.7s|vampiric_touch 34.1s|devouring_plague 22.2s|shadow_word_death 17.1s|shadow_word_insanity 15.0s|halo 12.2s|shadowfiend 2.5s|dispersion 2.2s|waiting 12.9s&chtt=priest_90_di_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no2PT14 83312
devouring_plague 5604 (14748) 6.7% (17.7%) 18.6 25.12sec 358282 300289 112245 232178 136051 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.60 18.60 0.00 0.00 1.1931 0.0000 2530581.94 2530581.94 0.00 300289.10 300289.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.91 80.15% 112245.45 102399 137090 112289.06 105994 122032 1673315 1673315 0.00
crit 3.69 19.85% 232177.79 210941 282405 229067.04 0 282405 857267 857267 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2177 2.6% 43.8 9.72sec 22491 0 18587 38466 22523 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.76 43.70 0.00 0.00 0.0000 0.0000 984310.67 984310.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.05 80.20% 18587.22 17006 22766 18590.67 17564 19890 651480 651480 0.00
crit 8.65 19.80% 38465.61 35032 46897 38468.91 35032 44793 332831 332831 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6968 8.4% 18.6 25.12sec 169308 0 0 0 0 0.0% 0.0% 0.0% 0.0% 140.2 18537 38356 22462 19.8% 0.0% 23.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.60 18.60 140.20 140.20 0.0000 0.7560 3149123.18 3149123.18 0.00 29711.79 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.4 80.20% 18536.93 17006 24963 18540.77 17621 19614 2084219 2084219 0.00
crit 27.8 19.80% 38356.05 35032 51424 38359.86 35593 41734 1064904 1064904 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3126) 0.0% (3.7%) 10.4 43.11sec 135350 114814 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 1.1789 0.0000 0.00 0.00 0.00 114813.79 114813.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.35 80.32% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.05 19.68% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3126 3.7% 10.4 43.11sec 135350 0 111837 231311 135350 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 0.0000 0.0000 1406354.17 1406354.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.35 80.32% 111836.96 104363 133162 111851.58 104363 120779 933333 933333 0.00
crit 2.04 19.68% 231311.42 214987 274315 207015.81 0 274315 473021 473021 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.4 43.11sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.39 224.63 0.00 0.00 0.0000 0.0000 0.00 43709458.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.16 77.09% 0.00 0 0 0.00 0 0 0 27074312 100.00
crit 51.47 22.91% 0.00 0 0 0.00 0 0 0 16635147 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11089 13.3% 46.1 9.61sec 108570 88236 89716 185801 108572 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.07 46.07 0.00 0.00 1.2305 0.0000 5001921.57 5001921.57 0.00 88235.99 88235.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.03 80.38% 89715.65 82079 110390 89735.84 86606 92985 3322256 3322256 0.00
crit 9.04 19.62% 185800.70 169082 227403 185871.67 169082 227403 1679666 1679666 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14727 (19335) 17.7% (23.2%) 112.7 3.85sec 77320 46089 0 0 0 0.0% 0.0% 0.0% 0.0% 228.6 23930 49605 29038 19.9% 0.0% 37.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.74 112.74 228.64 228.64 1.6776 0.7382 6639203.95 6639203.95 0.00 46089.01 46089.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.1 80.10% 23930.16 21797 29181 23936.44 23280 24586 4382791 4382791 0.00
crit 45.5 19.90% 49604.58 44901 60113 49617.89 47377 52397 2256413 2256413 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4608 5.5% 71.5 5.97sec 29040 0 23950 49635 29049 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.55 71.52 0.00 0.00 0.0000 0.0000 2077748.59 2077748.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.32 80.15% 23949.50 21797 29181 23955.68 22898 25041 1372874 1372874 0.00
crit 14.20 19.85% 49635.35 44901 60113 49652.91 45479 57803 704874 704874 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3458 4.2% 14.3 5.30sec 108930 91110 89649 185702 108928 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.34 14.34 0.00 0.00 1.1956 0.0000 1562264.28 1562264.28 0.00 91110.06 91110.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.46 79.93% 89649.25 79678 107383 89731.08 79678 100456 1027654 1027654 0.00
crit 2.88 20.07% 185701.57 164137 221210 177626.41 0 221210 534611 534611 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4529 5.4% 12.6 33.66sec 162243 136444 134118 277456 162243 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.60 12.60 0.00 0.00 1.1891 0.0000 2044608.79 2044608.79 0.00 136443.70 136443.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.13 80.38% 134117.74 122772 165600 134134.63 122772 144617 1358539 1358539 0.00
crit 2.47 19.62% 277455.81 252910 341137 257614.72 0 341137 686069 686069 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8609 (11306) 10.3% (13.6%) 56.4 7.81sec 90421 76446 0 0 0 0.0% 0.0% 0.0% 0.0% 230.4 13908 28783 16858 19.8% 0.0% 87.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.40 56.40 230.35 230.35 1.1828 1.7118 3883326.70 3883326.70 0.00 11062.00 76445.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.7 80.17% 13908.49 12783 17110 13910.65 13472 14363 2568491 2568491 0.00
crit 45.7 19.83% 28782.90 26333 35247 28785.84 27534 30341 1314835 1314835 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2697 3.2% 72.1 6.08sec 16878 0 13932 28848 16890 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.08 72.03 0.00 0.00 0.0000 0.0000 1216510.02 1216510.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.75 80.17% 13932.38 12783 17110 13935.18 13350 14509 804566 804566 0.00
crit 14.28 19.83% 28847.75 26333 35247 28858.33 26649 31820 411945 411945 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2179 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2568 3.1% 56.2 7.77sec 20621 0 17396 34979 20887 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 55.50 0.00 0.00 0.0000 0.0000 1159197.79 1159197.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.48 80.15% 17396.16 15875 21413 17398.83 16654 18253 773824 773824 0.00
crit 11.02 19.85% 34978.53 31750 42826 34981.58 31750 39859 385374 385374 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7201 (9452) 8.6% (11.3%) 28.8 15.28sec 148110 124964 0 0 0 0.0% 0.0% 0.0% 0.0% 170.9 15662 32423 18991 19.9% 0.0% 84.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.76 28.76 170.93 170.93 1.1852 2.2356 3246020.22 3246020.22 0.00 10235.94 124964.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.0 80.14% 15661.98 14287 19397 15664.47 15228 16199 2145397 2145397 0.00
crit 33.9 19.86% 32423.48 29431 39957 32426.20 30795 34834 1100623 1100623 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2251 2.7% 53.4 7.99sec 18979 0 15678 32481 18992 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.44 53.40 0.00 0.00 0.0000 0.0000 1014261.77 1014261.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.87 80.28% 15678.48 14287 19397 15681.66 14901 16667 672165 672165 0.00
crit 10.53 19.72% 32480.87 29431 39957 32493.23 29431 38090 342096 342096 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46496 / 3700
melee 46496 4.4% 31.4 12.74sec 52701 51825 45906 92696 52702 20.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.39 31.39 0.00 0.00 1.0169 0.0000 1654187.03 1654187.03 0.00 51824.53 51824.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.46 55.63% 45906.01 36329 55931 45920.22 41382 52034 801514 801514 0.00
crit 6.39 20.36% 92695.56 72658 111863 92568.26 0 111863 592513 592513 0.00
glance 7.54 24.01% 34520.46 27247 41949 34517.70 0 41949 260160 260160 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1968 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.60%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.6 0.6 28.3sec 27.1sec 5.50% 29.08%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.50%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.9sec 108.9sec 19.93% 19.93%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.93%

    Trigger Attempt Success

    • trigger_pct:16.43%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.72% 44.09%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.72%

    Trigger Attempt Success

    • trigger_pct:2.45%
light_of_the_cosmos 9.5 0.0 49.4sec 49.4sec 41.00% 41.00%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.00%

    Trigger Attempt Success

    • trigger_pct:15.01%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.0sec 10.0sec 9.99% 44.93%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.99%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.17% 14.17%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.61%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no2PT14
devouring_plague Shadow Orb 18.6 55.8 3.0 3.0 119427.8
halo Mana 10.4 420804.7 40500.0 40499.1 3.3
mind_blast Mana 46.1 275449.0 5978.9 5978.8 18.2
mind_flay Mana 112.7 338219.5 3000.0 3000.0 25.8
shadow_word_death Mana 14.3 111872.0 7800.0 7800.3 14.0
shadow_word_insanity Mana 12.6 94516.8 7500.0 7500.0 21.6
shadow_word_pain Mana 56.4 744496.9 13200.0 13200.0 6.9
vampiric_touch Mana 28.8 258880.3 9000.0 9000.1 16.5
Resource Gains Type Count Total Average Overflow
dispersion Mana 2.77 49864.32 (2.52%) 18000.00 0.00 0.00%
shadowfiend Mana 31.39 249345.17 (12.59%) 7943.88 33149.71 11.73%
Shadow Orbs from Mind Blast Shadow Orb 46.07 46.07 (85.34%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.91 7.91 (14.66%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.90 0.00 (-nan%) 0.00 2553752.02 100.00%
Vampiric Touch Mana Mana 224.33 1150434.77 (58.10%) 5128.27 35344.27 2.98%
mp5_regen Mana 1808.89 530562.14 (26.79%) 293.31 12104.74 2.23%
Resource RPS-Gain RPS-Loss
Mana 4377.62 4961.31
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 35970.43 0.00 262200.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.3%
shadowfiend-Mana Cap 2.3%
lightwell-Mana Cap 2.3%

Procs

Count Interval
Shadowy Recall Extra Tick 240.7 1.8sec
Shadowy Apparition Procced 56.2 7.8sec
Divine Insight Mind Blast CD Reset 26.7 27.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no2PT14 Damage Per Second
Count 49992
Mean 83312.10
Minimum 67102.45
Maximum 93339.51
Spread ( max - min ) 26237.05
Range [ ( max - min ) / 2 * 100% ] 15.75%
Standard Deviation 3697.5065
5th Percentile 76165.59
95th Percentile 88310.68
( 95th Percentile - 5th Percentile ) 12145.08
Mean Distribution
Standard Deviation 16.5371
95.00% Confidence Intervall ( 83279.68 - 83344.51 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7566
0.1 Scale Factor Error with Delta=300 116708
0.05 Scale Factor Error with Delta=300 466833
0.01 Scale Factor Error with Delta=300 11670825
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 83312.10
Distribution Chart

Damage

Sample Data
Count 49992
Mean 35915433.64
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 356.33
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.69 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.34 shadow_word_death,if=active_enemies<=5
F 49.49 mind_blast,if=active_enemies<=6&cooldown_react
G 18.64 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 28.88 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.60 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.39 halo,if=talent.halo.enabled
M 13.91 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 71.60 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 33.10 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.43 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 37.77 shadow_word_pain,moving=1
X 0.46 dispersion

Sample Sequence

DGLWFHTFTHTIFGTWFMWWFHTFLTHIGFMTWWFHTFTTHIGFMLTWWWWFHTFTHIGTQQQQQQQQQQQFMTQFGFWHLTFMTTHTFGTWWWWFHTFLMHIGTQFTBWWFHTFMTHIGTFLQQQQFWWWWHTFMTTFHIGTFTFGMHTLQFTTHFGTQFWFMWHTFTTQQQFHIGLTQFMTWWWFHTQFTHIGFMTWLWWFHTFTTFHIGMQQQQQFTGBWFHTLFMEEHIGFTPEDEWWWWFHEETQFDPEEFHFGLDEET9WWWFEDEHTFTEEITGHQQQQQQQQFDEPPPPPPE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no4PT14 : 85221 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
85220.9 85220.9 33.09 / 0.04% 6223 / 7.3% 16.4 4960.5 4379.6 Mana 2.90% 47.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:300114|136761|125081|114749|91255|88363|83013|46083&chds=0,600227&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++300114++devouring_plague,9482C9,0,0,15|t++136761++shadow_word_insanity,9482C9,1,0,15|t++125081++vampiric_touch,9482C9,2,0,15|t++114749++halo,9482C9,3,0,15|t++91255++shadow_word_death,9482C9,4,0,15|t++88363++mind_blast,9482C9,5,0,15|t++83013++shadow_word_pain,9482C9,6,0,15|t++46083++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,14,11,9,9,7,6,6,4,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_insanity|shadowfiend: melee|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no4PT14 Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6877655554335655656630yxwvvuttstsstsrqonnnnmnnoooomlkjhgfffffffggfgggffhiiijkmlmlkjjihhgggggfggffeeefggghijkllkihggegggghgghiggggfegiikklkkkkjihgfgfffgggghghhhhiijjkklmmmlkjjjjkkkllmnoonnnnmnoppooopopomlkjijjijjjjjkjkkjjjjkjkklmmmkjhgfeeddddddefeeeeddfiijjlmmnmllkjiihhhhhhgggggfffggghhjjjkjihhhggggggggghgggggghiiiikllllkkjjijjiijjijjjjjjkkkllllmmmnljihhhiijjklmoppqqqqqsuvwvvvvvtsqpnmmllllllllllllllmmmnnoppponnnnmmmmmmllmmlmllllmonnnoppqppppppppppppppppppppoppoooooonmkjihgffedcbbaaZZZZYYZaaabbbbcccccccdccccccccccccccccbbbbbbbaZZZabcdeefgiknooqrstvxy0011&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6201,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=85221|max=137423&chxp=1,1,62,100&chtt=priest_90_di_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,24,8,32,32,40,40,96,64,112,152,240,312,384,320,544,632,768,752,840,896,912,1160,1304,1552,1752,2000,2496,3144,3120,3584,4008,3400,3528,2864,2576,1992,1408,1072,728,496,280,152,72,24,40,24&chds=0,4008&chbh=5&chxt=x&chxl=0:|min=67078|avg=85221|max=95251&chxp=0,1,64,100&chtt=priest_90_di_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.8,14.8,12.5,7.5,4.9,3.8,3.3,2.7,0.5,0.5,2.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 189.0s|shadow_word_pain 66.8s|mind_blast 56.6s|vampiric_touch 34.1s|devouring_plague 22.1s|shadow_word_death 17.1s|shadow_word_insanity 15.0s|halo 12.2s|shadowfiend 2.5s|dispersion 2.2s|waiting 13.1s&chtt=priest_90_di_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no4PT14 85221
devouring_plague 5594 (14706) 6.6% (17.3%) 18.6 25.19sec 358097 300114 112220 232058 136124 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 0.00 0.00 1.1932 0.0000 2525962.04 2525962.04 0.00 300113.56 300113.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.86 80.06% 112220.08 102399 137090 112258.07 105417 119484 1667104 1667104 0.00
crit 3.70 19.94% 232057.93 210941 282405 228363.75 0 282405 858858 858858 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2175 2.6% 43.7 9.72sec 22489 0 18575 38449 22518 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.72 43.66 0.00 0.00 0.0000 0.0000 983152.52 983152.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.00 80.16% 18574.88 17006 22766 18579.73 17678 19724 650103 650103 0.00
crit 8.66 19.84% 38449.35 35032 46897 38448.49 0 46897 333050 333050 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6937 8.2% 18.6 25.19sec 168995 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.7 18528 38364 22446 19.7% 0.0% 23.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.56 18.56 139.72 139.72 0.0000 0.7561 3135999.96 3135999.96 0.00 29687.41 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.1 80.25% 18528.27 17006 27322 18532.24 17351 19415 2077464 2077464 0.00
crit 27.6 19.75% 38363.52 35032 56284 38365.52 35778 41792 1058535 1058535 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3123) 0.0% (3.7%) 10.4 43.11sec 135309 114749 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 1.1792 0.0000 0.00 0.00 0.00 114749.19 114749.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.33 80.19% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.06 19.81% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3123 3.7% 10.4 43.11sec 135309 0 111835 231214 135309 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 10.39 0.00 0.00 0.0000 0.0000 1405448.12 1405448.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.34 80.34% 111835.34 104363 133162 111847.03 104363 120779 933214 933214 0.00
crit 2.04 19.66% 231213.91 214987 274315 207465.49 0 274315 472234 472234 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.4 43.11sec 0 0 0 0 0 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.39 224.71 0.00 0.00 0.0000 0.0000 0.00 43687870.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.41 77.17% 0.00 0 0 0.00 0 0 0 27107950 100.00
crit 51.31 22.83% 0.00 0 0 0.00 0 0 0 16579920 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11081 13.0% 45.9 9.64sec 108818 88363 89698 185744 108816 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.94 45.94 0.00 0.00 1.2315 0.0000 4999113.04 4999113.04 0.00 88362.58 88362.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.79 80.09% 89697.61 82079 110390 89716.30 86551 93422 3300403 3300403 0.00
crit 9.15 19.91% 185743.57 169082 227403 185748.43 0 209691 1698710 1698710 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14716 (19316) 17.3% (22.7%) 112.7 3.85sec 77328 46083 0 0 0 0.0% 0.0% 0.0% 0.0% 228.6 23932 49598 29031 19.9% 0.0% 37.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.65 112.65 228.58 228.58 1.6780 0.7382 6635864.32 6635864.32 0.00 46083.26 46083.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.2 80.13% 23931.88 21797 29181 23938.01 23317 24556 4383421 4383421 0.00
crit 45.4 19.87% 49597.86 44901 60113 49611.52 47394 52445 2252443 2252443 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4600 5.4% 71.4 5.98sec 29084 0 23951 49629 29095 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.36 71.33 0.00 0.00 0.0000 0.0000 2075299.63 2075299.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.04 79.97% 23950.97 21797 29181 23957.14 22959 25152 1366188 1366188 0.00
crit 14.29 20.03% 49629.01 44901 60113 49645.77 45800 55901 709112 709112 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3456 4.1% 14.3 5.30sec 109138 91255 89646 185628 109139 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.31 14.31 0.00 0.00 1.1960 0.0000 1561918.61 1561918.61 0.00 91254.88 91254.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.41 79.69% 89646.38 79678 107383 89730.82 82656 98147 1022432 1022432 0.00
crit 2.91 20.31% 185627.96 164137 221210 177802.55 0 221210 539487 539487 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4540 5.3% 12.6 33.64sec 162617 136761 134051 277407 162616 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.61 12.61 0.00 0.00 1.1891 0.0000 2050185.98 2050185.98 0.00 136761.12 136761.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.10 80.07% 134051.12 122772 165600 134058.60 124640 144465 1353273 1353273 0.00
crit 2.51 19.93% 277406.69 252910 341137 258859.25 0 341137 696913 696913 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9359 (12290) 11.0% (14.4%) 56.5 7.81sec 98190 83013 0 0 0 0.0% 0.0% 0.0% 0.0% 230.3 13907 28752 18333 29.8% 0.0% 87.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.46 56.46 230.31 230.31 1.1828 1.7114 4222391.94 4222391.94 0.00 12027.84 83013.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.46 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 161.6 70.18% 13907.15 12783 17110 13909.32 13505 14434 2247984 2247984 0.00
crit 68.7 29.82% 28752.28 26333 35247 28755.51 27687 30141 1974408 1974408 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2931 3.4% 72.1 6.08sec 18335 0 13931 28816 18347 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.08 72.04 0.00 0.00 0.0000 0.0000 1321634.69 1321634.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.67 70.34% 13931.10 12783 17110 13933.83 13328 14634 705865 705865 0.00
crit 21.37 29.66% 28815.80 26333 35247 28818.60 26989 30783 615769 615769 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2177 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3563 4.2% 78.0 5.64sec 20607 0 17391 34937 20876 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.03 77.02 0.00 0.00 0.0000 0.0000 1607936.07 1607936.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.73 80.14% 17390.80 15875 21413 17393.53 16752 18073 1073457 1073457 0.00
crit 15.30 19.86% 34936.74 31750 42826 34946.29 32078 38020 534479 534479 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7197 (9454) 8.4% (11.1%) 28.8 15.29sec 148246 125081 0 0 0 0.0% 0.0% 0.0% 0.0% 170.8 15662 32423 18991 19.9% 0.0% 84.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.75 28.75 170.85 170.85 1.1852 2.2356 3244557.40 3244557.40 0.00 10244.87 125081.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.9 80.14% 15661.51 14287 19397 15664.47 15179 16233 2144196 2144196 0.00
crit 33.9 19.86% 32422.92 29431 39957 32426.97 30786 34671 1100362 1100362 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2257 2.6% 53.5 7.97sec 19010 0 15676 32466 19022 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.53 53.50 0.00 0.00 0.0000 0.0000 1017585.52 1017585.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.84 80.07% 15675.79 14287 19397 15678.46 14913 16555 671484 671484 0.00
crit 10.66 19.93% 32466.47 29431 39957 32473.40 29431 36317 346101 346101 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46389 / 3691
melee 46389 4.3% 31.4 12.75sec 52598 51695 45888 92587 52598 20.3% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.38 31.38 0.00 0.00 1.0175 0.0000 1650482.21 1650482.21 0.00 51695.50 51695.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.44 55.58% 45887.73 36329 55931 45903.24 40879 51762 800263 800263 0.00
crit 6.36 20.27% 92586.92 72658 111863 92460.93 0 111863 588856 588856 0.00
glance 7.58 24.15% 34483.27 27247 41949 34479.28 0 41949 261363 261363 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1967 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.60%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.4 0.6 28.5sec 27.3sec 5.53% 28.88%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.53%

Trigger Attempt Success

  • trigger_pct:4.97%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.9sec 108.9sec 19.92% 19.92%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.92%

    Trigger Attempt Success

    • trigger_pct:16.31%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 8.9 36.4sec 20.7sec 43.71% 44.05%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.71%

    Trigger Attempt Success

    • trigger_pct:2.45%
light_of_the_cosmos 9.5 0.0 49.4sec 49.4sec 40.97% 40.97%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:40.97%

    Trigger Attempt Success

    • trigger_pct:14.98%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.9 0.0 10.0sec 10.0sec 9.98% 44.80%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.98%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.17% 14.17%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.64%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no4PT14
devouring_plague Shadow Orb 18.6 55.7 3.0 3.0 119365.3
halo Mana 10.4 420675.1 40500.0 40500.4 3.3
mind_blast Mana 45.9 274991.0 5985.8 5985.8 18.2
mind_flay Mana 112.7 337952.6 3000.0 3000.0 25.8
shadow_word_death Mana 14.3 111631.1 7800.0 7800.1 14.0
shadow_word_insanity Mana 12.6 94555.2 7500.0 7499.9 21.7
shadow_word_pain Mana 56.5 745297.3 13200.0 13200.0 7.4
vampiric_touch Mana 28.8 258753.6 9000.0 9000.0 16.5
Resource Gains Type Count Total Average Overflow
dispersion Mana 2.81 50624.64 (2.56%) 18000.00 0.00 0.00%
shadowfiend Mana 31.38 249491.09 (12.59%) 7950.84 32921.71 11.66%
Shadow Orbs from Mind Blast Shadow Orb 45.94 45.94 (85.32%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.90 7.90 (14.68%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.38 0.00 (-nan%) 0.00 2546502.10 100.00%
Vampiric Touch Mana Mana 224.34 1150409.95 (58.07%) 5127.89 35160.77 2.97%
mp5_regen Mana 1808.89 530554.85 (26.78%) 293.30 12112.03 2.23%
Resource RPS-Gain RPS-Loss
Mana 4379.55 4960.47
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 37229.38 0.00 256500.00
Shadow Orb 1.17 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.3%
shadowfiend-Mana Cap 2.3%
lightwell-Mana Cap 2.3%

Procs

Count Interval
Shadowy Recall Extra Tick 240.5 1.9sec
Shadowy Apparition Procced 78.0 5.6sec
Divine Insight Mind Blast CD Reset 26.5 27.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no4PT14 Damage Per Second
Count 49992
Mean 85220.89
Minimum 67078.49
Maximum 95251.16
Spread ( max - min ) 28172.67
Range [ ( max - min ) / 2 * 100% ] 16.53%
Standard Deviation 3775.1366
5th Percentile 77885.67
95th Percentile 90331.31
( 95th Percentile - 5th Percentile ) 12445.65
Mean Distribution
Standard Deviation 16.8843
95.00% Confidence Intervall ( 85187.80 - 85253.98 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7538
0.1 Scale Factor Error with Delta=300 121660
0.05 Scale Factor Error with Delta=300 486641
0.01 Scale Factor Error with Delta=300 12166033
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 85220.89
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36787049.83
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 358.37
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.67 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.31 shadow_word_death,if=active_enemies<=5
F 49.41 mind_blast,if=active_enemies<=6&cooldown_react
G 18.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 28.85 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.61 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.39 halo,if=talent.halo.enabled
M 13.89 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 73.19 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 33.80 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 57.31 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 37.84 shadow_word_pain,moving=1
X 0.46 dispersion

Sample Sequence

DGLWFHTFTHTIFGTWWWWWFHMTFLFTHIGTFTWWWFHMTFTHIGTFLTWFMWHTFTTHFIGTFGWWHTLFMTTHFTIGTFWWFWHTQFMTTHLFIGTBWWFHTFMTHGTFTLWWWHFTQFMHTIGTFTGWWFHTLTFMTHIGTFTWWWWHFTFMHTIGLQFTWWWFHTQQFMTHIGTFTWFWWHTFMTTFHIGTQFTGBWFHMLTFTEEHIFGTPEDEWWWFHTEETFMTEEFGHTED9EWFHTEEFTLIPPPEDEFT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no2PT14 : 87834 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87834.0 87834.0 18.61 / 0.02% 3434 / 3.9% 17.5 4801.2 4437.4 Mana 0.41% 38.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311010|136965|120566|94424|90633|88642|78998|48328&chds=0,622021&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311010++devouring_plague,9482C9,0,0,15|t++136965++vampiric_touch,9482C9,1,0,15|t++120566++halo,9482C9,2,0,15|t++94424++shadow_word_death,9482C9,3,0,15|t++90633++shadow_word_pain,9482C9,4,0,15|t++88642++mind_blast,9482C9,5,0,15|t++78998++mind_spike,4A79D3,6,0,15|t++48328++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,12,11,9,9,8,6,6,4,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:678776665542354464530ywutrqqoonnoppnmljihggghhiiiihgffdcbbccdddddddcccbbccdefgggffeddccccccddddccbbbaabbcdeefgedcbbabccdeffggggfffeghijjkkjjihgffdeddddeeffeeefeeeeefgggghgfdeeeffffghijjjjjjiiijkjjjjjjjihgeeeeeeffggggggffedeeefggghfdcbbZaZZabcddedddeeefghijkkllkjihgffffeeeeffedddcccccdeeeefeddccbbbcccdddddddddcdeeefggghgggggfffffghhiiiiiiiiiiiijkkkkjhgefegghhjlmoppppqqprstvuutttsqpnljkjjiiiijjjjjjjijjjjkklllkjkkkjjjjjijjjjjkjjjjkllllmmnnnoooooopppqqrrrrrrrrrrrqqqrqqqollkjiihhhhhijjjkklllnpqrrtttuuuttsrsrrqqqpppppooooooonnnnnnmlllklmmnnoppqrrrrsssuwwxxxw&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5761,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=87834|max=152458&chxp=1,1,58,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,0,8,8,0,8,32,16,64,72,128,88,248,376,568,608,904,1400,1608,2120,2536,2896,3128,3312,3320,3672,3496,2968,2976,2560,2480,1984,1520,1304,1056,768,552,304,256,176,136,128,80,40,40,8,8,0,16&chds=0,3672&chbh=5&chxt=x&chxl=0:|min=78101|avg=87834|max=96458&chxp=0,1,53,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.2,13.7,11.4,9.4,7.6,4.4,4.0,2.8,0.5,0.0,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 186.2s|shadow_word_pain 62.1s|mind_blast 51.7s|mind_spike 42.6s|vampiric_touch 34.6s|devouring_plague 20.0s|shadow_word_death 18.0s|halo 12.8s|shadowfiend 2.5s|dispersion 0.0s|waiting 1.9s&chtt=priest_90_pi_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no2PT14 87834
devouring_plague 5204 (13749) 5.9% (15.7%) 17.2 27.37sec 361121 311010 112483 232718 136605 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 0.00 0.00 1.1612 0.0000 2353748.17 2353748.17 0.00 311010.42 311010.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.77 79.94% 112483.04 102399 137090 112515.58 105406 122661 1549377 1549377 0.00
crit 3.46 20.06% 232718.03 210941 282405 227172.10 0 282405 804371 804371 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2042 2.3% 41.0 10.37sec 22536 0 18618 38522 22571 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.02 40.96 0.00 0.00 0.0000 0.0000 924489.88 924489.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.82 80.14% 18617.64 17006 22766 18619.09 17639 19711 611094 611094 0.00
crit 8.14 19.86% 38522.32 35032 46897 38512.99 0 46897 313396 313396 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6503 7.4% 17.2 27.37sec 170866 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.9 18557 38417 22495 19.8% 0.0% 21.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.23 17.23 130.88 130.88 0.0000 0.7378 2944147.41 2944147.41 0.00 30490.03 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 104.9 80.17% 18557.18 17006 22766 18559.12 17685 19602 1947202 1947202 0.00
crit 26.0 19.83% 38416.68 35032 46897 38417.58 35876 41353 996946 996946 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3402) 0.0% (3.9%) 11.3 41.50sec 136045 120566 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 1.1284 0.0000 0.00 0.00 0.00 120565.94 120565.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.06 80.20% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.24 19.80% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3402 3.9% 11.3 41.50sec 136045 0 112058 232215 136043 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 0.0000 0.0000 1537577.45 1537577.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.05 80.04% 112058.45 104363 133162 112045.04 104363 119193 1013656 1013656 0.00
crit 2.26 19.96% 232215.20 214987 274315 212777.88 0 274315 523921 523921 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.50sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.30 245.57 0.00 0.00 0.0000 0.0000 0.00 47854136.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.33 77.10% 0.00 0 0 0.00 0 0 0 29645781 100.00
crit 56.24 22.90% 0.00 0 0 0.00 0 0 0 18208355 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10139 11.5% 42.0 10.74sec 109100 88642 89921 186232 109098 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.02 42.02 0.00 0.00 1.2308 0.0000 4584223.17 4584223.17 0.00 88642.26 88642.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.65 80.09% 89920.67 82079 110390 89939.71 87197 93256 3025963 3025963 0.00
crit 8.37 19.91% 186232.23 169082 227403 186250.23 0 227403 1558260 1558260 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15178 (19929) 17.3% (22.7%) 114.8 3.86sec 78416 48328 0 0 0 0.0% 0.0% 0.0% 0.0% 234.8 24040 49841 29190 20.0% 0.0% 36.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.77 114.77 234.81 234.81 1.6226 0.7058 6854113.82 6854113.82 0.00 48328.13 48328.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.9 80.04% 24039.95 21797 29181 24048.05 23352 24912 4518067 4518067 0.00
crit 46.9 19.96% 49841.24 44901 60113 49859.56 47496 52850 2336047 2336047 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4751 5.4% 73.5 5.96sec 29185 0 24044 49862 29201 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.51 73.47 0.00 0.00 0.0000 0.0000 2145308.95 2145308.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.79 80.02% 24044.05 21797 29181 24051.30 22911 25375 1413581 1413581 0.00
crit 14.68 19.98% 49861.64 44901 60113 49871.77 44901 56842 731728 731728 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7438 8.5% 36.6 11.87sec 91821 78998 75696 156913 91821 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.63 36.63 0.00 0.00 1.1623 0.0000 3362962.25 3362962.25 0.00 78998.41 78998.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.35 80.15% 75696.39 68964 93036 75713.02 71999 80782 2221977 2221977 0.00
crit 7.27 19.85% 156913.01 142066 191655 156781.83 0 191655 1140985 1140985 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3736 4.3% 15.5 4.90sec 109509 94424 89936 186340 109511 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.49 15.49 0.00 0.00 1.1598 0.0000 1696227.81 1696227.81 0.00 94423.73 94423.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.34 79.70% 89936.21 79678 107383 90027.27 83148 99142 1110220 1110220 0.00
crit 3.14 20.30% 186340.40 164137 221210 180536.66 0 221210 586008 586008 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9475 (12446) 10.8% (14.2%) 53.6 8.40sec 104943 90633 0 0 0 0.0% 0.0% 0.0% 0.0% 253.6 13936 28836 16892 19.8% 0.0% 96.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.62 53.62 253.59 253.59 1.1579 1.7148 4283514.92 4283514.92 0.00 11322.50 90632.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 203.3 80.16% 13936.26 12783 17110 13937.90 13438 14392 2833031 2833031 0.00
crit 50.3 19.84% 28835.87 26333 35247 28839.34 27606 30731 1450484 1450484 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2971 3.4% 79.3 5.64sec 16933 0 13971 28938 16946 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.32 79.26 0.00 0.00 0.0000 0.0000 1343132.98 1343132.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.51 80.13% 13971.18 12783 17110 13973.80 13494 14521 887326 887326 0.00
crit 15.75 19.87% 28937.95 26333 35247 28944.45 26558 32011 455807 455807 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2198 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2812 3.2% 61.7 7.24sec 20610 0 17446 35068 20958 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.69 60.66 0.00 0.00 0.0000 0.0000 1271333.35 1271333.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.57 80.07% 17445.80 15875 21413 17449.16 16785 18325 847346 847346 0.00
crit 12.09 19.93% 35067.96 31750 42826 35070.74 31750 39651 423987 423987 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7977 (10478) 9.1% (11.9%) 30.0 15.09sec 157968 136965 0 0 0 0.0% 0.0% 0.0% 0.0% 189.6 15695 32502 19027 19.8% 0.0% 89.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.99 29.99 189.57 189.57 1.1534 2.1282 3607027.12 3607027.12 0.00 10814.67 136965.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.0 80.17% 15695.23 14287 19397 15697.84 15222 16247 2385490 2385490 0.00
crit 37.6 19.83% 32502.03 29431 39957 32507.70 30390 34591 1221537 1221537 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2500 2.8% 59.3 7.43sec 19052 0 15734 32596 19070 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.32 59.26 0.00 0.00 0.0000 0.0000 1130187.81 1130187.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.54 80.21% 15733.53 14287 19397 15736.94 14973 16551 747909 747909 0.00
crit 11.73 19.79% 32596.00 29431 39957 32607.93 29431 37694 382279 382279 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46604 / 3705
melee 46604 4.2% 31.3 12.75sec 52848 52007 46024 92923 52848 20.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.35 31.35 0.00 0.00 1.0162 0.0000 1656538.27 1656538.27 0.00 52007.36 52007.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.44 55.63% 46023.83 36329 55931 46041.85 41472 51804 802491 802491 0.00
crit 6.39 20.39% 92923.31 72658 111863 92851.88 0 111863 593783 593783 0.00
glance 7.52 23.99% 34614.32 27247 41949 34616.51 27247 41949 260264 260264 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1366 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.30%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.01% 20.01%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.01%

    Trigger Attempt Success

    • trigger_pct:16.34%
glyph_mind_spike 25.7 10.9 17.1sec 11.9sec 36.26% 49.48%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.37%
  • glyph_mind_spike_2:7.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.3sec 20.1sec 44.70% 45.28%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.70%

    Trigger Attempt Success

    • trigger_pct:2.37%
light_of_the_cosmos 9.6 0.0 49.2sec 49.2sec 41.36% 41.36%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.36%

    Trigger Attempt Success

    • trigger_pct:14.82%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.54% 20.90%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.93% 49.44%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.93%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 31.9 5.5 13.7sec 11.7sec 19.09% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.56%
  • surge_of_darkness_2:1.52%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.65%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no2PT14
devouring_plague Shadow Orb 17.2 51.7 3.0 3.0 120371.6
halo Mana 11.3 424532.0 37562.8 37562.7 3.6
mind_blast Mana 42.0 364451.6 8673.5 8673.6 12.6
mind_flay Mana 114.8 327811.3 2856.4 2856.4 27.5
shadow_word_death Mana 15.5 116231.7 7503.8 7504.0 14.6
shadow_word_pain Mana 53.6 681167.7 12704.6 12704.5 8.3
vampiric_touch Mana 30.0 257627.2 8590.9 8590.9 18.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.04 662.40 (0.03%) 18000.00 0.00 0.00%
shadowfiend Mana 31.35 232642.87 (11.59%) 7421.90 49466.09 17.53%
Shadow Orbs from Mind Blast Shadow Orb 42.02 42.02 (84.29%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.83 7.83 (15.71%) 1.00 0.00 0.00%
Devouring Plague Health Health 171.84 0.00 (-nan%) 0.00 2386303.95 100.00%
Vampiric Touch Mana Mana 248.84 1249964.85 (62.27%) 5023.26 65253.87 4.96%
mp5_regen Mana 1808.89 523984.42 (26.10%) 289.67 18682.46 3.44%
Resource RPS-Gain RPS-Loss
Mana 4437.41 4801.22
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 135431.00 180.00 300000.00
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.5%
shadowfiend-Mana Cap 3.5%
lightwell-Mana Cap 3.5%

Procs

Count Interval
Shadowy Recall Extra Tick 253.0 1.8sec
Shadowy Apparition Procced 61.7 7.2sec
FDCL Mind Spike proc 37.4 11.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 87834.00
Minimum 78100.92
Maximum 96458.28
Spread ( max - min ) 18357.36
Range [ ( max - min ) / 2 * 100% ] 10.45%
Standard Deviation 2122.4296
5th Percentile 84461.06
95th Percentile 91328.09
( 95th Percentile - 5th Percentile ) 6867.02
Mean Distribution
Standard Deviation 9.4926
95.00% Confidence Intervall ( 87815.40 - 87852.61 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2243
0.1 Scale Factor Error with Delta=300 38454
0.05 Scale Factor Error with Delta=300 153819
0.01 Scale Factor Error with Delta=300 3845477
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 87834.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 38037995.08
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 290.11
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.95 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.49 shadow_word_death,if=active_enemies<=5
F 46.31 mind_blast,if=active_enemies<=6&cooldown_react
G 19.59 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.08 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.55 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.30 halo,if=talent.halo.enabled
M 13.28 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.48 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.83 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 33.07 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.82 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 34.02 shadow_word_pain,moving=1
X 0.01 dispersion

Sample Sequence

CDGLWFHTQFRTHGFMTWWWWFHTLFTHTFGTWWWFHMRTRTFTHRTFGLRRWWWFHMRTFTTHGQFRTQCGWWFHLMTRFTHTGFTRTWRFMHRTFTTLGHFRTBWWFHMTRTFTHRGQFTLWWWWFHMTRRFTHRGQFRTCGWWFHMTLTFTHGQFTWRWWFHTFTHGFLMRTRFWHRTFTTRHQFMTGTFWWWWHLFTTFHTGRTQFMRGBCRFHTFTEEGHJFLMPEEWWWWWFEDEHRTQFTEETGFHDPEER9WWFLEDEHTFTEERFGHTEDE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no4PT14 : 89949 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
89948.8 89948.8 18.47 / 0.02% 3441 / 3.8% 18.0 4800.3 4436.7 Mana 0.41% 38.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:310932|137038|120287|98543|94391|88655|78962|48310&chds=0,621865&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++310932++devouring_plague,9482C9,0,0,15|t++137038++vampiric_touch,9482C9,1,0,15|t++120287++halo,9482C9,2,0,15|t++98543++shadow_word_pain,9482C9,3,0,15|t++94391++shadow_word_death,9482C9,4,0,15|t++88655++mind_blast,9482C9,5,0,15|t++78962++mind_spike,4A79D3,6,0,15|t++48310++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,12,12,9,9,8,6,6,4,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:578776665542354565531ywvtrrqpooooqpomlkihhhhhhiiiihgffdcccccdeeeeddddcbcdddefggggfeeddddccddddedccbbbbbccdeffgfdccbbbccdefgghgggggfghijkkkjkjihgfeeeeeeeffffefffffffgghhhhgfeefffggggijkkjjjjjijklkjkjkkjihgfefeeefggghggggfeeeeffgghhfedcbaaaabcdeefeeeeeefgijkllllljjihggffffffffeeeddccdddeffffeddddccccccddeeddeeddeffffghhhhhhggfgggghhiiiiijjiiiiijjkkkljhgfffghhijlnopppqqqqrtuvvvuttsrpnlkkkjjjjjjjjjjjjjjjjjklllmlkkkkjkjjjjjjkkkkkkjjkllllmmnooooooopppqqrrssssssrrrrrrrrqqqomlkjiiihhhiijjjkklllnpqrstttuuuutsstssrrqqqqppppppoooooonnnmlmlllnnoopqqrsttstttvxxyzzy&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5840,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=89949|max=154031&chxp=1,1,58,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,0,8,16,8,16,32,40,88,136,176,272,440,464,936,1168,1344,1736,2224,2680,2712,3216,3496,3184,3560,3280,3128,2744,2544,2216,1752,1544,1128,1072,784,520,376,312,208,144,104,72,24,24,8,16,24&chds=0,3560&chbh=5&chxt=x&chxl=0:|min=80197|avg=89949|max=98076&chxp=0,1,55,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.2,13.7,11.4,9.4,7.6,4.4,4.0,2.8,0.5,0.0,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 186.4s|shadow_word_pain 62.0s|mind_blast 51.7s|mind_spike 42.5s|vampiric_touch 34.6s|devouring_plague 20.0s|shadow_word_death 18.0s|halo 12.8s|shadowfiend 2.5s|dispersion 0.0s|waiting 1.8s&chtt=priest_90_pi_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no4PT14 89949
devouring_plague 5197 (13739) 5.8% (15.3%) 17.2 27.38sec 360921 310932 112469 232774 136435 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.22 17.22 0.00 0.00 1.1608 0.0000 2349552.02 2349552.02 0.00 310932.40 310932.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.79 80.08% 112469.16 102399 137090 112502.02 106102 119691 1551063 1551063 0.00
crit 3.43 19.92% 232773.87 210941 282405 227158.57 0 282405 798489 798489 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2038 2.3% 40.9 10.39sec 22524 0 18602 38502 22557 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.95 40.89 0.00 0.00 0.0000 0.0000 922278.35 922278.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.76 80.13% 18602.33 17006 22766 18606.06 17592 19707 609429 609429 0.00
crit 8.13 19.87% 38501.59 35032 46897 38487.32 0 46897 312849 312849 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6504 7.2% 17.2 27.38sec 170934 0 0 0 0 0.0% 0.0% 0.0% 0.0% 130.9 18557 38411 22480 19.8% 0.0% 21.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.22 17.22 130.95 130.95 0.0000 0.7375 2943708.26 2943708.26 0.00 30482.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.1 80.24% 18556.99 17006 22766 18561.12 17662 19449 1949827 1949827 0.00
crit 25.9 19.76% 38410.59 35032 46897 38416.61 35697 41550 993881 993881 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3393) 0.0% (3.8%) 11.3 41.49sec 135748 120287 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 1.1286 0.0000 0.00 0.00 0.00 120286.63 120286.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.05 80.07% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.25 19.93% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3393 3.8% 11.3 41.49sec 135748 0 112114 231649 135749 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.30 0.00 0.00 0.0000 0.0000 1533895.08 1533895.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.07 80.23% 112113.59 104363 133162 112116.43 106065 119166 1016365 1016365 0.00
crit 2.23 19.77% 231649.35 214987 274315 211709.32 0 274315 517530 517530 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.49sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.30 245.46 0.00 0.00 0.0000 0.0000 0.00 47835498.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.16 77.06% 0.00 0 0 0.00 0 0 0 29611387 100.00
crit 56.31 22.94% 0.00 0 0 0.00 0 0 0 18224111 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10141 11.3% 42.0 10.75sec 109138 88655 89926 186299 109138 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.00 42.00 0.00 0.00 1.2310 0.0000 4584021.13 4584021.13 0.00 88655.50 88655.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 33.63 80.07% 89925.75 82079 110390 89944.72 86933 93473 3024131 3024131 0.00
crit 8.37 19.93% 186298.75 169082 227403 186276.40 0 227403 1559890 1559890 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15194 (19945) 16.9% (22.2%) 114.9 3.86sec 78420 48310 0 0 0 0.0% 0.0% 0.0% 0.0% 235.1 24039 49828 29188 20.0% 0.0% 36.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.86 114.86 235.09 235.09 1.6233 0.7058 6861768.14 6861768.14 0.00 48310.40 48310.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 188.1 80.03% 24038.75 21797 29181 24046.72 23317 24847 4522737 4522737 0.00
crit 46.9 19.97% 49827.69 44901 60113 49843.15 47387 52709 2339031 2339031 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4751 5.3% 73.5 5.95sec 29174 0 24046 49832 29187 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.55 73.51 0.00 0.00 0.0000 0.0000 2145657.47 2145657.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.86 80.06% 24046.29 21797 29181 24054.02 23035 25373 1415239 1415239 0.00
crit 14.66 19.94% 49832.43 44901 60113 49861.30 45576 54916 730418 730418 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7418 8.3% 36.5 11.90sec 91813 78962 75706 156840 91813 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.53 36.53 0.00 0.00 1.1628 0.0000 3353926.57 3353926.57 0.00 78962.37 78962.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.28 80.15% 75706.41 68964 93036 75726.21 71468 80742 2216544 2216544 0.00
crit 7.25 19.85% 156839.57 142066 191655 156658.41 0 191655 1137383 1137383 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3737 4.2% 15.5 4.90sec 109461 94391 89939 186448 109459 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.50 15.50 0.00 0.00 1.1597 0.0000 1696306.94 1696306.94 0.00 94391.35 94391.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.36 79.77% 89938.77 79678 107383 90043.46 82266 99467 1111841 1111841 0.00
crit 3.13 20.23% 186448.31 164137 221210 180714.12 0 221210 584466 584466 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10296 (13521) 11.5% (15.0%) 53.6 8.41sec 114100 98543 0 0 0 0.0% 0.0% 0.0% 0.0% 253.6 13932 28799 18355 29.7% 0.0% 96.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.58 53.58 253.61 253.61 1.1579 1.7151 4654899.75 4654899.75 0.00 12300.44 98543.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.2 70.25% 13932.40 12783 17110 13934.20 13451 14383 2482294 2482294 0.00
crit 75.4 29.75% 28798.97 26333 35247 28802.45 27594 29929 2172606 2172606 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3225 3.6% 79.3 5.64sec 18390 0 13969 28893 18406 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.30 79.23 0.00 0.00 0.0000 0.0000 1458321.17 1458321.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.68 70.27% 13969.45 12783 17110 13972.14 13467 14532 777815 777815 0.00
crit 23.55 29.73% 28893.36 26333 35247 28897.68 27058 30694 680507 680507 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2194 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3867 4.3% 84.9 5.28sec 20598 0 17432 35045 20938 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.92 83.54 0.00 0.00 0.0000 0.0000 1749123.36 1749123.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.91 80.09% 17431.56 15875 21413 17434.59 16792 18030 1166318 1166318 0.00
crit 16.63 19.91% 35045.48 31750 42826 35055.00 32143 38599 582805 582805 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7981 (10484) 8.9% (11.7%) 30.0 15.09sec 158025 137038 0 0 0 0.0% 0.0% 0.0% 0.0% 189.6 15696 32518 19031 19.8% 0.0% 89.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.99 29.99 189.60 189.60 1.1532 2.1281 3608249.24 3608249.24 0.00 10819.45 137037.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.0 80.18% 15696.04 14287 19397 15698.63 15222 16259 2386007 2386007 0.00
crit 37.6 19.82% 32517.95 29431 39957 32522.47 30572 34437 1222243 1222243 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2503 2.8% 59.2 7.44sec 19097 0 15732 32593 19113 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.25 59.20 0.00 0.00 0.0000 0.0000 1131471.76 1131471.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.33 79.95% 15732.04 14287 19397 15735.34 15057 16613 744595 744595 0.00
crit 11.87 20.05% 32593.17 29431 39957 32599.42 29431 38579 386877 386877 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46581 / 3704
melee 46581 4.1% 31.3 12.75sec 52838 51999 46022 92957 52837 20.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.35 31.35 0.00 0.00 1.0161 0.0000 1656232.00 1656232.00 0.00 51999.37 51999.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 55.49% 46022.50 36329 55931 46032.55 40825 51642 800459 800459 0.00
crit 6.39 20.39% 92956.68 72658 111863 92857.59 0 111863 594058 594058 0.00
glance 7.56 24.13% 34608.26 27247 41949 34616.76 0 41949 261716 261716 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1365 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.30%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.00% 20.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.00%

    Trigger Attempt Success

    • trigger_pct:16.13%
glyph_mind_spike 25.7 10.8 17.1sec 11.9sec 36.19% 49.35%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.31%
  • glyph_mind_spike_2:7.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.4 36.1sec 20.1sec 44.65% 45.19%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.65%

    Trigger Attempt Success

    • trigger_pct:2.37%
light_of_the_cosmos 9.6 0.0 49.1sec 49.1sec 41.39% 41.39%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.39%

    Trigger Attempt Success

    • trigger_pct:14.88%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.54% 20.93%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.93% 49.43%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.93%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 31.9 5.4 13.8sec 11.7sec 19.02% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:17.50%
  • surge_of_darkness_2:1.52%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.66%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no4PT14
devouring_plague Shadow Orb 17.2 51.7 3.0 3.0 120305.1
halo Mana 11.3 424449.1 37563.5 37563.3 3.6
mind_blast Mana 42.0 364288.0 8673.0 8673.1 12.6
mind_flay Mana 114.9 328107.8 2856.6 2856.5 27.5
shadow_word_death Mana 15.5 116272.7 7502.8 7503.0 14.6
shadow_word_pain Mana 53.6 680614.4 12703.6 12703.3 9.0
vampiric_touch Mana 30.0 257653.4 8590.4 8590.3 18.4
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.03 489.60 (0.02%) 18000.00 0.00 0.00%
shadowfiend Mana 31.35 232551.20 (11.59%) 7418.90 49560.64 17.57%
Shadow Orbs from Mind Blast Shadow Orb 42.00 42.00 (84.28%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.84 7.84 (15.72%) 1.00 0.00 0.00%
Devouring Plague Health Health 171.84 0.00 (-nan%) 0.00 2386226.18 100.00%
Vampiric Touch Mana Mana 248.80 1249898.22 (62.28%) 5023.77 65289.78 4.96%
mp5_regen Mana 1808.89 523981.08 (26.11%) 289.67 18685.80 3.44%
Resource RPS-Gain RPS-Loss
Mana 4436.67 4800.26
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 135536.39 0.00 293700.00
Shadow Orb 1.17 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.5%
shadowfiend-Mana Cap 3.5%
lightwell-Mana Cap 3.5%

Procs

Count Interval
Shadowy Recall Extra Tick 252.8 1.8sec
Shadowy Apparition Procced 84.9 5.3sec
FDCL Mind Spike proc 37.3 11.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 89948.84
Minimum 80197.28
Maximum 98076.31
Spread ( max - min ) 17879.03
Range [ ( max - min ) / 2 * 100% ] 9.94%
Standard Deviation 2106.5572
5th Percentile 86593.59
95th Percentile 93475.66
( 95th Percentile - 5th Percentile ) 6882.07
Mean Distribution
Standard Deviation 9.4216
95.00% Confidence Intervall ( 89930.38 - 89967.31 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2106
0.1 Scale Factor Error with Delta=300 37881
0.05 Scale Factor Error with Delta=300 151527
0.01 Scale Factor Error with Delta=300 3788176
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 89948.84
Distribution Chart

Damage

Sample Data
Count 49992
Mean 38993179.23
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 289.75
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.95 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.50 shadow_word_death,if=active_enemies<=5
F 46.28 mind_blast,if=active_enemies<=6&cooldown_react
G 19.60 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.09 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.53 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.30 halo,if=talent.halo.enabled
M 13.27 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.73 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 33.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.86 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 33.98 shadow_word_pain,moving=1
X 0.01 dispersion

Sample Sequence

CDGLWFHTRTFTHTGQFMRTWWWWWFHRTLFTHTFGTWWWFHMTQFRTHRTGFLRTWWWWFHMTFTHTGFTCGWWFHLTJRTFMRTHGQFRTRTWFWHTQFMTTHLFRGTFBRWHTFTTQFHMTGTFTLWWWHQFRTTFHMTGTFTCGWWFHTRLTFMTHTGFRRTWWWFHTFMTRHLFGRTWWWFHTQFMRTHTGFRTWLWWWFHRTQFMTHTFGTGBCRFHTLTFMREEGHTFTEDEWWRFHTEERTFMTEEHGFLRTE9DERFHTEEFGTHEDEFRTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no2PT14 : 89136 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
89136.2 89136.2 15.56 / 0.02% 2892 / 3.2% 15.7 5053.3 4789.1 Mana 0.45% 34.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://2.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:308933|136430|120264|94233|86495|83080|49084&chds=0,617867&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308933++devouring_plague,9482C9,0,0,15|t++136430++vampiric_touch,9482C9,1,0,15|t++120264++halo,9482C9,2,0,15|t++94233++shadow_word_death,9482C9,3,0,15|t++86495++mind_blast,9482C9,4,0,15|t++83080++shadow_word_pain,9482C9,5,0,15|t++49084++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,12,12,12,10,8,7,6,5,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mindbender: melee|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb_no2PT14 Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:014676555531343454420yvspmmmkkjklnmkjihgedeeffgfefdcaaYYZaabdeghiijlllkkmmmmnnllkihfdbbaZZZZaaaZaZZZZZaabceeeedcbaaZcddeghjjkklmmmlmnopqqponmkjhfdecbbbbbccbbbcbbabbcdeeeedccbbbbcbbbcdfffghhhhhiijjklklkjjhgffedccddddddddcbbbbcceeefdcbZYYaaabcefghhjijklmmnpqrqqqpnlkighfedcccccbaaaZZZZaabcccccbaaZZZabbcdefgghijkklmmmnnonnmllkihigfeeefffffggfffffggiiiihfedcbccccdfhijjllmnoprrssuvuutsronllkjhhfffgfhggggghhhijjjkjiiiihighiiijkllmmnopqrrrrstuttssrrqrqqppoooooppppppppoopoonmjiihggfffghijllnopqruxyyz001110zxwuvttrqponnmnmmmmnnmmmnmmmlkklkklkjkkkkllllllllmnmmmnn&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5743,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=89136|max=155202&chxp=1,1,57,100&chtt=priest_90_pi_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,8,40,16,56,48,128,232,344,440,624,616,904,1192,1448,1808,1960,2136,2744,2880,2880,3000,2968,2896,2640,2568,2232,2320,1864,1704,1496,1200,1176,800,720,440,336,248,288,224,80,104,32,16,40,40,8,16,16&chds=0,3000&chbh=5&chxt=x&chxl=0:|min=82926|avg=89136|max=95999&chxp=0,1,48,100&chtt=priest_90_pi_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.8,15.4,11.1,7.6,4.2,4.0,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 216.3s|shadow_word_pain 69.6s|mind_blast 50.2s|vampiric_touch 34.5s|devouring_plague 19.2s|shadow_word_death 17.9s|halo 12.8s|mindbender 8.0s|waiting 2.0s&chtt=priest_90_pi_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no2PT14 89136
devouring_plague 4979 (13069) 5.6% (14.7%) 16.5 28.54sec 358959 308933 112648 233269 136631 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 0.00 0.00 1.1620 0.0000 2252395.85 2252395.85 0.00 308933.40 308933.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.21 80.12% 112648.07 102399 137090 112692.98 105839 121691 1487868 1487868 0.00
crit 3.28 19.88% 233269.18 210941 282405 225422.99 0 282405 764528 764528 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1930 2.2% 38.8 10.88sec 22516 0 18602 38504 22553 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.84 38.78 0.00 0.00 0.0000 0.0000 874613.43 874613.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.08 80.15% 18602.02 17006 22766 18604.27 17396 20272 578188 578188 0.00
crit 7.70 19.85% 38503.67 35032 46897 38492.90 0 44793 296425 296425 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6159 6.9% 16.5 28.54sec 169276 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.8 18582 38480 22533 19.9% 0.0% 20.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.49 16.49 123.85 123.85 0.0000 0.7399 2790610.00 2790610.00 0.00 30452.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.3 80.14% 18581.68 17006 22766 18585.12 17593 19581 1844379 1844379 0.00
crit 24.6 19.86% 38479.60 35032 46897 38482.41 35391 41855 946231 946231 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3401) 0.0% (3.8%) 11.3 41.44sec 135719 120264 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 0.00 0.00 1.1285 0.0000 0.00 0.00 0.00 120264.35 120264.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.10 80.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.24 19.73% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3401 3.8% 11.3 41.44sec 135719 0 112066 231817 135720 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 0.00 0.00 0.0000 0.0000 1538301.26 1538301.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.10 80.25% 112065.73 104363 133162 112056.14 105493 119434 1019318 1019318 0.00
crit 2.24 19.75% 231816.63 214987 274315 211000.04 0 274315 518984 518984 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.44sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.33 247.85 0.00 0.00 0.0000 0.0000 0.00 48265845.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 191.13 77.12% 0.00 0 0 0.00 0 0 0 29910021 100.00
crit 56.72 22.88% 0.00 0 0 0.00 0 0 0 18355824 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9586 10.8% 39.8 11.36sec 109044 86495 89947 186292 109045 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.79 39.79 0.00 0.00 1.2607 0.0000 4339003.53 4339003.53 0.00 86494.64 86494.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.90 80.18% 89946.97 82079 110390 89973.14 86950 93507 2869683 2869683 0.00
crit 7.89 19.82% 186292.22 169082 227403 186334.42 0 214864 1469321 1469321 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17912 (23523) 20.1% (26.3%) 130.8 3.40sec 81181 49084 0 0 0 0.0% 0.0% 0.0% 0.0% 277.0 24039 49826 29190 20.0% 0.0% 43.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.76 130.76 276.95 276.95 1.6539 0.7062 8084130.89 8084130.89 0.00 49083.94 49083.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.76 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 221.6 80.03% 24039.37 21797 29181 24046.27 23494 24700 5328070 5328070 0.00
crit 55.3 19.97% 49826.34 44901 60113 49841.88 47640 52755 2756061 2756061 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5611 6.3% 86.8 5.06sec 29171 0 24052 49830 29187 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.78 86.73 0.00 0.00 0.0000 0.0000 2531498.88 2531498.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.46 80.08% 24051.75 21797 29181 24058.65 23192 25163 1670518 1670518 0.00
crit 17.28 19.92% 49829.76 44901 60113 49843.11 46140 55435 860981 860981 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.0 60.69sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.96 6.96 0.00 0.00 1.1437 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3717 4.2% 15.4 4.92sec 109379 94233 89980 186588 109381 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 1.1608 0.0000 1687704.45 1687704.45 0.00 94232.52 94232.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 79.92% 89980.01 79678 107383 90071.57 82485 99228 1109584 1109584 0.00
crit 3.10 20.08% 186587.95 164137 221210 180290.05 0 221210 578121 578121 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9726 (12779) 10.9% (14.3%) 59.9 7.52sec 96535 83080 0 0 0 0.0% 0.0% 0.0% 0.0% 260.4 13932 28831 16896 19.9% 0.0% 96.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.87 59.87 260.35 260.35 1.1620 1.6741 4398990.68 4398990.68 0.00 11435.48 83079.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 208.6 80.10% 13932.07 12783 17110 13933.79 13540 14401 2905590 2905590 0.00
crit 51.8 19.90% 28831.31 26333 35247 28834.13 27592 30426 1493400 1493400 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3053 3.4% 81.5 5.48sec 16932 0 13973 28931 16944 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.55 81.48 0.00 0.00 0.0000 0.0000 1380697.70 1380697.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.30 80.13% 13973.00 12783 17110 13976.01 13466 14538 912384 912384 0.00
crit 16.19 19.87% 28930.96 26333 35247 28935.48 26784 32384 468313 468313 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2868 3.2% 63.0 7.09sec 20589 0 17445 35073 20940 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.02 61.96 0.00 0.00 0.0000 0.0000 1297430.53 1297430.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.67 80.17% 17444.97 15875 21413 17448.45 16664 18293 866555 866555 0.00
crit 12.29 19.83% 35073.16 31750 42826 35078.60 32113 40136 430875 430875 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7937 (10425) 8.9% (11.7%) 30.0 15.12sec 157358 136430 0 0 0 0.0% 0.0% 0.0% 0.0% 188.4 15693 32506 19042 19.9% 0.0% 88.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.95 29.95 188.45 188.45 1.1534 2.1315 3588337.17 3588337.17 0.00 10804.80 136429.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 150.9 80.08% 15693.28 14287 19397 15695.45 15182 16245 2368374 2368374 0.00
crit 37.5 19.92% 32506.05 29431 39957 32509.29 30764 34991 1219963 1219963 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2488 2.8% 58.9 7.48sec 19088 0 15738 32608 19105 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.93 58.88 0.00 0.00 0.0000 0.0000 1124901.12 1124901.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.13 80.04% 15737.52 14287 19397 15740.84 14992 16524 741682 741682 0.00
crit 11.75 19.96% 32607.93 29431 39957 32617.90 29431 37160 383219 383219 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37677 / 9768
melee 37677 10.9% 105.5 4.18sec 41779 39171 36475 73421 41779 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.51 105.51 0.00 0.00 1.0666 0.0000 4407959.09 4407959.09 0.00 39171.41 39171.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.84 55.77% 36475.50 29063 44745 36495.45 34678 38613 2146232 2146232 0.00
crit 21.36 20.24% 73421.50 58126 89490 73461.18 67022 81269 1568176 1568176 0.00
glance 25.31 23.99% 27404.17 21797 33559 27419.15 25271 29475 693550 693550 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 23.49 0.00 0.00 1.1255 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.29%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.99% 19.99%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.99%

    Trigger Attempt Success

    • trigger_pct:16.07%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.5 36.2sec 20.1sec 44.74% 45.37%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.74%

    Trigger Attempt Success

    • trigger_pct:2.37%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.48% 41.48%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.48%

    Trigger Attempt Success

    • trigger_pct:14.85%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.53% 21.00%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.88% 49.43%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.5 0.0 19.3sec 19.3sec 85.39% 83.91%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.73% 1.73%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.73%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no2PT14
devouring_plague Shadow Orb 16.5 49.5 3.0 3.0 119652.3
halo Mana 11.3 425653.1 37554.1 37553.9 3.6
mind_blast Mana 39.8 345995.7 8695.2 8695.3 12.5
mind_flay Mana 130.8 374191.4 2861.6 2861.6 28.4
shadow_word_death Mana 15.4 115897.8 7511.1 7511.3 14.6
shadow_word_pain Mana 59.9 766261.5 12798.7 12798.5 7.5
vampiric_touch Mana 30.0 257869.4 8609.3 8609.3 18.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.51 419765.75 (19.38%) 3978.52 42459.77 9.19%
Shadow Orbs from Mind Blast Shadow Orb 39.79 39.79 (83.61%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.80 7.80 (16.39%) 1.00 0.00 0.00%
Devouring Plague Health Health 162.63 0.00 (-nan%) 0.00 2258376.05 100.00%
Vampiric Touch Mana Mana 247.33 1229890.39 (56.77%) 4972.73 77431.85 5.92%
mp5_regen Mana 1808.89 516668.47 (23.85%) 285.63 25998.41 4.79%
Resource RPS-Gain RPS-Loss
Mana 4789.07 5053.34
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 180445.58 7621.90 297132.38
Shadow Orb 1.13 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.9%
shadowfiend-Mana Cap 4.9%
lightwell-Mana Cap 4.9%

Procs

Count Interval
Shadowy Recall Extra Tick 265.9 1.7sec
Shadowy Apparition Procced 63.0 7.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no2PT14 Damage Per Second
Count 49992
Mean 89136.23
Minimum 82925.74
Maximum 95999.07
Spread ( max - min ) 13073.34
Range [ ( max - min ) / 2 * 100% ] 7.33%
Standard Deviation 1774.5953
5th Percentile 86312.14
95th Percentile 92096.24
( 95th Percentile - 5th Percentile ) 5784.10
Mean Distribution
Standard Deviation 7.9369
95.00% Confidence Intervall ( 89120.67 - 89151.78 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1522
0.1 Scale Factor Error with Delta=300 26883
0.05 Scale Factor Error with Delta=300 107533
0.01 Scale Factor Error with Delta=300 2688328
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 89136.23
Distribution Chart

Damage

Sample Data
Count 49992
Mean 35888615.49
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 262.02
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.96 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.99 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.43 shadow_word_death,if=active_enemies<=5
F 44.98 mind_blast,if=active_enemies<=6&cooldown_react
G 19.16 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.05 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.33 halo,if=talent.halo.enabled
M 12.50 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.38 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.56 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.68 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.71 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGLWFHTFTHTFGTWWWWWFHMTLFTHTFGTAWWFHTQQFMTHTGTFLTWWWWFHTQQFMTHTGFTCGAWFHLTFTHGQFMTWWWWFHTFTLHTGTFMTWAWFHTQFTHTGFMTLWWWWFHTQFTHTGTFMTCGWAFHTLTQFTGHQFTWWWWFHMTFTHLGFTWWAFHTFMTHTGTFTWLWWWHFTTFHMTGTFTGCWWAFHTLTFMEETGHTFPEDEWWWWFHEETQFTEDEGHFLTPEEW9WWAFDEEHTQFTEDETGHFTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no4PT14 : 91293 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
91292.8 91292.8 15.66 / 0.02% 2966 / 3.2% 16.1 5053.6 4789.1 Mana 0.45% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://6.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:308793|136615|120237|94220|90250|86541|49086&chds=0,617585&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308793++devouring_plague,9482C9,0,0,15|t++136615++vampiric_touch,9482C9,1,0,15|t++120237++halo,9482C9,2,0,15|t++94220++shadow_word_death,9482C9,3,0,15|t++90250++shadow_word_pain,9482C9,4,0,15|t++86541++mind_blast,9482C9,5,0,15|t++49086++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,13,12,12,10,8,7,6,5,5,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mindbender: melee|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb_no4PT14 Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024686555531343454430yvspmnmkkkllnnkkjigfeeefggfffecbaYYZabbdfghjiklllklmnnmnomlkjhfeccbZZaaaaaZaaZaZabbcceeefecbaaacddeghjjlkmmmmmnooqqrpoomljhgefdcbbcccdbbbcccbcbcdeeeeedcbbbbcbbcdefgfhhiihhiijjklkllkjigfffdcddeeeeeeddcbcbcdefefecbaZYbaabdefghhjjkllmnnpqrqrqpnmkihhgedcccddbbaaaZaaaacdccdcbbaZZaabcceeghghjkkklmmmnnoonnmlkjhihgfeeffgfggggffgfggiiiihfeddbccddefhikjllmnoprrssuvuuusrpnlmkkihggggghhhhhhhhiikjjkjiiiiiihiiijkkllmnopprssrrstuuttssrqrqqppoopoopppppppppopooomkjihghgffghijllnopqruxyyz001110zywuvttsrqonnmnmmmmnnmmmnmmmlkkkkklkkkkklmnnnooooprqqqss&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5803,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=91293|max=157312&chxp=1,1,58,100&chtt=priest_90_pi_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:48,32,80,136,224,256,264,488,624,872,976,1192,1408,1592,2056,2296,2216,2536,2704,2872,3000,2872,2928,2656,2392,1944,1960,1768,1360,1224,952,808,648,528,440,512,232,296,136,128,40,120,40,48,16,24,16,0,8,24&chds=0,3000&chbh=5&chxt=x&chxl=0:|min=86076|avg=91293|max=98573&chxp=0,1,42,100&chtt=priest_90_pi_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.8,15.4,11.1,7.6,4.2,4.0,2.8,1.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 216.3s|shadow_word_pain 69.6s|mind_blast 50.2s|vampiric_touch 34.5s|devouring_plague 19.1s|shadow_word_death 17.9s|halo 12.8s|mindbender 8.0s|waiting 2.0s&chtt=priest_90_pi_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no4PT14 91293
devouring_plague 4977 (13047) 5.5% (14.3%) 16.5 28.55sec 358720 308793 112632 233250 136711 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 0.00 0.00 1.1617 0.0000 2251884.92 2251884.92 0.00 308792.58 308792.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.18 80.04% 112631.62 102399 137090 112665.95 105223 120142 1484873 1484873 0.00
crit 3.29 19.96% 233249.55 210941 282405 227478.53 0 282405 767012 767012 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1918 2.1% 38.6 10.94sec 22514 0 18605 38510 22552 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.61 38.55 0.00 0.00 0.0000 0.0000 869362.22 869362.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.90 80.17% 18605.20 17006 22766 18608.66 17434 20006 574982 574982 0.00
crit 7.64 19.83% 38509.54 35032 46897 38500.43 0 46897 294380 294380 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6152 6.8% 16.5 28.55sec 169229 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.8 18579 38457 22524 19.8% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.47 16.47 123.75 123.75 0.0000 0.7399 2787498.81 2787498.81 0.00 30440.85 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.2 80.15% 18578.63 17006 22766 18581.22 17669 19508 1842812 1842812 0.00
crit 24.6 19.85% 38456.63 35032 46897 38461.67 35730 41353 944687 944687 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3401) 0.0% (3.7%) 11.3 41.43sec 135702 120237 0 0 0 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 0.00 0.00 1.1287 0.0000 0.00 0.00 0.00 120236.74 120236.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.12 80.47% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.53% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3401 3.7% 11.3 41.43sec 135702 0 112083 231836 135705 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 0.00 0.00 0.0000 0.0000 1537587.38 1537587.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.10 80.28% 112082.58 104363 133162 112077.40 104363 121427 1019486 1019486 0.00
crit 2.23 19.72% 231836.33 214987 274315 210924.71 0 274315 518102 518102 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.43sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.33 247.79 0.00 0.00 0.0000 0.0000 0.00 48277773.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 190.99 77.08% 0.00 0 0 0.00 0 0 0 29891617 100.00
crit 56.80 22.92% 0.00 0 0 0.00 0 0 0 18386157 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9592 10.5% 39.8 11.36sec 109135 86541 89953 186251 109134 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.78 39.78 0.00 0.00 1.2611 0.0000 4341080.85 4341080.85 0.00 86541.22 86541.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.85 80.08% 89953.41 82079 110390 89977.50 86860 93647 2865379 2865379 0.00
crit 7.92 19.92% 186251.32 169082 227403 186228.92 0 227403 1475702 1475702 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17915 (23527) 19.6% (25.7%) 130.7 3.40sec 81218 49086 0 0 0 0.0% 0.0% 0.0% 0.0% 277.0 24037 49827 29182 20.0% 0.0% 43.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.73 130.73 277.05 277.05 1.6546 0.7062 8084868.88 8084868.88 0.00 49085.93 49085.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 221.8 80.05% 24037.07 21797 29181 24044.42 23469 24657 5330808 5330808 0.00
crit 55.3 19.95% 49826.74 44901 60113 49842.89 47686 52913 2754061 2754061 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5612 6.1% 86.8 5.06sec 29192 0 24045 49860 29207 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.78 86.73 0.00 0.00 0.0000 0.0000 2533203.75 2533203.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.39 80.01% 24045.38 21797 29181 24052.49 23086 25265 1668560 1668560 0.00
crit 17.34 19.99% 49859.59 44901 60113 49873.82 45913 54542 864643 864643 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 7.0 60.70sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.96 6.96 0.00 0.00 1.1443 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.07sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3718 4.1% 15.4 4.92sec 109383 94220 90015 186542 109382 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.43 15.43 0.00 0.00 1.1610 0.0000 1687848.25 1687848.25 0.00 94219.51 94219.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.33 79.94% 90015.45 79678 107383 90111.91 83419 97370 1110314 1110314 0.00
crit 3.10 20.06% 186542.47 164137 221210 180425.25 0 221210 577534 577534 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10568 (13891) 11.6% (15.2%) 59.9 7.51sec 104861 90250 0 0 0 0.0% 0.0% 0.0% 0.0% 260.3 13934 28795 18358 29.8% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.91 59.91 260.35 260.35 1.1619 1.6740 4779480.11 4779480.11 0.00 12429.73 90250.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.8 70.23% 13933.64 12783 17110 13935.41 13545 14434 2547661 2547661 0.00
crit 77.5 29.77% 28795.48 26333 35247 28797.70 27685 30369 2231819 2231819 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3323 3.6% 81.6 5.48sec 18418 0 13972 28892 18433 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.60 81.53 0.00 0.00 0.0000 0.0000 1502827.59 1502827.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.15 70.10% 13971.60 12783 17110 13974.40 13317 14627 798468 798468 0.00
crit 24.38 29.90% 28892.45 26333 35247 28898.34 27302 31345 704360 704360 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3931 4.3% 86.4 5.19sec 20582 0 17432 35064 20930 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.40 84.96 0.00 0.00 0.0000 0.0000 1778312.90 1778312.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.11 80.16% 17432.00 15875 21413 17434.59 16794 18076 1187245 1187245 0.00
crit 16.86 19.84% 35064.20 31750 42826 35073.29 32475 38341 591068 591068 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7941 (10432) 8.7% (11.4%) 29.9 15.12sec 157548 136615 0 0 0 0.0% 0.0% 0.0% 0.0% 188.5 15699 32504 19046 19.9% 0.0% 88.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.94 29.94 188.52 188.52 1.1532 2.1307 3590532.88 3590532.88 0.00 10813.61 136615.37
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 151.0 80.08% 15699.21 14287 19397 15701.21 15197 16287 2370180 2370180 0.00
crit 37.5 19.92% 32504.50 29431 39957 32507.57 30744 34495 1220353 1220353 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2491 2.7% 59.0 7.47sec 19092 0 15740 32622 19109 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.00 58.95 0.00 0.00 0.0000 0.0000 1126385.94 1126385.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.18 80.04% 15739.99 14287 19397 15744.77 15063 16627 742647 742647 0.00
crit 11.76 19.96% 32621.95 29431 39957 32623.46 29431 36194 383739 383739 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37632 / 9754
melee 37632 10.7% 105.5 4.18sec 41727 39126 36473 73495 41728 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.50 105.50 0.00 0.00 1.0665 0.0000 4402002.50 4402002.50 0.00 39126.13 39126.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.00 55.93% 36473.17 29063 44745 36491.49 34762 38792 2152009 2152009 0.00
crit 21.17 20.07% 73494.51 58126 89490 73540.04 66550 81237 1555848 1555848 0.00
glance 25.32 24.00% 27411.30 21797 33559 27422.31 25068 29523 694146 694146 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.5 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.49 23.49 0.00 0.00 1.1256 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.28%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.01% 20.01%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.01%

    Trigger Attempt Success

    • trigger_pct:16.27%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.6 36.3sec 20.0sec 44.79% 45.41%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.79%

    Trigger Attempt Success

    • trigger_pct:2.38%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.52% 41.52%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.52%

    Trigger Attempt Success

    • trigger_pct:14.90%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.53% 20.98%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.2sec 10.2sec 9.88% 49.46%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.88%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.5 0.0 19.3sec 19.3sec 85.39% 83.91%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.73% 1.73%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.73%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no4PT14
devouring_plague Shadow Orb 16.5 49.4 3.0 3.0 119573.8
halo Mana 11.3 425507.9 37554.0 37553.8 3.6
mind_blast Mana 39.8 345857.8 8694.9 8694.9 12.6
mind_flay Mana 130.7 374093.5 2861.5 2861.5 28.4
shadow_word_death Mana 15.4 115922.2 7512.3 7512.5 14.6
shadow_word_pain Mana 59.9 766895.5 12801.0 12800.7 8.2
vampiric_touch Mana 29.9 257714.8 8607.8 8607.8 18.3
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.50 419616.39 (19.37%) 3977.56 42555.86 9.21%
Shadow Orbs from Mind Blast Shadow Orb 39.78 39.78 (83.61%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.80 7.80 (16.39%) 1.00 0.00 0.00%
Devouring Plague Health Health 162.30 0.00 (-nan%) 0.00 2253852.35 100.00%
Vampiric Touch Mana Mana 247.46 1230157.57 (56.78%) 4971.04 77792.99 5.95%
mp5_regen Mana 1808.89 516577.45 (23.85%) 285.58 26089.43 4.81%
Resource RPS-Gain RPS-Loss
Mana 4789.13 5053.61
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 180347.36 4742.86 285204.76
Shadow Orb 1.16 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.9%
shadowfiend-Mana Cap 4.9%
lightwell-Mana Cap 4.9%

Procs

Count Interval
Shadowy Recall Extra Tick 265.8 1.7sec
Shadowy Apparition Procced 86.4 5.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no4PT14 Damage Per Second
Count 49992
Mean 91292.85
Minimum 86075.99
Maximum 98573.26
Spread ( max - min ) 12497.27
Range [ ( max - min ) / 2 * 100% ] 6.84%
Standard Deviation 1786.0518
5th Percentile 88440.34
95th Percentile 94372.87
( 95th Percentile - 5th Percentile ) 5932.54
Mean Distribution
Standard Deviation 7.9881
95.00% Confidence Intervall ( 91277.19 - 91308.50 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1470
0.1 Scale Factor Error with Delta=300 27231
0.05 Scale Factor Error with Delta=300 108926
0.01 Scale Factor Error with Delta=300 2723151
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 91292.85
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36870874.50
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 261.87
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.96 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.99 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.43 shadow_word_death,if=active_enemies<=5
F 44.99 mind_blast,if=active_enemies<=6&cooldown_react
G 19.15 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.03 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.33 halo,if=talent.halo.enabled
M 12.48 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.46 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.65 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.76 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGLWFHTFTHTGFTWWWWWFHMTLFTHTGFTAWWFHTQFMTHTGFLTWWWWFHTQQFMTHTFGTCGAWFHLTFMTHGTQFTWWWWFHTFMLHTGTFTWAWFHTQQFMTHTGFTLWWWWFHTFMTHTGFTGCWAFHTLTQFTGHFMTWWWWFHTFTHGLTFMTWWAFHTQFTHTGQFMTWWLWFHTFTHTFGTGWCWAFHMTLQFTEETHGTFDEEWWWWFTEDEHTFTEEGTFHDLE9EWFATHPEDEQQFTEEGFHMTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no2PT14 : 83798 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
83797.9 83797.9 28.41 / 0.03% 5528 / 6.6% 15.7 5092.3 4526.5 Mana 2.33% 44.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://0.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:308810|140220|138069|119775|94111|85610|76335|49546&chds=0,617619&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308810++devouring_plague,9482C9,0,0,15|t++140220++shadow_word_insanity,9482C9,1,0,15|t++138069++vampiric_touch,9482C9,2,0,15|t++119775++halo,9482C9,3,0,15|t++94111++shadow_word_death,9482C9,4,0,15|t++85610++mind_blast,9482C9,5,0,15|t++76335++shadow_word_pain,9482C9,6,0,15|t++49546++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,11,10,7,7,6,6,5,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_insanity|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_swi_no2PT14 Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57877555555335345442zwtrqooommlklonlkjihhhgfhhihhhgedcZYZZZZaZYababbbbcdeeeeiihhhgffedecbbbaaababYYZZabacdffggfedccbcdddeeffgefeeedeffhijihhhfedcacbbbabbcdbbcccddeeefhggggfeeeeegeeffghhhhihhijkkjjkljlkjihffffeeeeddedfedddeedefhhhhgfdccacaaabbbbcbcbcdceefhikkklkjihgfgfeedddddccbabaaaabdeddedccbbaabbbabbbcbcccccdeeeegighhgggfegfeeeeeefefeeeefffffhgghfedcccfefghijlnmnnoooqssuuutttrqomkijjiiiiihihhhhiiiiiijkkkljijjihihihgghhhhiiiiijkkjklmmmmmmlllmllllllkkkkkkkjjkjjjjjiigeedcbcbaZYYXXXWXXXXXYaabbcccdddddddddddcccccbcbccccbbcccbbbaZaaaabccddegijkkkkllnpprrrs&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5512,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=83798|max=152024&chxp=1,1,55,100&chtt=priest_90_pi_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,16,8,32,40,80,144,160,184,240,336,400,488,560,456,608,728,768,760,896,840,1040,1136,1528,1984,2432,2640,3256,3336,3528,3584,3216,3184,2776,2656,1712,1480,968,744,352,312,168,72,80,8,32,8&chds=0,3584&chbh=5&chxt=x&chxl=0:|min=69399|avg=83798|max=92730&chxp=0,1,62,100&chtt=priest_90_pi_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.2,15.8,10.8,7.4,4.1,3.7,3.2,2.6,0.5,0.5,2.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 199.9s|shadow_word_pain 71.3s|mind_blast 48.9s|vampiric_touch 33.4s|devouring_plague 18.6s|shadow_word_death 16.9s|shadow_word_insanity 14.3s|halo 11.9s|shadowfiend 2.5s|dispersion 2.2s|waiting 10.5s&chtt=priest_90_pi_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no2PT14 83798
devouring_plague 4837 (12698) 5.8% (15.2%) 16.0 29.46sec 358736 308810 112538 232897 136556 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.99 15.99 0.00 0.00 1.1617 0.0000 2183286.34 2183286.34 0.00 308809.62 308809.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.80 80.05% 112538.22 102399 137090 112589.80 104944 119143 1440242 1440242 0.00
crit 3.19 19.95% 232897.48 210941 282405 226407.09 0 282405 743044 743044 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1876 2.2% 37.7 11.19sec 22491 0 18589 38489 22528 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.69 37.63 0.00 0.00 0.0000 0.0000 847651.93 847651.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.18 80.21% 18589.28 17006 22766 18593.92 17459 19951 561015 561015 0.00
crit 7.45 19.79% 38489.48 35032 46897 38469.45 0 46897 286637 286637 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 5985 7.2% 16.0 29.46sec 169162 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.2 18558 38419 22497 19.8% 0.0% 19.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.99 15.99 120.22 120.22 0.0000 0.7390 2704582.88 2704582.88 0.00 30441.59 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.4 80.16% 18557.55 17006 22766 18563.51 17673 19551 1788440 1788440 0.00
crit 23.8 19.84% 38418.89 35032 46897 38423.31 35720 41740 916143 916143 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3173) 0.0% (3.8%) 10.5 42.91sec 135532 119775 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.55 10.55 0.00 0.00 1.1316 0.0000 0.00 0.00 0.00 119775.03 119775.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.44 80.07% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.10 19.93% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3173 3.8% 10.5 42.91sec 135532 0 111952 231385 135533 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.55 10.55 0.00 0.00 0.0000 0.0000 1429275.47 1429275.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.46 80.26% 111952.48 104363 133162 111965.59 105384 120467 947540 947540 0.00
crit 2.08 19.74% 231384.98 214987 274315 208462.79 0 274315 481736 481736 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.5 42.91sec 0 0 0 0 0 22.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.55 229.12 0.00 0.00 0.0000 0.0000 0.00 44588134.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.81 77.17% 0.00 0 0 0.00 0 0 0 27666676 100.00
crit 52.30 22.83% 0.00 0 0 0.00 0 0 0 16921458 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9283 11.1% 38.4 11.67sec 109007 85610 89836 185943 109006 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.44 38.44 0.00 0.00 1.2733 0.0000 4190451.50 4190451.50 0.00 85610.27 85610.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.77 80.05% 89835.54 82079 110390 89854.69 86912 93348 2764597 2764597 0.00
crit 7.67 19.95% 185942.59 169082 227403 185956.16 0 217058 1425855 1425855 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16735 (21973) 20.0% (26.2%) 119.8 3.65sec 82675 49546 0 0 0 0.0% 0.0% 0.0% 0.0% 258.4 24034 49820 29191 20.0% 0.0% 40.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.81 119.81 258.43 258.43 1.6687 0.7043 7543826.80 7543826.80 0.00 49545.59 49545.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 206.7 80.00% 24034.20 21797 29181 24041.50 23525 24698 4968961 4968961 0.00
crit 51.7 20.00% 49820.47 44901 60113 49836.57 47614 52833 2574866 2574866 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5238 6.2% 80.9 5.33sec 29188 0 24042 49861 29200 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.92 80.89 0.00 0.00 0.0000 0.0000 2361872.08 2361872.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.73 80.02% 24041.82 21797 29181 24049.38 23129 25242 1556110 1556110 0.00
crit 16.16 19.98% 49861.39 44901 60113 49872.92 45882 54558 805762 805762 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3520 4.2% 14.5 5.22sec 109328 94111 89709 185958 109327 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 0.00 0.00 1.1617 0.0000 1590564.13 1590564.13 0.00 94110.65 94110.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.58 79.62% 89708.98 79678 107383 89794.64 83128 99142 1039111 1039111 0.00
crit 2.97 20.38% 185958.21 164137 221210 177901.90 0 221210 551453 551453 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4448 5.3% 12.4 34.67sec 162583 140220 134216 277360 162586 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.37 12.37 0.00 0.00 1.1595 0.0000 2010755.56 2010755.56 0.00 140220.05 140220.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.92 80.18% 134216.47 122772 165600 134217.99 123857 144381 1330975 1330975 0.00
crit 2.45 19.82% 277359.66 252910 341137 255942.77 0 341137 679781 679781 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9183 (12062) 11.0% (14.4%) 61.4 7.22sec 88569 76335 0 0 0 0.0% 0.0% 0.0% 0.0% 245.6 13918 28796 16868 19.8% 0.0% 88.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.44 61.44 245.61 245.61 1.1603 1.6255 4142830.70 4142830.70 0.00 11565.60 76335.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 196.9 80.17% 13917.76 12783 17110 13919.47 13447 14370 2740512 2740512 0.00
crit 48.7 19.83% 28796.01 26333 35247 28799.29 27475 30192 1402319 1402319 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2879 3.4% 76.8 5.75sec 16918 0 13957 28897 16928 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.78 76.73 0.00 0.00 0.0000 0.0000 1298866.52 1298866.52 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.47 80.11% 13957.37 12783 17110 13960.59 13451 14619 857949 857949 0.00
crit 15.26 19.89% 28896.95 26333 35247 28902.78 26596 31913 440917 440917 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2198 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2721 3.2% 59.5 7.41sec 20655 0 17422 35049 20927 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.45 58.68 0.00 0.00 0.0000 0.0000 1227979.27 1227979.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.01 80.12% 17422.23 15875 21413 17425.46 16711 18264 819030 819030 0.00
crit 11.67 19.88% 35048.85 31750 42826 35057.48 31750 40445 408949 408949 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7777 (10213) 9.3% (12.2%) 28.9 15.35sec 159318 138069 0 0 0 0.0% 0.0% 0.0% 0.0% 184.2 15691 32489 19035 19.9% 0.0% 86.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.90 28.90 184.22 184.22 1.1539 2.1247 3506678.94 3506678.94 0.00 10841.24 138068.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 147.5 80.09% 15691.34 14287 19397 15694.69 15075 16504 2315187 2315187 0.00
crit 36.7 19.91% 32489.20 29431 39957 32493.65 30813 34632 1191492 1191492 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2436 2.9% 57.7 7.49sec 19051 0 15713 32554 19062 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.65 57.62 0.00 0.00 0.0000 0.0000 1098331.77 1098331.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.16 80.12% 15713.35 14287 19397 15716.57 15010 16580 725377 725377 0.00
crit 11.46 19.88% 32554.09 29431 39957 32556.49 29431 37826 372954 372954 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46610 / 3707
melee 46610 4.4% 31.4 12.75sec 52863 52029 46048 92948 52862 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.36 31.36 0.00 0.00 1.0161 0.0000 1657739.16 1657739.16 0.00 52028.72 52028.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.48 55.74% 46048.24 36329 55931 46061.79 41252 51595 804929 804929 0.00
crit 6.38 20.36% 92947.51 72658 111863 92888.32 0 111863 593355 593355 0.00
glance 7.50 23.90% 34613.82 27247 41949 34618.07 0 41949 259455 259455 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1367 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.54%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.9sec 108.9sec 19.96% 19.96%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.96%

    Trigger Attempt Success

    • trigger_pct:16.26%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.4 36.1sec 20.1sec 44.73% 45.42%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.73%

    Trigger Attempt Success

    • trigger_pct:2.45%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.13% 41.13%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.13%

    Trigger Attempt Success

    • trigger_pct:14.89%
power_infusion 4.3 0.0 121.4sec 121.0sec 18.55% 20.53%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.4sec 10.4sec 9.73% 47.38%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.73%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.65%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no2PT14
devouring_plague Shadow Orb 16.0 48.0 3.0 3.0 119578.5
halo Mana 10.5 396673.2 37615.0 37614.7 3.6
mind_blast Mana 38.4 334738.1 8707.7 8707.6 12.5
mind_flay Mana 119.8 342263.1 2856.6 2856.6 28.9
shadow_word_death Mana 14.5 109312.8 7513.6 7513.6 14.6
shadow_word_insanity Mana 12.4 89801.3 7260.9 7261.0 22.4
shadow_word_pain Mana 61.4 782623.6 12738.1 12738.0 7.0
vampiric_touch Mana 28.9 248076.0 8582.8 8582.6 18.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 2.88 51912.00 (2.54%) 18000.00 0.00 0.00%
shadowfiend Mana 31.36 236611.25 (11.56%) 7545.12 45624.43 16.17%
Shadow Orbs from Mind Blast Shadow Orb 38.44 38.44 (83.39%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.66 7.66 (16.61%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.84 0.00 (-nan%) 0.00 2191931.40 100.00%
Vampiric Touch Mana Mana 241.83 1230817.80 (60.11%) 5089.51 47333.88 3.70%
mp5_regen Mana 1808.89 528213.20 (25.80%) 292.01 14453.68 2.66%
Resource RPS-Gain RPS-Loss
Mana 4526.50 5092.29
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 44073.19 0.00 276360.00
Shadow Orb 1.13 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 252.9 1.8sec
Shadowy Apparition Procced 59.5 7.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no2PT14 Damage Per Second
Count 49992
Mean 83797.85
Minimum 69398.66
Maximum 92730.00
Spread ( max - min ) 23331.33
Range [ ( max - min ) / 2 * 100% ] 13.92%
Standard Deviation 3240.6527
5th Percentile 77154.83
95th Percentile 88211.49
( 95th Percentile - 5th Percentile ) 11056.67
Mean Distribution
Standard Deviation 14.4938
95.00% Confidence Intervall ( 83769.44 - 83826.26 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5745
0.1 Scale Factor Error with Delta=300 89649
0.05 Scale Factor Error with Delta=300 358598
0.01 Scale Factor Error with Delta=300 8964966
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 83797.85
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36136953.88
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 334.37
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.85 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.55 shadow_word_death,if=active_enemies<=5
F 44.12 mind_blast,if=active_enemies<=6&cooldown_react
G 18.62 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 29.00 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.37 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.55 halo,if=talent.halo.enabled
M 12.14 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 49.52 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 36.09 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 52.96 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 42.82 shadow_word_pain,moving=1
X 0.49 dispersion

Sample Sequence

CDGLWFHTQFTHIGFMTWWWWFHTLFTHTIGFTWWWFHMTFTHIGTFLTWWWWFHMTFTHIGTFTCGWWFHLMTFTIGHQFTWWWWFHTQFTHIGLFMTBWWFHTQFTHIGTFMTWWLWFHTFTHIGTFMTGCWWFHTLFTHGQFTWWWWFHMTFTHIGFLTWWWFHTFMTHIGTFTWWWWFHTFLTHITFMGTGBCWQFHTQFTEEHIGFMLPEEWWWWFHEDETFTEEHGFTE9DEWFHTEETFMTHIEEGQQQQQQQFTE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no4PT14 : 85904 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
85904.3 85904.3 28.40 / 0.03% 5501 / 6.4% 16.1 5095.7 4528.0 Mana 2.29% 44.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:308404|140425|138051|119864|94086|85632|83032|49522&chds=0,616809&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308404++devouring_plague,9482C9,0,0,15|t++140425++shadow_word_insanity,9482C9,1,0,15|t++138051++vampiric_touch,9482C9,2,0,15|t++119864++halo,9482C9,3,0,15|t++94086++shadow_word_death,9482C9,4,0,15|t++85632++mind_blast,9482C9,5,0,15|t++83032++shadow_word_pain,9482C9,6,0,15|t++49522++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,11,9,7,6,6,5,5,4,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_insanity|shadowy_apparition|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_swi_no4PT14 Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:578776555553453554420xusqoponnmlloomkkjhhhhghhihhigfecaZZZZZaZZabacbccceeefeijhihggfedeccbcbaababZZZabbaddffghgedccbdddeffffhfffffefgghijjiihgfdcbdccbbbcddcccddeeeeeghhhhgfeeeefgffggghihiiihijkkjjklklkjihgfgfeefeeeeefeeedeeeefhhhigfedcbdbbbcbbcdbcccdcefghikkklkjihhfhgffdedeeccbbcbbbbcdeeeeddccbbbbbbbbbccccccccdfeefhihihhhggfgfffffeeffffeffffffghhghfedcccfefghijlnmnnoopqstuuutttsqonljkjjiiiiiihiiiiijiijjlkklkjjjiiiiihhhhhiiiiiiijkkkklmmmmmmlllmlllllllkkkkkkkkkjjjkjiihfeedccbaaZYYYYXYXXYYZbbbcdddeeeeeeeeeeedddddcccccccccccccbbaaaZaabccddfgikllmmnoprsuvvw&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5577,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=85904|max=154034&chxp=1,1,56,100&chtt=priest_90_pi_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,8,0,8,8,64,80,120,128,208,200,320,384,464,728,552,640,608,720,816,720,920,1152,1160,1688,1976,2504,2632,2848,3360,3632,3768,3192,3168,2680,2296,1864,1528,1040,656,488,264,176,80,88,24,16&chds=0,3768&chbh=5&chxt=x&chxl=0:|min=71038|avg=85904|max=94382&chxp=0,1,64,100&chtt=priest_90_pi_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.2,15.8,10.8,7.4,4.1,3.7,3.2,2.6,0.5,0.5,2.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 200.0s|shadow_word_pain 71.3s|mind_blast 49.0s|vampiric_touch 33.4s|devouring_plague 18.6s|shadow_word_death 16.9s|shadow_word_insanity 14.4s|halo 12.0s|shadowfiend 2.5s|dispersion 2.2s|waiting 10.4s&chtt=priest_90_pi_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no4PT14 85904
devouring_plague 4831 (12688) 5.6% (14.8%) 16.0 29.45sec 358295 308404 112539 233135 136329 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.00 16.00 0.00 0.00 1.1618 0.0000 2181473.54 2181473.54 0.00 308404.45 308404.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.84 80.27% 112538.99 102399 137090 112582.74 104156 120189 1445539 1445539 0.00
crit 3.16 19.73% 233134.75 210941 282405 225483.04 0 282405 735935 735935 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1877 2.2% 37.7 11.20sec 22524 0 18593 38492 22560 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.67 37.61 0.00 0.00 0.0000 0.0000 848586.72 848586.72 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.12 80.06% 18593.45 17006 22766 18598.37 17426 19810 559958 559958 0.00
crit 7.50 19.94% 38491.69 35032 46897 38480.66 0 46897 288628 288628 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 5980 7.0% 16.0 29.45sec 168933 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.2 18566 38405 22487 19.8% 0.0% 19.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.00 16.00 120.21 120.21 0.0000 0.7391 2703178.54 2703178.54 0.00 30425.44 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.5 80.24% 18565.91 17006 22766 18570.27 17449 19675 1790725 1790725 0.00
crit 23.8 19.76% 38405.35 35032 46897 38409.58 35815 41738 912453 912453 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3182) 0.0% (3.7%) 10.6 42.89sec 135662 119864 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 1.1318 0.0000 0.00 0.00 0.00 119864.18 119864.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.47 80.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.09 19.83% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3182 3.7% 10.6 42.89sec 135662 0 112010 231376 135660 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.56 10.56 0.00 0.00 0.0000 0.0000 1432496.80 1432496.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.47 80.18% 112010.05 104363 133162 112031.05 104363 120408 948383 948383 0.00
crit 2.09 19.82% 231376.04 214987 274315 208486.76 0 274315 484113 484113 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.6 42.89sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.56 229.39 0.00 0.00 0.0000 0.0000 0.00 44694102.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.82 77.09% 0.00 0 0 0.00 0 0 0 27681554 100.00
crit 52.56 22.91% 0.00 0 0 0.00 0 0 0 17012548 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9287 10.8% 38.5 11.66sec 108984 85632 89836 186018 108984 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.47 38.47 0.00 0.00 1.2727 0.0000 4192460.92 4192460.92 0.00 85632.08 85632.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.81 80.09% 89835.54 82079 110390 89850.37 86700 93386 2767875 2767875 0.00
crit 7.66 19.91% 186017.67 169082 227403 186012.33 0 227403 1424586 1424586 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16732 (21967) 19.5% (25.6%) 119.9 3.65sec 82625 49522 0 0 0 0.0% 0.0% 0.0% 0.0% 258.5 24035 49825 29183 20.0% 0.0% 40.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.85 119.85 258.49 258.49 1.6685 0.7043 7543656.55 7543656.55 0.00 49522.04 49522.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 206.9 80.04% 24034.63 21797 29181 24042.36 23454 24710 4972460 4972460 0.00
crit 51.6 19.96% 49824.75 44901 60113 49842.57 47430 53115 2571196 2571196 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5234 6.1% 80.8 5.35sec 29198 0 24051 49840 29210 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.80 80.77 0.00 0.00 0.0000 0.0000 2359315.97 2359315.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.61 80.00% 24051.23 21797 29181 24058.20 23155 25317 1554065 1554065 0.00
crit 16.16 20.00% 49839.84 44901 60113 49857.64 45441 55124 805251 805251 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3518 4.1% 14.6 5.21sec 109272 94086 89706 185993 109272 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 0.00 0.00 1.1614 0.0000 1590331.33 1590331.33 0.00 94085.74 94085.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.60 79.68% 89705.73 79678 107383 89802.30 81978 99459 1040270 1040270 0.00
crit 2.96 20.32% 185992.91 164137 221210 178287.11 0 221210 550061 550061 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4476 5.2% 12.4 34.54sec 162770 140425 134197 277650 162769 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.43 12.43 0.00 0.00 1.1592 0.0000 2022677.10 2022677.10 0.00 140424.68 140424.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.95 80.08% 134197.22 122772 165600 134178.88 124670 145189 1335458 1335458 0.00
crit 2.48 19.92% 277650.44 252910 341137 257289.54 0 341137 687219 687219 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9986 (13119) 11.6% (15.3%) 61.4 7.22sec 96335 83032 0 0 0 0.0% 0.0% 0.0% 0.0% 245.6 13915 28765 18343 29.8% 0.0% 88.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.45 61.45 245.63 245.63 1.1602 1.6256 4505659.08 4505659.08 0.00 12578.26 83031.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 172.4 70.18% 13914.95 12783 17110 13916.69 13512 14345 2398832 2398832 0.00
crit 73.2 29.82% 28764.95 26333 35247 28768.19 27460 30376 2106827 2106827 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3133 3.6% 76.8 5.75sec 18404 0 13951 28858 18417 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.82 76.76 0.00 0.00 0.0000 0.0000 1413682.81 1413682.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.77 70.04% 13951.24 12783 17110 13954.63 13357 14559 750117 750117 0.00
crit 22.99 29.96% 28858.28 26333 35247 28862.60 27253 31456 663565 663565 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2201 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3742 4.4% 81.9 5.41sec 20624 0 17412 35012 20903 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.89 80.80 0.00 0.00 0.0000 0.0000 1688991.98 1688991.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.78 80.17% 17412.50 15875 21413 17415.37 16764 18084 1127954 1127954 0.00
crit 16.02 19.83% 35012.04 31750 42826 35017.18 32333 37889 561038 561038 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7776 (10215) 9.1% (11.9%) 28.9 15.35sec 159282 138051 0 0 0 0.0% 0.0% 0.0% 0.0% 184.3 15695 32496 19031 19.9% 0.0% 86.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.92 28.92 184.28 184.28 1.1538 2.1250 3507107.50 3507107.50 0.00 10841.48 138051.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 28.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 147.7 80.14% 15695.34 14287 19397 15698.63 15185 16290 2317998 2317998 0.00
crit 36.6 19.86% 32495.80 29431 39957 32501.45 30779 34669 1189109 1189109 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2439 2.8% 57.8 7.49sec 19044 0 15712 32580 19056 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.76 57.73 0.00 0.00 0.0000 0.0000 1100076.18 1100076.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.28 80.17% 15711.73 14287 19397 15715.76 15036 16574 727203 727203 0.00
crit 11.45 19.83% 32579.71 29431 39957 32589.03 29431 36760 372873 372873 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46643 / 3711
melee 46643 4.3% 31.4 12.75sec 52919 52059 46056 93031 52919 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.35 31.35 0.00 0.00 1.0165 0.0000 1659075.63 1659075.63 0.00 52059.23 52059.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.45 55.64% 46056.28 36329 55931 46069.62 41497 51511 803462 803462 0.00
crit 6.40 20.42% 93031.36 72658 111863 92927.25 0 111863 595524 595524 0.00
glance 7.50 23.94% 34656.77 27247 41949 34652.63 0 41949 260090 260090 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1368 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.55%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.8sec 108.8sec 19.97% 19.97%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.97%

    Trigger Attempt Success

    • trigger_pct:16.46%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.6 9.4 36.2sec 20.2sec 44.66% 45.35%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.66%

    Trigger Attempt Success

    • trigger_pct:2.44%
light_of_the_cosmos 9.5 0.0 49.3sec 49.3sec 41.12% 41.12%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.12%

    Trigger Attempt Success

    • trigger_pct:14.88%
power_infusion 4.3 0.0 121.4sec 121.0sec 18.55% 20.56%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.4sec 10.4sec 9.73% 47.35%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.73%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.65%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no4PT14
devouring_plague Shadow Orb 16.0 48.0 3.0 3.0 119431.7
halo Mana 10.6 397292.7 37624.7 37624.9 3.6
mind_blast Mana 38.5 334902.8 8705.9 8705.8 12.5
mind_flay Mana 119.9 342354.4 2856.4 2856.4 28.9
shadow_word_death Mana 14.6 109328.3 7511.7 7512.0 14.5
shadow_word_insanity Mana 12.4 90209.5 7259.2 7259.4 22.4
shadow_word_pain Mana 61.4 782690.3 12738.0 12738.0 7.6
vampiric_touch Mana 28.9 248250.5 8582.6 8582.7 18.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 2.87 51678.72 (2.52%) 18000.00 0.00 0.00%
shadowfiend Mana 31.35 236629.20 (11.55%) 7547.69 45531.60 16.14%
Shadow Orbs from Mind Blast Shadow Orb 38.47 38.47 (83.39%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.66 7.66 (16.61%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.83 0.00 (-nan%) 0.00 2191664.78 100.00%
Vampiric Touch Mana Mana 242.01 1231696.65 (60.13%) 5089.48 47167.35 3.69%
mp5_regen Mana 1808.89 528239.21 (25.79%) 292.02 14427.67 2.66%
Resource RPS-Gain RPS-Loss
Mana 4528.03 5095.70
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 43210.76 0.00 276900.00
Shadow Orb 1.13 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 252.9 1.8sec
Shadowy Apparition Procced 81.9 5.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no4PT14 Damage Per Second
Count 49992
Mean 85904.26
Minimum 71038.26
Maximum 94381.78
Spread ( max - min ) 23343.52
Range [ ( max - min ) / 2 * 100% ] 13.59%
Standard Deviation 3240.2665
5th Percentile 79306.53
95th Percentile 90307.97
( 95th Percentile - 5th Percentile ) 11001.44
Mean Distribution
Standard Deviation 14.4921
95.00% Confidence Intervall ( 85875.86 - 85932.66 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5465
0.1 Scale Factor Error with Delta=300 89628
0.05 Scale Factor Error with Delta=300 358513
0.01 Scale Factor Error with Delta=300 8962829
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 85904.26
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37089695.04
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 333.19
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.86 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.55 shadow_word_death,if=active_enemies<=5
F 44.15 mind_blast,if=active_enemies<=6&cooldown_react
G 18.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 29.02 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.43 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.56 halo,if=talent.halo.enabled
M 12.14 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 48.98 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 35.24 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 52.99 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 42.82 shadow_word_pain,moving=1
X 0.49 dispersion

Sample Sequence

CDGLWFHTFTHIGFMTWWWWFHTLFTHTIGFTWWWFHMTFTHTIGFLTWWWWFHMTFTHIGTFTCGWWFHLMTFTHIGFTWWWWFHTQFTHIGLFMTBWWFHTFTHIGTFMTWWWLHFTQFTHIGTFMTGCWWFHTLFTHGTFMTWWWWFHTFTHIGLFMTWWWFHTQFTHIGTFMTWWWLFHTFTHIGTQFMTGBCWFHTQFLTEETHFGMTEEWWWWFHEDETFTEEGHFLMT9EEWFHTEDEFTHIEEFGMTWW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no2PT14 : 85522 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
85521.7 85521.7 28.80 / 0.03% 5600 / 6.5% 16.7 4903.0 4338.0 Mana 1.65% 43.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311406|126963|117287|104452|88249|87298|79213|46403&chds=0,622812&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311406++devouring_plague,9482C9,0,0,15|t++126963++vampiric_touch,9482C9,1,0,15|t++117287++halo,9482C9,2,0,15|t++104452++shadow_word_death,9482C9,3,0,15|t++88249++mind_blast,9482C9,4,0,15|t++87298++shadow_word_pain,9482C9,5,0,15|t++79213++mind_spike,4A79D3,6,0,15|t++46403++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,12,11,9,9,8,7,5,5,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:687765544320131231220xvuttssrrrssuttsqpomlllllmmmmkjiigeeeeffgghhggggfefggghjjkkjihhgfgfffggghhgffeedeeefghiijigfeecdeeefghhhggffedegghijiiihggfedeedeefgghgggghhhhhijkjkkjighhhijjjklmoonnnnmmmopnnnnnnmmljihhhhhijjjkkjjjjihhhijkkkkjhfedccbbbcdeeededddcdfghijkkkkjihgfgffffgggggfffeeeffghiiiihgggfeeeeffggghgggggghiiijkklllllkkjkkkkllmmnnnnnnnnnnoopppqomljjjkkllmoqrsssttsstvwxxxxxwwutrpoonnmnnoopopoooooppqqrsstsrrrrqrqqqqrrrsrsrrrqsttttuvwwxxxxxxyyyyzz00100000zzzzzzzzzywtsrqoomlkjjihhggffedfghhhiijjjjjjkkkjjjjjjjjiiiiihhhhhhggggfeeefghiijklnqsutvwxy0245667&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6262,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=85522|max=136571&chxp=1,1,63,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,8,24,24,24,56,32,64,144,160,176,216,240,424,464,512,440,560,472,752,792,792,1040,1208,1456,1728,2120,2376,2880,3336,3464,3352,3632,3272,2880,2888,2144,1760,1344,920,640,416,344,176,112,48,8,48,8&chds=0,3632&chbh=5&chxt=x&chxl=0:|min=70821|avg=85522|max=94713&chxp=0,1,62,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:40.2,13.8,11.5,8.8,7.7,4.5,3.9,2.8,0.5,0.2,1.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 181.7s|shadow_word_pain 62.6s|mind_blast 51.8s|mind_spike 39.7s|vampiric_touch 34.8s|devouring_plague 20.2s|shadow_word_death 17.8s|halo 12.8s|shadowfiend 2.5s|dispersion 0.7s|waiting 7.5s&chtt=priest_90_tof_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no2PT14 85522
devouring_plague 5322 (13948) 6.2% (16.3%) 17.0 27.67sec 371747 311406 117054 242273 141730 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 0.00 0.00 1.1938 0.0000 2404090.11 2404090.11 0.00 311405.89 311405.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.62 80.29% 117054.07 102399 157653 117093.32 109056 126583 1594195 1594195 0.00
crit 3.34 19.71% 242272.82 210941 324765 235393.05 0 324765 809896 809896 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2062 2.4% 39.7 10.66sec 23505 0 19403 40232 23540 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.67 39.61 0.00 0.00 0.0000 0.0000 932429.85 932429.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.74 80.14% 19403.00 17006 26181 19406.64 17883 21391 615908 615908 0.00
crit 7.87 19.86% 40232.03 35032 53932 40227.07 0 49788 316522 316522 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6564 7.7% 17.0 27.67sec 175044 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.8 19315 40025 23423 19.8% 0.0% 21.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.96 16.96 126.76 126.76 0.0000 0.7575 2969137.82 2969137.82 0.00 30921.43 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.6 80.16% 19315.30 17006 26181 19318.01 18329 20398 1962736 1962736 0.00
crit 25.1 19.84% 40024.84 35032 53932 40026.14 36635 45209 1006402 1006402 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3340) 0.0% (3.9%) 10.9 41.80sec 138265 117287 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1789 0.0000 0.00 0.00 0.00 117286.59 117286.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.79% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3340 3.9% 10.9 41.80sec 138265 0 114000 236019 138265 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 0.0000 0.0000 1503262.20 1503262.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.71 80.11% 114000.19 104363 153137 113988.32 105092 126569 992963 992963 0.00
crit 2.16 19.89% 236018.77 214987 315462 213938.37 0 315462 510299 510299 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 41.80sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 235.42 0.00 0.00 0.0000 0.0000 0.00 46629981.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.55 77.12% 0.00 0 0 0.00 0 0 0 28896224 100.00
crit 53.87 22.88% 0.00 0 0 0.00 0 0 0 17733758 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10133 11.8% 41.1 10.85sec 111240 88249 91854 190088 111239 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.10 41.10 0.00 0.00 1.2605 0.0000 4572190.30 4572190.30 0.00 88249.19 88249.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.99 80.27% 91854.17 82079 126948 91884.18 87242 96550 3030315 3030315 0.00
crit 8.11 19.73% 190087.76 169082 261513 190157.27 169082 232674 1541875 1541875 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14236 (18692) 16.6% (21.8%) 109.6 3.98sec 76920 46403 0 0 0 0.0% 0.0% 0.0% 0.0% 218.5 24218 50215 29385 19.9% 0.0% 35.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.59 109.59 218.49 218.49 1.6577 0.7388 6420406.03 6420406.03 0.00 46402.88 46402.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.59 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.1 80.12% 24218.25 21797 33558 24225.52 23487 25021 4239798 4239798 0.00
crit 43.4 19.88% 50214.72 44901 69130 50229.02 47361 53533 2180608 2180608 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4456 5.2% 68.3 6.28sec 29407 0 24233 50248 29419 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.34 68.31 0.00 0.00 0.0000 0.0000 2009604.74 2009604.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.69 80.07% 24233.32 21797 33558 24240.80 22852 25611 1325378 1325378 0.00
crit 13.62 19.93% 50247.51 44901 69130 50266.20 44901 57799 684227 684227 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6966 8.2% 33.6 12.63sec 93496 79213 77081 159861 93496 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.64 33.64 0.00 0.00 1.1803 0.0000 3144894.95 3144894.95 0.00 79212.51 79212.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.97 80.17% 77080.67 68964 106992 77083.90 71994 85100 2078588 2078588 0.00
crit 6.67 19.83% 159861.14 142066 220403 159727.50 0 220403 1066307 1066307 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4107 4.8% 14.9 5.11sec 124846 104452 102764 213106 124844 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 14.88 0.00 0.00 1.1953 0.0000 1857363.93 1857363.93 0.00 104451.91 104451.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.90 79.99% 102763.67 79678 123491 102861.69 91921 113512 1222891 1222891 0.00
crit 2.98 20.01% 213106.05 164137 254391 204385.87 0 254391 634473 634473 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9211 (12101) 10.8% (14.2%) 52.9 8.41sec 103235 87298 0 0 0 0.0% 0.0% 0.0% 0.0% 242.0 14178 29347 17184 19.8% 0.0% 95.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.91 52.91 241.97 241.97 1.1826 1.7764 4158057.11 4158057.11 0.00 11093.32 87298.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 194.0 80.18% 14177.77 12783 19677 14179.56 13657 14694 2750667 2750667 0.00
crit 48.0 19.82% 29346.61 26333 40534 29349.29 27494 31347 1407390 1407390 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2890 3.4% 75.6 5.84sec 17251 0 14237 29496 17263 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.61 75.56 0.00 0.00 0.0000 0.0000 1304370.98 1304370.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.58 80.17% 14236.59 12783 19677 14238.86 13586 14957 862400 862400 0.00
crit 14.98 19.83% 29496.09 26333 40534 29499.91 26807 32856 441971 441971 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2185 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2746 3.2% 59.0 7.47sec 21025 0 17754 35715 21325 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.97 58.14 0.00 0.00 0.0000 0.0000 1239908.05 1239908.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.58 80.12% 17753.68 15875 24625 17755.30 16669 18836 826990 826990 0.00
crit 11.56 19.88% 35714.87 31750 49250 35718.44 32078 41835 412918 412918 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7453 (9792) 8.7% (11.4%) 29.4 15.11sec 150358 126963 0 0 0 0.0% 0.0% 0.0% 0.0% 173.9 15956 33049 19334 19.8% 0.0% 86.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.37 29.37 173.87 173.87 1.1843 2.2367 3361580.06 3361580.06 0.00 10424.05 126963.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.5 80.24% 15956.25 14287 22306 15958.27 15196 16545 2226062 2226062 0.00
crit 34.4 19.76% 33049.16 29431 45950 33053.21 31007 36085 1135518 1135518 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2339 2.7% 54.3 7.94sec 19422 0 16028 33173 19433 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.31 54.28 0.00 0.00 0.0000 0.0000 1054839.64 1054839.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.50 80.14% 16027.75 14287 22306 16029.12 15088 17100 697184 697184 0.00
crit 10.78 19.86% 33173.13 29431 45950 33172.68 29431 39286 357656 357656 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46482 / 3697
melee 46482 4.3% 31.4 12.75sec 52687 51800 45902 92682 52686 20.4% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.38 31.38 0.00 0.00 1.0172 0.0000 1653285.60 1653285.60 0.00 51799.53 51799.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 55.46% 45902.38 36329 55931 45914.04 40176 52518 798813 798813 0.00
crit 6.39 20.38% 92681.60 72658 111863 92599.38 0 111863 592675 592675 0.00
glance 7.58 24.16% 34527.05 27247 41949 34518.32 0 41949 261798 261798 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1971 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.47%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.8sec 108.8sec 19.94% 19.94%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.94%

    Trigger Attempt Success

    • trigger_pct:16.53%
glyph_mind_spike 24.0 9.6 17.9sec 12.6sec 33.91% 47.35%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:26.95%
  • glyph_mind_spike_2:6.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.4sec 20.7sec 43.64% 43.99%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.64%

    Trigger Attempt Success

    • trigger_pct:2.42%
light_of_the_cosmos 9.5 0.0 49.4sec 49.4sec 41.04% 41.04%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.04%

    Trigger Attempt Success

    • trigger_pct:15.05%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 10.0sec 10.0sec 10.06% 46.73%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.06%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 29.6 4.6 14.4sec 12.5sec 17.77% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:16.46%
  • surge_of_darkness_2:1.31%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 101.2 0.0sec 0.7sec 16.49% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.55%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no2PT14
devouring_plague Shadow Orb 17.0 50.9 3.0 3.0 123914.4
halo Mana 10.9 440329.0 40500.0 40500.1 3.4
mind_blast Mana 41.1 369920.2 9000.0 9000.1 12.4
mind_flay Mana 109.6 328782.7 3000.0 3000.0 25.6
shadow_word_death Mana 14.9 116046.5 7800.0 7800.3 16.0
shadow_word_pain Mana 52.9 698434.2 13200.0 13199.7 7.8
vampiric_touch Mana 29.4 264355.2 9000.0 9000.0 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.90 16231.68 (0.83%) 18000.00 0.00 0.00%
shadowfiend Mana 31.38 251762.83 (12.83%) 8023.12 30654.29 10.85%
Shadow Orbs from Mind Blast Shadow Orb 41.10 41.10 (83.77%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.96 7.96 (16.23%) 1.00 0.00 0.00%
Devouring Plague Health Health 166.37 0.00 (-nan%) 0.00 2310376.41 100.00%
Vampiric Touch Mana Mana 228.15 1165023.60 (59.37%) 5106.38 41038.32 3.40%
mp5_regen Mana 1808.89 529251.31 (26.97%) 292.58 13415.57 2.47%
Resource RPS-Gain RPS-Loss
Mana 4337.97 4903.01
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 44393.86 0.00 235500.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.5%
shadowfiend-Mana Cap 2.5%
lightwell-Mana Cap 2.5%

Procs

Count Interval
Shadowy Recall Extra Tick 237.8 1.9sec
Shadowy Apparition Procced 59.0 7.5sec
FDCL Mind Spike proc 34.2 12.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 85521.69
Minimum 70821.23
Maximum 94713.25
Spread ( max - min ) 23892.03
Range [ ( max - min ) / 2 * 100% ] 13.97%
Standard Deviation 3285.8611
5th Percentile 78837.35
95th Percentile 90036.97
( 95th Percentile - 5th Percentile ) 11199.62
Mean Distribution
Standard Deviation 14.6960
95.00% Confidence Intervall ( 85492.89 - 85550.50 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5670
0.1 Scale Factor Error with Delta=300 92168
0.05 Scale Factor Error with Delta=300 368673
0.01 Scale Factor Error with Delta=300 9216840
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 85521.69
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36932135.78
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 327.67
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.99 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.88 shadow_word_death,if=active_enemies<=5
F 45.28 mind_blast,if=active_enemies<=6&cooldown_react
G 19.25 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 29.45 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.09 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 12.98 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 45.02 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 14.74 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 30.55 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.74 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 33.66 shadow_word_pain,moving=1
X 0.15 dispersion

Sample Sequence

DGLWFHTFTHTFGTRTRWFMWHTFTLTTRHQFTGTFWWWHTFMRTTFHTGLRTFRWWWRHQFMTQFTHRTGTFTGWLFHMTFTHGRTFTWWRWFHJMRTFLTHTGFTBWWFHMTQFTHTGQFTLTWWWWFHMJRTFTRHTGFTGWWFHLMTRTFTHTFGTRRWWFHMRTFTTHGLFRTRFMHTGFRTTHTFTGWLWWWFHJMRRRTQFRRTHTQFGTGBWFHMTLRFTEEHTFDEEGWWWFHEDERTQFRTEEHGFLRTED9EWFHTEETFMTRHEEGQFTWE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no4PT14 : 87688 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
87687.7 87687.7 29.57 / 0.03% 5631 / 6.4% 17.1 4903.8 4341.6 Mana 1.65% 43.5 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://2.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311804|127102|117571|104568|94872|88384|79141|46460&chds=0,623608&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311804++devouring_plague,9482C9,0,0,15|t++127102++vampiric_touch,9482C9,1,0,15|t++117571++halo,9482C9,2,0,15|t++104568++shadow_word_death,9482C9,3,0,15|t++94872++shadow_word_pain,9482C9,4,0,15|t++88384++mind_blast,9482C9,5,0,15|t++79141++mind_spike,4A79D3,6,0,15|t++46460++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,12,12,9,8,8,6,5,5,5,4,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|mind_spike|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowy_apparition|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://5.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:687765544420242242320ywvuttssrsstuutsrqonmmmmmmmmmlkjihfffffghhhhhhhggfggghijkkkjjiihgggggghhhhhgffeeeffghiijjigfeedefffghhhihhggfefghiikjiiihgffdeeeefghhhhhhhhhiiijjkkkljihiiijjjklmnoooooonmnopoooonnnmlkihiihiijkklkkkkjiiiijjkkkljhgfecccccdefffeeeeddefhhikkllkkihhghgggghhhhgggffffffghiiijihgggfffffgghhhhhhhhghiiijkllmmllllklkllmmnnoooooonnooopqqqqomljkklllmnoqrtstttssuvwyxyxxxwvtrqoponnooopppppppopppqrsstutrsssrsrrrrssssssssrrsttttvvwxxxxxxxyyyyz0011111100000zz0zzzwutsrponmkkjjihgggffdfhhhhiijjjkjkkkkjjjjjjjjjiiiiihhhhhhhggfeeefghiijklnprttuuvwz124445&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6354,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=87688|max=138008&chxp=1,1,64,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,8,0,0,16,16,0,8,16,56,72,72,144,184,256,280,360,448,456,704,560,808,720,840,1104,1280,1352,2096,2064,3128,3280,3712,3896,3960,4368,3336,2944,2400,1656,1288,808,496,360,232,104,64,32&chds=0,4368&chbh=5&chxt=x&chxl=0:|min=68759|avg=87688|max=96349&chxp=0,1,69,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:40.1,13.8,11.4,8.8,7.7,4.5,3.9,2.8,0.5,0.2,1.7&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 181.6s|shadow_word_pain 62.6s|mind_blast 51.8s|mind_spike 39.7s|vampiric_touch 34.8s|devouring_plague 20.2s|shadow_word_death 17.8s|halo 12.8s|shadowfiend 2.5s|dispersion 0.8s|waiting 7.5s&chtt=priest_90_tof_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no4PT14 87688
devouring_plague 5334 (13955) 6.1% (15.9%) 17.0 27.68sec 372189 311804 117051 242581 142146 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 16.95 0.00 0.00 1.1937 0.0000 2409665.84 2409665.84 0.00 311803.93 311803.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.56 80.01% 117050.86 102399 157653 117086.06 107559 125650 1587553 1587553 0.00
crit 3.39 19.99% 242581.08 210941 324765 236663.78 0 324765 822113 822113 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2063 2.4% 39.7 10.66sec 23520 0 19402 40170 23555 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.67 39.61 0.00 0.00 0.0000 0.0000 933072.29 933072.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.69 80.00% 19402.14 17006 26181 19404.85 17998 21639 614872 614872 0.00
crit 7.92 20.00% 40169.85 35032 53932 40152.23 0 51512 318200 318200 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6558 7.5% 17.0 27.68sec 175001 0 0 0 0 0.0% 0.0% 0.0% 0.0% 126.7 19318 40022 23418 19.8% 0.0% 21.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.95 16.95 126.68 126.68 0.0000 0.7574 2966614.35 2966614.35 0.00 30919.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.6 80.20% 19318.25 17006 26181 19320.85 18238 20485 1962587 1962587 0.00
crit 25.1 19.80% 40021.53 35032 53932 40026.23 36473 45844 1004027 1004027 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3349) 0.0% (3.8%) 10.9 41.83sec 138579 117571 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.88 10.88 0.00 0.00 1.1788 0.0000 0.00 0.00 0.00 117570.85 117570.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.74 80.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3349 3.8% 10.9 41.83sec 138579 0 114027 235986 138579 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.88 10.88 0.00 0.00 0.0000 0.0000 1507846.16 1507846.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.69 79.87% 114027.30 104363 153137 114020.66 104363 124182 990933 990933 0.00
crit 2.19 20.13% 235985.64 214987 315462 215081.19 0 315462 516913 516913 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 41.83sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.88 235.41 0.00 0.00 0.0000 0.0000 0.00 46633932.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.52 77.11% 0.00 0 0 0.00 0 0 0 28895290 100.00
crit 53.89 22.89% 0.00 0 0 0.00 0 0 0 17738643 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10144 11.6% 41.1 10.86sec 111403 88384 91841 190285 111405 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.08 41.08 0.00 0.00 1.2605 0.0000 4576323.96 4576323.96 0.00 88383.56 88383.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.92 80.13% 91840.96 82079 126948 91870.41 87122 96845 3023013 3023013 0.00
crit 8.16 19.87% 190285.12 169082 261513 190399.92 0 235175 1553311 1553311 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14246 (18707) 16.2% (21.3%) 109.5 3.98sec 77028 46460 0 0 0 0.0% 0.0% 0.0% 0.0% 218.5 24220 50208 29410 20.0% 0.0% 35.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 109.54 109.54 218.47 218.47 1.6580 0.7389 6425320.19 6425320.19 0.00 46459.59 46459.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.8 80.03% 24220.29 21797 33558 24228.12 23539 25087 4234749 4234749 0.00
crit 43.6 19.97% 50207.75 44901 69130 50223.62 47405 54096 2190571 2190571 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4461 5.1% 68.4 6.27sec 29403 0 24243 50220 29415 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.44 68.41 0.00 0.00 0.0000 0.0000 2012298.24 2012298.24 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.79 80.09% 24242.77 21797 33558 24250.08 22784 25730 1328262 1328262 0.00
crit 13.62 19.91% 50219.80 44901 69130 50232.99 44901 56863 684036 684036 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 6968 7.9% 33.7 12.62sec 93393 79141 77052 159636 93394 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.65 33.65 0.00 0.00 1.1801 0.0000 3142836.68 3142836.68 0.00 79140.73 79140.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.99 80.21% 77052.14 68964 106992 77062.97 71738 84313 2079871 2079871 0.00
crit 6.66 19.79% 159635.93 142066 220403 159283.91 0 200781 1062966 1062966 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4109 4.7% 14.9 5.11sec 124956 104568 102798 213244 124956 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.88 14.88 0.00 0.00 1.1950 0.0000 1858805.24 1858805.24 0.00 104568.25 104568.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.89 79.94% 102798.41 79678 123491 102908.00 91722 111726 1222412 1222412 0.00
crit 2.98 20.06% 213243.55 164137 254391 204765.68 0 254391 636393 636393 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10018 (13159) 11.4% (15.0%) 52.9 8.40sec 112194 94872 0 0 0 0.0% 0.0% 0.0% 0.0% 242.0 14176 29309 18688 29.8% 0.0% 95.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.94 52.94 241.99 241.99 1.1826 1.7761 4522275.43 4522275.43 0.00 12062.46 94871.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 169.8 70.18% 14175.61 12783 19677 14177.28 13627 14776 2407529 2407529 0.00
crit 72.2 29.82% 29308.65 26333 40534 29312.45 27904 30938 2114747 2114747 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3141 3.6% 75.6 5.85sec 18756 0 14236 29446 18769 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.57 75.52 0.00 0.00 0.0000 0.0000 1417450.10 1417450.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.01 70.20% 14236.44 12783 19677 14239.13 13423 15081 754700 754700 0.00
crit 22.51 29.80% 29446.37 26333 40534 29453.61 27435 32664 662750 662750 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.92sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2186 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3799 4.3% 81.7 5.43sec 20995 0 17747 35691 21295 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.73 80.58 0.00 0.00 0.0000 0.0000 1715858.11 1715858.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.65 80.23% 17747.24 15875 24625 17749.52 17034 18675 1147337 1147337 0.00
crit 15.93 19.77% 35691.33 31750 49250 35696.19 32241 41892 568521 568521 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7458 (9803) 8.5% (11.2%) 29.4 15.11sec 150520 127102 0 0 0 0.0% 0.0% 0.0% 0.0% 173.9 15958 33041 19349 19.9% 0.0% 86.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.37 29.37 173.85 173.85 1.1842 2.2366 3363860.08 3363860.08 0.00 10437.21 127102.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.3 80.15% 15957.67 14287 22306 15960.47 15295 16545 2223525 2223525 0.00
crit 34.5 19.85% 33041.31 29431 45950 33043.97 30967 35611 1140335 1140335 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2345 2.7% 54.5 7.92sec 19416 0 16020 33200 19430 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.47 54.43 0.00 0.00 0.0000 0.0000 1057521.41 1057521.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.63 80.15% 16019.75 14287 22306 16022.47 15143 17015 698864 698864 0.00
crit 10.80 19.85% 33199.98 29431 45950 33201.62 29431 39957 358657 358657 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46437 / 3694
melee 46437 4.2% 31.4 12.75sec 52646 51751 45904 92678 52646 20.3% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.37 31.37 0.00 0.00 1.0173 0.0000 1651636.34 1651636.34 0.00 51751.10 51751.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.44 55.59% 45903.68 36329 55931 45920.14 41549 52047 800560 800560 0.00
crit 6.36 20.29% 92677.97 72658 111863 92587.72 0 111863 589834 589834 0.00
glance 7.57 24.12% 34519.36 27247 41949 34509.74 0 41949 261242 261242 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1971 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.47%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.8sec 108.8sec 19.95% 19.95%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.95%

    Trigger Attempt Success

    • trigger_pct:16.40%
glyph_mind_spike 24.0 9.6 17.9sec 12.6sec 33.96% 47.48%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:27.01%
  • glyph_mind_spike_2:6.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.4sec 20.6sec 43.74% 44.09%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.74%

    Trigger Attempt Success

    • trigger_pct:2.44%
light_of_the_cosmos 9.5 0.0 49.4sec 49.4sec 41.04% 41.04%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.04%

    Trigger Attempt Success

    • trigger_pct:14.97%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.0 0.0 10.0sec 10.0sec 10.05% 46.71%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.05%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
surge_of_darkness 29.6 4.6 14.4sec 12.4sec 17.81% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:16.49%
  • surge_of_darkness_2:1.32%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 104.7 0.0sec 0.7sec 16.49% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.18% 14.18%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.18%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.56%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no4PT14
devouring_plague Shadow Orb 17.0 50.9 3.0 3.0 124063.1
halo Mana 10.9 440672.4 40500.0 40500.1 3.4
mind_blast Mana 41.1 369707.0 9000.0 8999.9 12.4
mind_flay Mana 109.5 328619.5 3000.0 3000.0 25.7
shadow_word_death Mana 14.9 116034.0 7800.0 7800.3 16.0
shadow_word_pain Mana 52.9 698827.0 13200.0 13200.0 8.5
vampiric_touch Mana 29.4 264366.7 9000.0 9000.0 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.97 17539.20 (0.89%) 18000.00 0.00 0.00%
shadowfiend Mana 31.37 251797.87 (12.82%) 8026.07 30554.45 10.82%
Shadow Orbs from Mind Blast Shadow Orb 41.08 41.08 (83.76%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.96 7.96 (16.24%) 1.00 0.00 0.00%
Devouring Plague Health Health 166.29 0.00 (-nan%) 0.00 2309223.26 100.00%
Vampiric Touch Mana Mana 228.28 1165348.08 (59.34%) 5104.90 41050.32 3.40%
mp5_regen Mana 1808.89 529232.93 (26.95%) 292.57 13433.95 2.48%
Resource RPS-Gain RPS-Loss
Mana 4341.61 4903.81
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 45692.41 0.00 226500.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.5%
shadowfiend-Mana Cap 2.5%
lightwell-Mana Cap 2.5%

Procs

Count Interval
Shadowy Recall Extra Tick 238.0 1.9sec
Shadowy Apparition Procced 81.7 5.4sec
FDCL Mind Spike proc 34.3 12.4sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 87687.65
Minimum 68758.91
Maximum 96348.87
Spread ( max - min ) 27589.96
Range [ ( max - min ) / 2 * 100% ] 15.73%
Standard Deviation 3373.7312
5th Percentile 80977.33
95th Percentile 92240.01
( 95th Percentile - 5th Percentile ) 11262.68
Mean Distribution
Standard Deviation 15.0890
95.00% Confidence Intervall ( 87658.08 - 87717.23 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5686
0.1 Scale Factor Error with Delta=300 97163
0.05 Scale Factor Error with Delta=300 388655
0.01 Scale Factor Error with Delta=300 9716382
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 87687.65
Distribution Chart

Damage

Sample Data
Count 49992
Mean 37909748.08
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 327.89
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.98 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.88 shadow_word_death,if=active_enemies<=5
F 45.25 mind_blast,if=active_enemies<=6&cooldown_react
G 19.26 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 29.45 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.08 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.88 halo,if=talent.halo.enabled
M 12.98 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 44.81 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.16 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 30.57 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.72 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 33.68 shadow_word_pain,moving=1
X 0.16 dispersion

Sample Sequence

DGLWFHTQQFTHTFGMRTWWWWWFHTLFTHTGQFMTRTWRFHTFRRTHRGQFMLRRTRFWWHRTQFTTHFMGTRTFGWWHLTFTTFHMTGRTFRWWWWHQFTRFLHMTGTFRTBRFHTGTFRRTHRTFMTLGRWWWFHTFTHTFGJRRTGFMHTLRFTTHGFJRRTRTFMWWHRTFTTHFLRGTQFMWWWHQFTRTFHTGRQFMTRLWWFHTFTRHTGFMTGBWFHTLTQQFREDEHRGFTPEERWWWFDEEHRTFTEETFGDEEHL9WWFEDEHTFTEETGFDEERW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no2PT14 : 88244 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
88244.2 88244.2 15.86 / 0.02% 2948 / 3.3% 15.0 5242.5 4773.0 Mana 0.53% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://6.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:310947|126664|117803|104771|87636|80511|46999&chds=0,621895&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++310947++devouring_plague,9482C9,0,0,15|t++126664++vampiric_touch,9482C9,1,0,15|t++117803++halo,9482C9,2,0,15|t++104771++shadow_word_death,9482C9,3,0,15|t++87636++mind_blast,9482C9,4,0,15|t++80511++shadow_word_pain,9482C9,5,0,15|t++46999++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,13,12,12,10,8,7,7,5,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no2PT14 Damage Sources&chts=dddddd,18
http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:y0245332220y02002011zxuspmnnmmmnoqponmlkihihijjiiigfdcaabccdfhijllmnoonopqqprrppomkigeedbbbbcccbcbbbbcddefghhhgeecdcfffghijkllllllkkmnoopnmmlkigfdedcbcdddeddcdccccceegffgfeeddcdedeffgijijklkkklllmnonnnmmkjhhhfeffgghggggfeeddefhhhhgedcaabbbbdfghihjjkkklmnopqrqqpnmkighfedddeeedddccbbcbddfffffeddcbccdefghijiklmnnoooopqrsrqponmlllkjiijkkklllkkkkkllmnnnljihgffefffhijkkmnnooqstutvxxxvvtsqponnllkkkkkllllllmnnopqqrqopppooonnopqrssuuvwwy00001234332110100zzyyyyyzzzzzzzzyyzyyyvtsrqoonmllmnopprstuux02335678776543310zyxwwvuuvuuututttuttusrrrrqqqoooopqqqpoooopqppoqq&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6206,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=88244|max=142199&chxp=1,1,62,100&chtt=priest_90_tof_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,0,0,0,16,24,16,56,72,96,208,352,360,416,608,1088,1296,1528,2032,2080,3024,3152,3336,3488,3416,3712,3216,2952,2384,2272,1920,1496,1424,1048,704,688,464,296,200,160,160,64,56,48,16,16,8,8&chds=0,3712&chbh=5&chxt=x&chxl=0:|min=80061|avg=88244|max=95434&chxp=0,1,53,100&chtt=priest_90_tof_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.5,15.6,11.4,7.8,4.4,4.1,2.9,1.8,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 210.3s|shadow_word_pain 70.7s|mind_blast 51.4s|vampiric_touch 35.5s|devouring_plague 19.9s|shadow_word_death 18.3s|halo 13.3s|mindbender 8.3s|dispersion 0.1s|waiting 2.4s&chtt=priest_90_tof_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no2PT14 88244
devouring_plague 5237 (13632) 5.9% (15.5%) 16.6 28.19sec 371532 310947 117397 243369 142616 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.62 16.62 0.00 0.00 1.1949 0.0000 2369641.49 2369641.49 0.00 310947.27 310947.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.29 79.98% 117397.33 102399 157653 117416.44 107889 126055 1560133 1560133 0.00
crit 3.33 20.02% 243368.69 210941 324765 237383.81 0 324765 809509 809509 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2008 2.3% 38.6 10.91sec 23545 0 19451 40317 23582 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.63 38.57 0.00 0.00 0.0000 0.0000 909607.78 909607.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.94 80.21% 19451.26 17006 26181 19452.59 17973 21322 601778 601778 0.00
crit 7.64 19.79% 40316.97 35032 53932 40283.77 0 53932 307830 307830 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6387 7.3% 16.6 28.19sec 174173 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.2 19379 40159 23490 19.8% 0.0% 20.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.62 16.62 123.20 123.20 0.0000 0.7582 2893986.92 2893986.92 0.00 30979.90 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.8 80.22% 19379.29 17006 26181 19379.85 18502 20626 1915251 1915251 0.00
crit 24.4 19.78% 40159.30 35032 53932 40157.96 36665 44620 978736 978736 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3458) 0.0% (3.9%) 11.2 41.55sec 138903 117803 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 11.25 0.00 0.00 1.1791 0.0000 0.00 0.00 0.00 117803.25 117803.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 80.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.69% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3458 3.9% 11.2 41.55sec 138903 0 114647 237545 138903 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 11.25 0.00 0.00 0.0000 0.0000 1562542.25 1562542.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 80.26% 114647.45 104363 153137 114610.11 105092 125328 1035145 1035145 0.00
crit 2.22 19.74% 237544.72 214987 315462 216177.12 0 315462 527397 527397 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.55sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.25 243.54 0.00 0.00 0.0000 0.0000 0.00 48479209.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.83 77.13% 0.00 0 0 0.00 0 0 0 30045403 100.00
crit 55.71 22.87% 0.00 0 0 0.00 0 0 0 18433807 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9947 11.3% 40.3 11.21sec 111820 87636 92222 190985 111823 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.25 40.25 0.00 0.00 1.2760 0.0000 4501247.06 4501247.06 0.00 87635.98 87635.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.27 80.16% 92222.14 82079 126948 92239.76 88711 97074 2975658 2975658 0.00
crit 7.99 19.84% 190984.93 169082 261513 191004.55 0 225971 1525589 1525589 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16691 (21910) 18.9% (24.8%) 125.3 3.54sec 78891 46999 0 0 0 0.0% 0.0% 0.0% 0.0% 255.8 24262 50282 29448 19.9% 0.0% 41.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.32 125.32 255.77 255.77 1.6786 0.7381 7531907.51 7531907.51 0.00 46999.47 46999.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 204.8 80.07% 24262.33 21797 33558 24266.63 23647 24930 4968816 4968816 0.00
crit 51.0 19.93% 50282.48 44901 69130 50292.70 47697 53801 2563091 2563091 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5219 5.9% 80.0 5.47sec 29441 0 24272 50347 29458 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.97 79.93 0.00 0.00 0.0000 0.0000 2354384.15 2354384.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.03 80.11% 24271.96 21797 33558 24275.43 23226 25757 1554149 1554149 0.00
crit 15.89 19.89% 50346.76 44901 69130 50353.26 45201 56724 800235 800235 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1968 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4229 4.8% 15.3 4.95sec 125272 104771 102964 213593 125268 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 15.33 0.00 0.00 1.1957 0.0000 1919829.43 1919829.43 0.00 104771.31 104771.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.24 79.84% 102964.18 79678 123491 103063.28 94554 113753 1259773 1259773 0.00
crit 3.09 20.16% 213592.98 164137 254391 206173.96 0 254391 660057 660057 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9579 (12583) 10.9% (14.3%) 59.7 7.53sec 95294 80511 0 0 0 0.0% 0.0% 0.0% 0.0% 251.4 14223 29441 17234 19.8% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.73 59.73 251.40 251.40 1.1836 1.7335 4332660.05 4332660.05 0.00 11237.01 80510.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 201.7 80.21% 14222.82 12783 19677 14221.30 13677 14672 2868164 2868164 0.00
crit 49.7 19.79% 29441.39 26333 40534 29437.77 28063 31376 1464496 1464496 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3005 3.4% 78.5 5.69sec 17314 0 14274 29573 17329 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.49 78.42 0.00 0.00 0.0000 0.0000 1358887.51 1358887.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.75 80.03% 14273.91 12783 19677 14274.56 13550 15048 895749 895749 0.00
crit 15.66 19.97% 29572.87 26333 40534 29575.82 26728 33695 463139 463139 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2830 3.2% 60.9 7.32sec 21011 0 17795 35823 21368 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.91 59.89 0.00 0.00 0.0000 0.0000 1279743.78 1279743.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.02 80.18% 17795.10 15875 24625 17794.39 16829 18760 854569 854569 0.00
crit 11.87 19.82% 35822.81 31750 49250 35815.41 31750 41200 425175 425175 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7569 (9942) 8.6% (11.3%) 30.0 15.08sec 150017 126664 0 0 0 0.0% 0.0% 0.0% 0.0% 176.3 16004 33147 19410 19.9% 0.0% 87.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.97 29.97 176.31 176.31 1.1844 2.2367 3422321.57 3422321.57 0.00 10458.13 126663.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.3 80.13% 16004.16 14287 22306 16003.26 15443 16689 2261106 2261106 0.00
crit 35.0 19.87% 33147.42 29431 45950 33145.03 30805 36343 1161215 1161215 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2374 2.7% 55.1 7.96sec 19479 0 16070 33281 19495 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.09 55.04 0.00 0.00 0.0000 0.0000 1073096.04 1073096.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.09 80.10% 16070.21 14287 22306 16071.24 15179 17243 708537 708537 0.00
crit 10.95 19.90% 33280.99 29431 45950 33279.33 29431 38922 364559 364559 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37574 / 9713
melee 37574 11.0% 105.3 4.18sec 41648 39063 36395 73315 41648 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.26 105.26 0.00 0.00 1.0662 0.0000 4383921.47 4383921.47 0.00 39062.64 39062.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.81 55.87% 36395.29 29063 44745 36413.90 34615 38934 2140470 2140470 0.00
crit 21.17 20.11% 73315.25 58126 89490 73348.39 67474 80856 1551930 1551930 0.00
glance 25.28 24.02% 27353.33 21797 33559 27367.14 25040 29590 691521 691521 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1908 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.32%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 19.97% 19.97%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.97%

    Trigger Attempt Success

    • trigger_pct:16.29%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.6sec 20.7sec 43.56% 43.87%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.56%

    Trigger Attempt Success

    • trigger_pct:2.40%
light_of_the_cosmos 9.5 0.0 49.2sec 49.2sec 41.28% 41.28%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.28%

    Trigger Attempt Success

    • trigger_pct:14.98%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.3sec 10.3sec 9.84% 49.35%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.84%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 110.3 0.0sec 0.7sec 16.49% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no2PT14
devouring_plague Shadow Orb 16.6 49.8 3.0 3.0 123842.4
halo Mana 11.2 455589.4 40500.0 40499.9 3.4
mind_blast Mana 40.3 362291.0 9000.0 9000.1 12.4
mind_flay Mana 125.3 375946.1 3000.0 3000.0 26.3
shadow_word_death Mana 15.3 119540.9 7800.0 7800.2 16.1
shadow_word_pain Mana 59.7 788380.0 13200.0 13199.9 7.2
vampiric_touch Mana 30.0 269694.7 9000.0 9000.0 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.09 1615.68 (0.07%) 18000.00 0.00 0.00%
mindbender Mana 105.26 443872.16 (20.56%) 4216.87 17271.10 3.75%
Shadow Orbs from Mind Blast Shadow Orb 40.25 40.25 (83.83%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.76 7.76 (16.17%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.78 0.00 (-nan%) 0.00 2246529.11 100.00%
Vampiric Touch Mana Mana 231.36 1185185.83 (54.89%) 5122.74 37830.65 3.09%
mp5_regen Mana 1808.89 528389.55 (24.47%) 292.11 14277.33 2.63%
Resource RPS-Gain RPS-Loss
Mana 4773.02 5242.52
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 87616.28 147.62 231876.19
Shadow Orb 1.17 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 252.0 1.8sec
Shadowy Apparition Procced 60.9 7.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no2PT14 Damage Per Second
Count 49992
Mean 88244.18
Minimum 80061.49
Maximum 95433.56
Spread ( max - min ) 15372.07
Range [ ( max - min ) / 2 * 100% ] 8.71%
Standard Deviation 1809.6612
5th Percentile 85358.08
95th Percentile 91254.46
( 95th Percentile - 5th Percentile ) 5896.39
Mean Distribution
Standard Deviation 8.0937
95.00% Confidence Intervall ( 88228.32 - 88260.04 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1615
0.1 Scale Factor Error with Delta=300 27956
0.05 Scale Factor Error with Delta=300 111824
0.01 Scale Factor Error with Delta=300 2795620
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 88244.18
Distribution Chart

Damage

Sample Data
Count 49992
Mean 35509855.56
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 261.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.98 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.33 shadow_word_death,if=active_enemies<=5
F 44.89 mind_blast,if=active_enemies<=6&cooldown_react
G 19.14 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.06 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.25 halo,if=talent.halo.enabled
M 12.64 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 3.38 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 10.42 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.66 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.59 shadow_word_pain,moving=1
X 0.02 dispersion

Sample Sequence

DGLWFHTFTHTFGTWWWWWFHMTLFTHTFGTAWWFHTQQFMTHTGTFLTWWWWFHTFMTHTGTFTGAWFHLTQFTHTFGMTWWWWFHTFTHLTGTFMTWWAFHTQQFTHTGQFMTLWWWFHTFTHTGTFMTGWAFHTLTFTHGTFMTWWWWHFTQFTHTGLFMTWWWAFHTTFTHTGTFMWWWWWHLFTTFTHTGTFMTGWWHAFTTLEEFHMGTPEEWWWWWFEDEHTQFTEETGHFDLE9EWQQQQQQQQQQQFAHPEDETQFTPEEGHFMTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no4PT14 : 90447 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
90447.0 90447.0 15.99 / 0.02% 2998 / 3.3% 15.4 5243.3 4772.3 Mana 0.55% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://0.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:310898|126658|117856|105012|87752|87605|46993&chds=0,621797&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++310898++devouring_plague,9482C9,0,0,15|t++126658++vampiric_touch,9482C9,1,0,15|t++117856++halo,9482C9,2,0,15|t++105012++shadow_word_death,9482C9,3,0,15|t++87752++mind_blast,9482C9,4,0,15|t++87605++shadow_word_pain,9482C9,5,0,15|t++46993++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,13,12,12,9,8,6,6,5,5,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|mindbender: melee|vampiric_touch|devouring_plague_tick|devouring_plague|mind_flay_mastery|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no4PT14 Damage Sources&chts=dddddd,18
http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:y0245332220y01002011zxvspnonnmmooqponmmkiiihijjiiigfdcbbbdddfhijllmooonopqqprrppomkjhfedcbcccccbccbcbcddefghhhgfecdcfffghikkllllllklmnoopnmmlkihfdedcccdeeeddddddddceegfggffeddddeeeffgijijklkkklllmnonnnmmkjhihfffghghhhgggffeeffhhhhgedcbabbbcdfhhiijkklklmnopqrqqpomkjhhgfeddeeedddccbbccdefgfgfeddccccdefhijkiklmnnoopppqrsrqqonnlmlljjjjkkkllllkklkllnnnnmkjihfffffghjjllmnoooqstutvwxwvvtsrponnllkklkkllmlmmnnnopqrrqppppooonooprrssuuvwwyz0zz12343321101z0zzyyyyyzzzzzzzzyyzyyywtsrqoonmmmmoopprstuux02334667776543310zyxxwvvvvuuututttuuttsrrrrpqpoonoopqqpooonoqppopq&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6239,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=90447|max=144963&chxp=1,1,62,100&chtt=priest_90_tof_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,32,0,8,8,24,48,88,112,176,240,336,440,576,752,896,1392,1560,1584,2328,2640,2840,3080,3240,3400,3200,2912,2920,2696,2400,1984,1712,1352,1392,976,704,520,392,376,224,120,72,48,80,32,32,40&chds=0,3400&chbh=5&chxt=x&chxl=0:|min=82365|avg=90447|max=96871&chxp=0,1,56,100&chtt=priest_90_tof_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.5,15.6,11.4,7.8,4.4,4.1,2.9,1.8,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 210.2s|shadow_word_pain 70.7s|mind_blast 51.4s|vampiric_touch 35.5s|devouring_plague 19.9s|shadow_word_death 18.3s|halo 13.3s|mindbender 8.3s|dispersion 0.1s|waiting 2.5s&chtt=priest_90_tof_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no4PT14 90447
devouring_plague 5230 (13632) 5.8% (15.1%) 16.6 28.19sec 371419 310898 117449 243320 142386 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.62 16.62 0.00 0.00 1.1947 0.0000 2366555.06 2366555.06 0.00 310898.41 310898.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.33 80.19% 117449.37 102399 157653 117470.33 108619 128667 1565332 1565332 0.00
crit 3.29 19.81% 243319.74 210941 324765 236397.52 0 324765 801223 801223 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2011 2.2% 38.7 10.90sec 23549 0 19449 40309 23590 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.69 38.62 0.00 0.00 0.0000 0.0000 911008.37 911008.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.95 80.15% 19449.37 17006 26181 19450.47 17961 21006 601985 601985 0.00
crit 7.67 19.85% 40309.13 35032 53932 40264.14 0 53932 309023 309023 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6391 7.1% 16.6 28.19sec 174220 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.3 19387 40162 23491 19.8% 0.0% 20.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.62 16.62 123.27 123.27 0.0000 0.7580 2895635.43 2895635.43 0.00 30989.25 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.9 80.25% 19386.82 17006 26181 19386.87 18303 20550 1917695 1917695 0.00
crit 24.3 19.75% 40162.01 35032 53932 40158.20 36446 44487 977941 977941 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3462) 0.0% (3.8%) 11.3 41.54sec 138935 117856 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.26 11.26 0.00 0.00 1.1789 0.0000 0.00 0.00 0.00 117855.82 117855.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.01 80.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.24 19.92% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3462 3.8% 11.3 41.54sec 138935 0 114668 237420 138936 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.26 11.26 0.00 0.00 0.0000 0.0000 1563946.70 1563946.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 80.23% 114668.04 104363 153137 114632.18 105214 124749 1035607 1035607 0.00
crit 2.23 19.77% 237420.02 214987 315462 215940.94 0 315462 528340 528340 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.3 41.54sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.26 243.71 0.00 0.00 0.0000 0.0000 0.00 48516569.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.95 77.12% 0.00 0 0 0.00 0 0 0 30069120 100.00
crit 55.75 22.88% 0.00 0 0 0.00 0 0 0 18447449 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9962 11.0% 40.3 11.20sec 111934 87752 92236 191017 111934 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.27 40.27 0.00 0.00 1.2756 0.0000 4507622.83 4507622.83 0.00 87751.57 87751.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.24 80.06% 92235.55 82079 126948 92251.86 88068 96301 2973647 2973647 0.00
crit 8.03 19.94% 191017.26 169082 261513 190973.46 0 261513 1533976 1533976 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16683 (21897) 18.4% (24.2%) 125.3 3.54sec 78884 46993 0 0 0 0.0% 0.0% 0.0% 0.0% 255.6 24266 50296 29452 19.9% 0.0% 41.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 125.25 125.25 255.62 255.62 1.6786 0.7381 7528546.07 7528546.07 0.00 46993.01 46993.01
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 204.7 80.08% 24265.74 21797 33558 24270.43 23726 25008 4967083 4967083 0.00
crit 50.9 19.92% 50295.62 44901 69130 50306.50 47896 53014 2561463 2561463 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5213 5.8% 79.8 5.47sec 29456 0 24276 50302 29470 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.84 79.80 0.00 0.00 0.0000 0.0000 2351734.37 2351734.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.88 80.04% 24276.16 21797 33558 24280.98 23028 25705 1550666 1550666 0.00
crit 15.93 19.96% 50301.65 44901 69130 50307.34 46073 55612 801068 801068 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1967 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4240 4.7% 15.3 4.96sec 125550 105012 102994 213717 125550 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.33 15.33 0.00 0.00 1.1956 0.0000 1924861.37 1924861.37 0.00 105011.53 105011.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.21 79.63% 102994.38 79678 123491 103085.04 94369 113580 1257378 1257378 0.00
crit 3.12 20.37% 213716.84 164137 254391 206301.10 0 254391 667483 667483 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10427 (13695) 11.5% (15.1%) 59.7 7.52sec 103697 87605 0 0 0 0.0% 0.0% 0.0% 0.0% 251.4 14222 29415 18761 29.9% 0.0% 96.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.74 59.74 251.39 251.39 1.1837 1.7333 4716307.14 4716307.14 0.00 12231.75 87604.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.74 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.3 70.13% 14222.47 12783 19677 14221.18 13669 14713 2507326 2507326 0.00
crit 75.1 29.87% 29414.53 26333 40534 29413.48 28120 30996 2208981 2208981 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3269 3.6% 78.6 5.68sec 18807 0 14278 29533 18823 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.62 78.55 0.00 0.00 0.0000 0.0000 1478475.62 1478475.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.15 70.21% 14278.09 12783 19677 14278.45 13650 15289 787382 787382 0.00
crit 23.40 29.79% 29532.54 26333 40534 29535.43 27443 32808 691094 691094 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3912 4.3% 84.2 5.32sec 21027 0 17796 35800 21379 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.17 82.78 0.00 0.00 0.0000 0.0000 1769784.57 1769784.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.31 80.10% 17795.51 15875 24625 17795.36 16987 18512 1180015 1180015 0.00
crit 16.47 19.90% 35800.39 31750 49250 35805.58 32616 40685 589770 589770 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 7566 (9938) 8.4% (11.0%) 30.0 15.08sec 150023 126658 0 0 0 0.0% 0.0% 0.0% 0.0% 176.2 16004 33147 19415 19.9% 0.0% 87.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.95 29.95 176.20 176.20 1.1845 2.2368 3420979.93 3420979.93 0.00 10459.12 126658.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.1 80.10% 16004.15 14287 22306 16003.29 15454 16597 2258887 2258887 0.00
crit 35.1 19.90% 33147.09 29431 45950 33145.27 31234 35861 1162093 1162093 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2372 2.6% 55.1 7.96sec 19470 0 16069 33292 19486 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.08 55.03 0.00 0.00 0.0000 0.0000 1072351.11 1072351.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.12 80.16% 16069.44 14287 22306 16069.60 15202 17210 708914 708914 0.00
crit 10.92 19.84% 33292.18 29431 45950 33295.22 29431 40390 363437 363437 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37558 / 9710
melee 37558 10.7% 105.3 4.18sec 41628 39049 36395 73324 41628 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.28 105.28 0.00 0.00 1.0661 0.0000 4382576.10 4382576.10 0.00 39049.26 39049.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.87 55.92% 36394.84 29063 44745 36413.81 34232 38573 2142603 2142603 0.00
crit 21.12 20.06% 73323.80 58126 89490 73352.76 64601 80037 1548362 1548362 0.00
glance 25.29 24.02% 27346.26 21797 33559 27361.55 25053 29975 691612 691612 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.32sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1909 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.32%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.8sec 108.8sec 19.96% 19.96%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.96%

    Trigger Attempt Success

    • trigger_pct:16.23%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.0 36.4sec 20.6sec 43.93% 44.32%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.93%

    Trigger Attempt Success

    • trigger_pct:2.42%
light_of_the_cosmos 9.5 0.0 49.2sec 49.2sec 41.28% 41.28%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.28%

    Trigger Attempt Success

    • trigger_pct:15.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.8 0.0 10.3sec 10.3sec 9.84% 49.35%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.84%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 114.0 0.0sec 0.7sec 16.49% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 510.0sec 510.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no4PT14
devouring_plague Shadow Orb 16.6 49.9 3.0 3.0 123805.9
halo Mana 11.3 455893.9 40500.0 40499.9 3.4
mind_blast Mana 40.3 362432.2 9000.0 9000.0 12.4
mind_flay Mana 125.3 375754.6 3000.0 3000.0 26.3
shadow_word_death Mana 15.3 119588.4 7800.0 7800.2 16.1
shadow_word_pain Mana 59.7 788551.1 13200.0 13199.8 7.9
vampiric_touch Mana 30.0 269557.9 9000.0 9000.0 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.10 1837.44 (0.09%) 18000.00 0.00 0.00%
mindbender Mana 105.28 443971.01 (20.57%) 4217.08 17252.86 3.74%
Shadow Orbs from Mind Blast Shadow Orb 40.27 40.27 (83.83%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.77 7.77 (16.17%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.89 0.00 (-nan%) 0.00 2248079.96 100.00%
Vampiric Touch Mana Mana 231.24 1184578.65 (54.87%) 5122.80 37740.87 3.09%
mp5_regen Mana 1808.89 528371.87 (24.48%) 292.10 14295.01 2.63%
Resource RPS-Gain RPS-Loss
Mana 4772.34 5243.26
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 86966.99 28.57 224123.81
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 252.0 1.8sec
Shadowy Apparition Procced 84.2 5.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no4PT14 Damage Per Second
Count 49992
Mean 90447.02
Minimum 82364.74
Maximum 96870.54
Spread ( max - min ) 14505.80
Range [ ( max - min ) / 2 * 100% ] 8.02%
Standard Deviation 1823.9949
5th Percentile 87445.87
95th Percentile 93442.04
( 95th Percentile - 5th Percentile ) 5996.17
Mean Distribution
Standard Deviation 8.1578
95.00% Confidence Intervall ( 90431.03 - 90463.00 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1562
0.1 Scale Factor Error with Delta=300 28400
0.05 Scale Factor Error with Delta=300 113603
0.01 Scale Factor Error with Delta=300 2840082
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 90447.02
Distribution Chart

Damage

Sample Data
Count 49992
Mean 36507808.56
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 261.61
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.00 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.33 shadow_word_death,if=active_enemies<=5
F 44.88 mind_blast,if=active_enemies<=6&cooldown_react
G 19.13 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.05 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.26 halo,if=talent.halo.enabled
M 12.62 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 3.53 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 10.63 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.62 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 40.61 shadow_word_pain,moving=1
X 0.02 dispersion

Sample Sequence

DGLWFHTFTHTFGTWWWWWFHMTLFTHTGFTAWWFHTQFMTHTGFLTWWWWFHTQFTHTGFMTGAWFHLTQFTHTFGTWWWWFHMTFTHLGFTWAWFHTQFMTHTGTFTWLWWFHTQFTHTGFMTGWAFHTLTFTHTGTFMTWWWWWFHTQFTHTLGFMTWWWAFHTTFTGHTFMWWWLWHFTTFTHTGTQFMTGWWFAHTLFTEDEHTGFTPEEWWWWFDEEHTQFTEDEGHQFLTPEE9WWFAHDEETQQFTEDEGFHTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no2PT14 : 79691 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
79690.7 79690.7 43.86 / 0.06% 7928 / 9.9% 15.1 5003.4 4398.1 Mana 5.86% 59.3 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309809|138423|126887|116727|104072|86520|74705|47207&chds=0,619618&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309809++devouring_plague,9482C9,0,0,15|t++138423++shadow_word_insanity,9482C9,1,0,15|t++126887++vampiric_touch,9482C9,2,0,15|t++116727++halo,9482C9,3,0,15|t++104072++shadow_word_death,9482C9,4,0,15|t++86520++mind_blast,9482C9,5,0,15|t++74705++shadow_word_pain,9482C9,6,0,15|t++47207++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,12,11,9,8,7,6,6,5,5,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|devouring_plague|shadow_word_insanity|mind_flay_mastery|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no2PT14 Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:687764444321342342320xutrqrrqqqqqrsqponlmllkllnmlmjihfdbbccbcbbdeceeeefhihiimnlmlkkjihigfefeddedebbccdedggiijkjigffegggggggghffedcbdgfhhjhghgffdcbddcddefdfdefffghihijllkljjhhhhijiikjklmlmmmmmopponpqopomlkjijihhihghihjihhhiiiijllllkihfededcbcbbbcbcccbbdgghikllmllkjjhigffffdcdccbabbbbabbdddddcccbbbbbbbaabbabbabbcdccdeeeeeeeeddeeeeeddeeeffffgggghijjjjigfeffghijklmoqpqrrrrtwxyxyyyxwvtrpnonnnnnnmnmmmmmmnnnnopppqpnoonmnnnmmllmmlmllllmonnnoppppoooonooooonnnnmnmmmmmmmmmmmllkihhgffedcbbaZZYYYYXXYZZZZZZaaabaabbbbbbabbbbbbbbbbbbbbbbaaZYYYYZabcdefgiloppqrsuwyz1113&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5892,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=79691|max=135262&chxp=1,1,59,100&chtt=priest_90_tof_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,32,16,48,48,96,168,168,144,304,272,344,312,376,568,672,784,856,936,1088,1144,1144,1360,1352,1392,1528,1576,1600,1528,1920,1984,1992,2560,2808,3104,3080,2672,2688,2240,1704,1296,832,616,384,96,80,24,24,8,8&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=61781|avg=79691|max=91880&chxp=0,1,60,100&chtt=priest_90_tof_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.1,15.0,10.7,7.1,4.2,3.6,3.4,2.5,1.3,0.5,5.9&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=mind_flay 185.8s|shadow_word_pain 67.6s|mind_blast 48.3s|vampiric_touch 32.0s|devouring_plague 19.0s|shadow_word_death 16.4s|shadow_word_insanity 15.4s|halo 11.5s|dispersion 5.8s|shadowfiend 2.5s|waiting 26.5s&chtt=priest_90_tof_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no2PT14 79691
devouring_plague 4999 (13008) 6.3% (16.4%) 15.9 29.55sec 369631 309809 117087 242078 141965 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.91 15.91 0.00 0.00 1.1931 0.0000 2258216.90 2258216.90 0.00 309808.75 309808.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.74 80.09% 117086.68 102399 157653 117118.95 106974 126885 1491695 1491695 0.00
crit 3.17 19.91% 242078.35 210941 324765 234116.46 0 324765 766521 766521 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1913 2.4% 36.8 11.42sec 23483 0 19392 40160 23517 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.84 36.79 0.00 0.00 0.0000 0.0000 865102.92 865102.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.48 80.14% 19391.74 17006 26181 19393.77 17635 21885 571694 571694 0.00
crit 7.31 19.86% 40160.42 35032 53932 40110.92 0 48833 293409 293409 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6096 7.7% 15.9 29.55sec 173277 0 0 0 0 0.0% 0.0% 0.0% 0.0% 117.6 19315 40010 23430 19.9% 0.0% 19.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.91 15.91 117.64 117.64 0.0000 0.7563 2756230.65 2756230.65 0.00 30978.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.2 80.11% 19315.19 17006 26181 19316.86 17821 20585 1820336 1820336 0.00
crit 23.4 19.89% 40009.54 35032 53932 40010.56 35947 45652 935894 935894 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.1 154.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 7.0 0 0 0 0.0% 0.0% 1.2%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.13 1.13 7.02 7.02 5.0892 0.7764 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.13 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:physical
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (2993) 0.0% (3.7%) 9.8 44.96sec 137508 116727 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.78 9.78 0.00 0.00 1.1781 0.0000 0.00 0.00 0.00 116727.46 116727.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.84 80.13% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.94 19.87% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 2993 3.7% 9.8 44.96sec 137508 0 113724 235344 137507 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.78 9.78 0.00 0.00 0.0000 0.0000 1344933.76 1344933.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.87 80.44% 113724.37 104363 153137 113734.63 105001 128892 894780 894780 0.00
crit 1.91 19.56% 235343.68 214987 315462 206907.22 0 315462 450154 450154 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 9.8 44.96sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.78 214.48 0.00 0.00 0.0000 0.0000 0.00 42461771.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 165.28 77.06% 0.00 0 0 0.00 0 0 0 26280330 100.00
crit 49.21 22.94% 0.00 0 0 0.00 0 0 0 16181441 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9265 11.6% 37.7 11.61sec 110823 86520 91422 189272 110823 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.70 37.70 0.00 0.00 1.2809 0.0000 4177545.39 4177545.39 0.00 86520.28 86520.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.22 80.17% 91422.15 82079 126948 91419.95 86304 96630 2762914 2762914 0.00
crit 7.47 19.83% 189272.14 169082 261513 189310.94 169082 232674 1414631 1414631 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14822 (19463) 18.6% (24.4%) 108.9 3.91sec 80537 47207 0 0 0 0.0% 0.0% 0.0% 0.0% 227.6 24175 50116 29344 19.9% 0.0% 37.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.88 108.88 227.57 227.57 1.7060 0.7367 6677720.22 6677720.22 0.00 47207.20 47207.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.2 80.07% 24174.95 21797 33558 24179.51 23432 25107 4405309 4405309 0.00
crit 45.3 19.93% 50115.57 44901 69130 50124.95 47155 53273 2272411 2272411 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4641 5.8% 71.2 5.89sec 29375 0 24199 50157 29384 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.18 71.16 0.00 0.00 0.0000 0.0000 2091065.10 2091065.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.95 80.02% 24198.87 21797 33558 24203.32 23075 26128 1378079 1378079 0.00
crit 14.21 19.98% 50157.38 44901 69130 50167.85 45351 63070 712986 712986 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3776 4.8% 13.7 5.53sec 124541 104072 102497 212425 124538 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.71 13.71 0.00 0.00 1.1967 0.0000 1707304.40 1707304.40 0.00 104072.20 104072.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.96 79.95% 102496.59 79678 123491 102588.84 93586 116171 1123330 1123330 0.00
crit 2.75 20.05% 212425.39 164137 254391 201013.81 0 254391 583974 583974 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4725 5.9% 12.9 32.48sec 164533 138423 136004 281883 164534 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.95 12.95 0.00 0.00 1.1887 0.0000 2130050.67 2130050.67 0.00 138422.84 138422.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.41 80.44% 136004.32 122772 190440 135955.74 124942 149434 1416389 1416389 0.00
crit 2.53 19.56% 281882.99 252910 392307 263039.70 0 392307 713661 713661 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8528 (11212) 10.7% (14.1%) 57.2 7.58sec 88341 74705 0 0 0 0.0% 0.0% 0.0% 0.0% 224.9 14115 29208 17095 19.7% 0.0% 84.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.20 57.20 224.85 224.85 1.1825 1.6914 3843790.55 3843790.55 0.00 11280.59 74705.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.5 80.26% 14115.02 12783 19677 14113.85 13429 14741 2547199 2547199 0.00
crit 44.4 19.74% 29208.09 26333 40534 29204.29 27465 31687 1296592 1296592 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2683 3.4% 70.3 6.14sec 17194 0 14174 29352 17203 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.35 70.31 0.00 0.00 0.0000 0.0000 1209497.50 1209497.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.27 80.04% 14173.86 12783 19677 14173.24 13466 15128 797601 797601 0.00
crit 14.03 19.96% 29351.53 26333 40534 29355.28 26333 33593 411896 411896 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2150 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2546 3.2% 54.7 7.88sec 21008 0 17683 35545 21241 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.65 54.05 0.00 0.00 0.0000 0.0000 1148097.09 1148097.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.29 80.08% 17683.48 15875 24625 17681.53 16657 19106 765476 765476 0.00
crit 10.76 19.92% 35544.85 31750 49250 35539.86 31750 43657 382621 382621 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 6853 (9006) 8.6% (11.3%) 26.9 16.00sec 150697 126887 0 0 0 0.0% 0.0% 0.0% 0.0% 160.1 15905 32929 19274 19.8% 0.0% 78.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.91 26.91 160.08 160.08 1.1877 2.2292 3085341.25 3085341.25 0.00 10429.04 126887.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.4 80.21% 15905.15 14287 22306 15904.05 15105 16655 2042263 2042263 0.00
crit 31.7 19.79% 32929.22 29431 45950 32926.67 30724 35681 1043078 1043078 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2153 2.7% 50.1 8.35sec 19350 0 15953 33073 19361 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.10 50.07 0.00 0.00 0.0000 0.0000 969468.93 969468.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.10 80.09% 15952.93 14287 22306 15949.85 15057 17248 639790 639790 0.00
crit 9.97 19.91% 33072.56 29431 45950 33070.01 29431 40947 329679 329679 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46458 / 3697
melee 46458 4.6% 31.4 12.73sec 52614 51780 45940 92696 52613 20.2% 0.0% 24.3% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.43 31.43 0.00 0.00 1.0161 0.0000 1653584.24 1653584.24 0.00 51779.69 51779.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.46 55.54% 45939.70 36329 55931 45954.36 41986 54268 801957 801957 0.00
crit 6.35 20.19% 92695.86 72658 111863 92576.41 0 111863 588320 588320 0.00
glance 7.63 24.26% 34530.02 27247 41949 34533.88 0 41949 263307 263307 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1955 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 11.98%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.5 0.0 109.5sec 109.5sec 19.83% 19.83%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.83%

    Trigger Attempt Success

    • trigger_pct:16.32%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 8.9 36.4sec 20.6sec 43.90% 44.35%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.90%

    Trigger Attempt Success

    • trigger_pct:2.62%
light_of_the_cosmos 9.3 0.0 49.9sec 49.9sec 40.53% 40.53%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:40.53%

    Trigger Attempt Success

    • trigger_pct:15.01%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.2 0.0 9.6sec 9.6sec 10.33% 39.95%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.33%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 83.0 0.0sec 0.9sec 16.46% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.17% 14.17%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.63%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no2PT14
devouring_plague Shadow Orb 15.9 47.7 3.0 3.0 123210.2
halo Mana 9.8 396122.4 40500.0 40500.1 3.4
mind_blast Mana 37.7 339261.1 9000.0 9000.0 12.3
mind_flay Mana 108.9 326637.6 3000.0 3000.0 26.8
shadow_word_death Mana 13.7 106933.6 7800.0 7800.4 16.0
shadow_word_insanity Mana 12.9 97094.4 7500.0 7499.9 21.9
shadow_word_pain Mana 57.2 755065.3 13200.0 13199.9 6.7
vampiric_touch Mana 26.9 242163.4 9000.0 9000.0 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 7.02 126288.00 (6.35%) 18000.00 0.00 0.00%
shadowfiend Mana 31.43 252174.72 (12.68%) 8023.64 30685.92 10.85%
Shadow Orbs from Mind Blast Shadow Orb 37.70 37.70 (82.15%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.19 8.19 (17.85%) 1.00 0.00 0.00%
Devouring Plague Health Health 154.42 0.00 (-nan%) 0.00 2144425.86 100.00%
Vampiric Touch Mana Mana 210.15 1079544.96 (54.26%) 5136.93 31152.48 2.80%
mp5_regen Mana 1808.89 531458.11 (26.71%) 293.80 11208.77 2.07%
Resource RPS-Gain RPS-Loss
Mana 4398.09 5003.40
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 26183.39 0.00 192600.00
Shadow Orb 1.17 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%
shadowfiend-Mana Cap 2.1%
lightwell-Mana Cap 2.1%

Procs

Count Interval
Shadowy Recall Extra Tick 228.3 1.9sec
Shadowy Apparition Procced 54.7 7.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no2PT14 Damage Per Second
Count 49992
Mean 79690.67
Minimum 61781.04
Maximum 91880.12
Spread ( max - min ) 30099.07
Range [ ( max - min ) / 2 * 100% ] 18.88%
Standard Deviation 5003.2879
5th Percentile 70359.19
95th Percentile 86215.87
( 95th Percentile - 5th Percentile ) 15856.68
Mean Distribution
Standard Deviation 22.3772
95.00% Confidence Intervall ( 79646.81 - 79734.53 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 151
0.1% Error 15142
0.1 Scale Factor Error with Delta=300 213695
0.05 Scale Factor Error with Delta=300 854780
0.01 Scale Factor Error with Delta=300 21369514
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 79690.67
Distribution Chart

Damage

Sample Data
Count 49992
Mean 34264365.30
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 447.27
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.01 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 13.71 shadow_word_death,if=active_enemies<=5
F 42.32 mind_blast,if=active_enemies<=6&cooldown_react
G 17.92 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 27.19 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.95 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.78 halo,if=talent.halo.enabled
M 11.90 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 132.28 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 79.44 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 52.33 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 39.28 shadow_word_pain,moving=1
X 1.13 dispersion

Sample Sequence

DGLWFHTQFTHIGFTWWWWWFHMTFLTHIGTFTWWWFHTFMTHIGTFLTWWWWHFTQFMHIGTFTGWWFHLTFMTHIGTFTWWWWFHTFMLHIGTQFTBWWFHTQQFMTHTIGFTLWWWWFHTQQFMTHIGTFTGWWFHTFTHTIFGMTWWWWQQQQQQQQQQQQQFXHLFTIGTFHMWWHQFTQFHTIGTFLMWWWWHFTQFTHTIGTQFMTGBWFHTLTFTEEHIGFMTEEWWWWFHEDETFTEEGHQQQQFMTEE9WQQQQQQQQQQQQFHTEDETFTHEPPEIQQQQQFMTG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no4PT14 : 81520 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
81520.4 81520.4 44.77 / 0.05% 8034 / 9.9% 15.5 4996.1 4389.2 Mana 5.97% 59.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://8.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309535|138938|126835|117081|104293|86418|81111|47186&chds=0,619071&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309535++devouring_plague,9482C9,0,0,15|t++138938++shadow_word_insanity,9482C9,1,0,15|t++126835++vampiric_touch,9482C9,2,0,15|t++117081++halo,9482C9,3,0,15|t++104293++shadow_word_death,9482C9,4,0,15|t++86418++mind_blast,9482C9,5,0,15|t++81111++shadow_word_pain,9482C9,6,0,15|t++47186++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,12,12,9,8,6,6,6,5,5,5,4,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|shadow_word_pain|mind_blast|vampiric_touch|devouring_plague_tick|devouring_plague|shadow_word_insanity|mind_flay_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no4PT14 Damage Sources&chts=dddddd,18
http://1.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:687764444321342342330xvtsrsrqqqrqssqpoommmlkmmnmmmkjhgdccdccdccdedfefffhiiiimnlmmlkjihiggffeddedecccdeedggjikkjihggegggghgghifgeedcdggihjighggfddbddddeffefeffgghhiiijmlklkjhhhhijiikklmmlmmmmnpppoopqopomlljijjiiiihhiijiiiijjijjlllmkihgfdedcccbbcdcccccbehhiikllmmllkjhihgggfeddcdcbbbbbbbcdddddccccbccccbbbbcbbbbbbcdccdeeeeeeedddeeeeedeefeffffgghhhijjjjigfeffghijklmoqpqrrrrtwxyxyyyxwvtrqooonnnnnnnmnmmmnnnnoopppqpnoonmnnnmmmlmmlmmmllnonnnoppppooooopoooonnnnnnnmmmmmmmmmllljhhgffedccbaaZZYYYYXXYZZZZZZZaaaaabbbaaaabbbbbabbbbbbaaaaaZZYXYYZaacdeegiknoopqstvyz0012&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5933,0.4&chxt=x,y&chxl=0:|0|sec=558|1:|0|avg=81520|max=137405&chxp=1,1,59,100&chtt=priest_90_tof_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,24,56,40,72,80,112,200,176,152,176,224,296,312,552,544,648,712,968,984,1136,1208,1360,1512,1536,1664,1600,1264,1472,1768,1888,1976,2008,2664,2864,3056,2976,2944,2352,2120,1472,1040,760,504,240,144,88,8,8&chds=0,3056&chbh=5&chxt=x&chxl=0:|min=62310|avg=81520|max=92974&chxp=0,1,63,100&chtt=priest_90_tof_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:41.0,14.9,10.7,7.0,4.2,3.6,3.4,2.5,1.3,0.5,6.0&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,9482C9,ffffff&chl=mind_flay 185.7s|shadow_word_pain 67.6s|mind_blast 48.2s|vampiric_touch 31.9s|devouring_plague 18.9s|shadow_word_death 16.4s|shadow_word_insanity 15.4s|halo 11.5s|dispersion 5.7s|shadowfiend 2.5s|waiting 27.0s&chtt=priest_90_tof_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no4PT14 81520
devouring_plague 4994 (12963) 6.1% (16.0%) 15.9 29.61sec 369205 309535 116975 242398 142120 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.88 15.88 0.00 0.00 1.1928 0.0000 2256359.12 2256359.12 0.00 309535.29 309535.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.69 79.95% 116975.21 102399 157653 117002.16 106539 127705 1484826 1484826 0.00
crit 3.18 20.05% 242398.17 210941 324765 233726.30 0 324765 771533 771533 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1901 2.3% 36.7 11.47sec 23456 0 19384 40137 23492 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.66 36.60 0.00 0.00 0.0000 0.0000 859858.83 859858.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.36 80.21% 19383.87 17006 26181 19383.44 17870 21126 569082 569082 0.00
crit 7.24 19.79% 40136.59 35032 53932 40083.93 0 51512 290777 290777 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6069 7.5% 15.9 29.61sec 172926 0 0 0 0 0.0% 0.0% 0.0% 0.0% 117.4 19302 40000 23391 19.8% 0.0% 19.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.88 15.88 117.37 117.37 0.0000 0.7562 2745451.90 2745451.90 0.00 30933.97 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.2 80.24% 19301.51 17006 26181 19302.87 18282 20502 1817777 1817777 0.00
crit 23.2 19.76% 39999.76 35032 53932 39993.33 35911 44566 927675 927675 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
dispersion 0 0.0% 1.1 153.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 7.0 0 0 0 0.0% 0.0% 1.2%

Stats details: dispersion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.12 1.12 6.95 6.95 5.1076 0.7759 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.12 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.0 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: dispersion

Static Values
  • id:47585
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:47585
  • name:Dispersion
  • school:physical
  • tooltip:Reduces all damage by {$s1=90}%, and you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Cannot attack or cast spells. Immune to snare and movement impairing effects.
  • description:You disperse into pure Shadow energy, reducing all damage taken by {$47585s1=90}%. You are unable to attack or cast spells, but you regenerate {$49766s1=6}% mana every {$60069t1=1} sec for {$d=6 seconds}. Dispersion can be cast while stunned, feared or silenced. Clears all snare and movement impairing effects when cast, and makes you immune to them while dispersed.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • tick_power_mod:0.000000
  • base_td:0.00
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (2998) 0.0% (3.7%) 9.8 44.95sec 137921 117081 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.76 9.76 0.00 0.00 1.1781 0.0000 0.00 0.00 0.00 117081.34 117081.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.83 80.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 1.94 19.82% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 2998 3.7% 9.8 44.95sec 137921 0 113695 235243 137920 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.76 9.76 0.00 0.00 0.0000 0.0000 1346786.68 1346786.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 7.82 80.07% 113695.29 104363 153137 113686.68 104363 127860 888945 888945 0.00
crit 1.95 19.93% 235243.48 214987 315462 207877.88 0 315462 457841 457841 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 9.8 44.95sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 9.76 214.05 0.00 0.00 0.0000 0.0000 0.00 42379073.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 164.87 77.02% 0.00 0 0 0.00 0 0 0 26208224 100.00
crit 49.18 22.98% 0.00 0 0 0.00 0 0 0 16170850 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9232 11.3% 37.6 11.63sec 110762 86418 91382 189248 110763 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.60 37.60 0.00 0.00 1.2817 0.0000 4164811.63 4164811.63 0.00 86417.64 86417.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.16 80.20% 91382.12 82079 126948 91373.58 86524 96693 2755665 2755665 0.00
crit 7.45 19.80% 189248.39 169082 261513 189098.29 0 236450 1409146 1409146 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 14805 (19443) 18.2% (23.8%) 108.9 3.91sec 80484 47186 0 0 0 0.0% 0.0% 0.0% 0.0% 227.4 24172 50096 29330 19.9% 0.0% 37.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.85 108.85 227.44 227.44 1.7057 0.7366 6670772.42 6670772.42 0.00 47185.80 47185.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.2 80.10% 24171.67 21797 33558 24175.47 23384 25134 4403529 4403529 0.00
crit 45.3 19.90% 50095.77 44901 69130 50103.93 47347 53672 2267244 2267244 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4638 5.7% 71.2 5.89sec 29358 0 24192 50143 29368 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.19 71.17 0.00 0.00 0.0000 0.0000 2090074.37 2090074.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.97 80.05% 24191.68 21797 33558 24195.40 23052 25787 1378279 1378279 0.00
crit 14.20 19.95% 50142.76 44901 69130 50147.79 45576 57953 711795 711795 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3775 4.6% 13.7 5.55sec 124778 104293 102425 212577 124780 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.68 13.68 0.00 0.00 1.1964 0.0000 1706434.47 1706434.47 0.00 104292.54 104292.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.90 79.71% 102424.84 79678 123491 102516.11 93263 114616 1116495 1116495 0.00
crit 2.78 20.29% 212577.11 164137 254391 202073.66 0 254391 589939 589939 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 4741 5.8% 12.9 32.53sec 165118 138938 136037 281748 165123 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.95 12.95 0.00 0.00 1.1885 0.0000 2137840.11 2137840.11 0.00 138938.07 138938.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 10.36 80.04% 136036.74 122772 190440 135975.36 123721 149406 1409784 1409784 0.00
crit 2.58 19.96% 281747.71 252910 392307 265917.39 0 392307 728056 728056 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9258 (12157) 11.4% (14.9%) 57.1 7.58sec 95902 81111 0 0 0 0.0% 0.0% 0.0% 0.0% 224.5 14107 29157 18588 29.8% 0.0% 83.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.14 57.14 224.49 224.49 1.1824 1.6912 4172824.44 4172824.44 0.00 12252.69 81110.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.14 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 157.7 70.23% 14106.98 12783 19677 14105.42 13406 14651 2224053 2224053 0.00
crit 66.8 29.77% 29157.46 26333 40534 29153.77 27629 30820 1948772 1948772 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2899 3.6% 70.1 6.15sec 18647 0 14168 29301 18657 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.08 70.05 0.00 0.00 0.0000 0.0000 1306861.79 1306861.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.27 70.33% 14167.60 12783 19677 14166.70 13332 15024 697993 697993 0.00
crit 20.78 29.67% 29301.17 26333 40534 29301.53 27191 32136 608869 608869 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 2.03 0.00 0.00 1.2158 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3524 4.3% 75.6 5.72sec 21018 0 17667 35551 21242 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.62 74.83 0.00 0.00 0.0000 0.0000 1589490.63 1589490.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.87 80.01% 17666.65 15875 24625 17664.85 16818 18487 1057659 1057659 0.00
crit 14.96 19.99% 35550.96 31750 49250 35550.65 31996 41066 531832 531832 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 6835 (8976) 8.4% (11.0%) 26.8 16.02sec 150604 126835 0 0 0 0.0% 0.0% 0.0% 0.0% 159.7 15900 32912 19270 19.8% 0.0% 78.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.84 26.84 159.73 159.73 1.1874 2.2287 3078122.79 3078122.79 0.00 10421.65 126835.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 26.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.1 80.19% 15900.33 14287 22306 15899.22 15175 16676 2036676 2036676 0.00
crit 31.6 19.81% 32911.58 29431 45950 32908.58 30691 35874 1041446 1041446 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2141 2.6% 49.9 8.36sec 19334 0 15942 33041 19343 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.87 49.84 0.00 0.00 0.0000 0.0000 964112.40 964112.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.93 80.11% 15942.38 14287 22306 15939.53 15063 17366 636587 636587 0.00
crit 9.91 19.89% 33041.02 29431 45950 33038.50 29431 38890 327525 327525 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46600 / 3710
melee 46600 4.5% 31.4 12.72sec 52745 51925 45913 92650 52746 20.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.44 31.44 0.00 0.00 1.0158 0.0000 1658524.12 1658524.12 0.00 51924.61 51924.61
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.46 55.52% 45912.80 36329 55931 45927.89 40962 52859 801558 801558 0.00
crit 6.44 20.47% 92649.51 72658 111863 92579.18 0 111863 596250 596250 0.00
glance 7.55 24.01% 34531.00 27247 41949 34533.22 0 41949 260716 260716 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 6.0 74.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.99 5.99 0.00 0.00 1.1956 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 8.99% 12.00%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:8.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 109.5sec 109.5sec 19.86% 19.86%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:19.86%

    Trigger Attempt Success

    • trigger_pct:16.60%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.11% 10.11%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.11%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 8.8 36.4sec 20.8sec 43.72% 44.17%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.72%

    Trigger Attempt Success

    • trigger_pct:2.60%
light_of_the_cosmos 9.3 0.0 49.9sec 49.9sec 40.53% 40.53%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00
  • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:40.53%

    Trigger Attempt Success

    • trigger_pct:15.02%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 8.2 0.0 9.6sec 9.6sec 10.34% 39.64%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:10.34%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.56% 3.56%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.56%
twist_of_fate 1.0 84.9 0.0sec 0.9sec 16.45% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.17% 14.17%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.17%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 6.0 0.0 74.9sec 74.9sec 83.40% 77.60%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.67% 5.67%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.67%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no4PT14
devouring_plague Shadow Orb 15.9 47.6 3.0 3.0 123069.4
halo Mana 9.8 395467.9 40500.0 40498.8 3.4
mind_blast Mana 37.6 338407.2 9000.0 8999.9 12.3
mind_flay Mana 108.9 326551.7 3000.0 3000.0 26.8
shadow_word_death Mana 13.7 106671.6 7800.0 7800.0 16.0
shadow_word_insanity Mana 12.9 97104.0 7500.0 7499.9 22.0
shadow_word_pain Mana 57.1 754199.4 13200.0 13199.6 7.3
vampiric_touch Mana 26.8 241551.4 9000.0 8999.6 16.7
Resource Gains Type Count Total Average Overflow
dispersion Mana 6.95 125161.92 (6.30%) 18000.00 0.00 0.00%
shadowfiend Mana 31.44 252174.62 (12.70%) 8019.76 30822.82 10.89%
Shadow Orbs from Mind Blast Shadow Orb 37.60 37.60 (82.09%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 8.20 8.20 (17.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 153.97 0.00 (-nan%) 0.00 2138126.90 100.00%
Vampiric Touch Mana Mana 209.57 1076639.90 (54.23%) 5137.40 31251.94 2.82%
mp5_regen Mana 1808.89 531466.99 (26.77%) 293.81 11199.89 2.06%
Resource RPS-Gain RPS-Loss
Mana 4389.20 4996.05
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 25472.11 0.00 223500.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.1%
shadowfiend-Mana Cap 2.1%
lightwell-Mana Cap 2.1%

Procs

Count Interval
Shadowy Recall Extra Tick 227.7 2.0sec
Shadowy Apparition Procced 75.6 5.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no4PT14 Damage Per Second
Count 49992
Mean 81520.42
Minimum 62309.52
Maximum 92974.04
Spread ( max - min ) 30664.52
Range [ ( max - min ) / 2 * 100% ] 18.81%
Standard Deviation 5107.0274
5th Percentile 72114.72
95th Percentile 88181.86
( 95th Percentile - 5th Percentile ) 16067.15
Mean Distribution
Standard Deviation 22.8411
95.00% Confidence Intervall ( 81475.65 - 81565.18 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 150
0.1% Error 15076
0.1 Scale Factor Error with Delta=300 222648
0.05 Scale Factor Error with Delta=300 890594
0.01 Scale Factor Error with Delta=300 22264863
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 81520.42
Distribution Chart

Damage

Sample Data
Count 49992
Mean 35089801.60
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 451.38
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.03 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.02 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 13.68 shadow_word_death,if=active_enemies<=5
F 42.25 mind_blast,if=active_enemies<=6&cooldown_react
G 17.89 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 27.11 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 12.95 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 9.76 halo,if=talent.halo.enabled
M 11.86 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 136.17 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 80.00 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 52.35 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 39.24 shadow_word_pain,moving=1
X 1.12 dispersion

Sample Sequence

DGLWFHTFTHTIFGTWWWWWFHMTLFTHTIFGTWWWFHTQFMTHTIGFLTWWWWFHTQFTHIGQFMTGWWFHLTQFTHTIFGTWWWWFHMTFTHIGFLTBWWFHTFMTHIGTFTWWWWHFLTFMHIGTQFTGWWFHTQFMTHLIGQQQQQQFTWWQQQQQQQQFTQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQFMXGFHLWWHTFTTFHIGMTFTWWWWHTFTLTFMHITGFTGBWHFTQFDEEHIGLFTEDEWWHFTPEETTFDEEHITQFX9EDEGFHTEETFMLTEETQQQQQQQQQQQQQQQQQQQQQQQQQQF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 348 - 558 ( 452.3 )

Performance:

Total Events Processed: 2136990112
Max Event Queue: 300
Sim Seconds: 22617391
CPU Seconds: 6209.6500
Speed Up: 3642

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Standard Deviation 58.1608
5th Percentile 368.18
95th Percentile 546.32
( 95th Percentile - 5th Percentile ) 178.15
Mean Distribution
Standard Deviation 0.2601
95.00% Confidence Intervall ( 451.84 - 452.86 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 635
0.1% Error 63505
0.1 Scale Factor Error with Delta=300 28
0.05 Scale Factor Error with Delta=300 115
0.01 Scale Factor Error with Delta=300 2887
Distribution Chart
Timeline Distribution Chart Gear Chart Raid Downtime Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague 2944 2680646 5926 2.61 112275 232358 19.7 19.7 19.8% 0.0% 0.0% 0.0% 23.67sec 2680646 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_mastery 124467 1047499 2316 6.17 18586 38495 46.6 46.5 19.7% 0.0% 0.0% 0.0% 9.16sec 1047499 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_tick ticks -2944 3350662 7446 19.86 18548 38397 19.7 149.0 19.9% 0.0% 0.0% 0.0% 23.67sec 3350662 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.8% 0.0% 0.0% 0.0% 41.62sec 0 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_damage 120696 1524697 3371 1.49 112028 231808 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.62sec 1524697 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_heal 120696 0 0 32.12 0 0 11.2 242.1 22.9% 0.0% 0.0% 0.0% 41.62sec 47156882 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_blast 8092 5396501 11930 6.57 89826 186031 49.5 49.5 19.8% 0.0% 0.0% 0.0% 9.07sec 5396501 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay ticks -15407 6070458 13490 27.85 23948 49622 106.6 208.9 19.9% 0.0% 0.0% 0.0% 4.15sec 6070458 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay_mastery 124468 1897564 4195 8.66 23960 49658 65.3 65.3 19.9% 0.0% 0.0% 0.0% 6.66sec 1897564 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_spike 73510 3125509 6910 4.53 75557 156405 34.1 34.1 19.8% 0.0% 0.0% 0.0% 12.65sec 3125509 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_death 32379 1675121 3703 2.03 89875 186495 15.3 15.3 20.1% 0.0% 0.0% 0.0% 4.96sec 1675121 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain ticks -589 4088240 9085 32.29 13930 28821 50.9 242.1 19.8% 0.0% 0.0% 0.0% 8.85sec 4088240 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain_mastery 124464 1279824 2829 10.04 13949 28883 75.8 75.7 19.8% 0.0% 0.0% 0.0% 5.89sec 1279824 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.91sec 0 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowy_apparition 87532 1218870 2695 7.73 17413 34992 59.2 58.3 19.9% 0.0% 0.0% 0.0% 7.52sec 1218870 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch ticks -34914 3364662 7477 23.61 15673 32460 30.0 177.1 19.8% 0.0% 0.0% 0.0% 15.04sec 3364662 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch_mastery 124465 1057041 2337 7.36 15700 32523 55.5 55.5 19.9% 0.0% 0.0% 0.0% 7.90sec 1057041 452.35sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend melee 0 1651085 46398 52.89 45920 92772 31.4 31.4 20.2% 0.0% 24.1% 0.0% 12.74sec 1651085 35.59sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.91sec 0 35.59sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague 2944 2679001 5922 2.61 112284 232344 19.7 19.7 19.8% 0.0% 0.0% 0.0% 23.70sec 2679001 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_mastery 124467 1044995 2310 6.15 18588 38450 46.5 46.4 19.8% 0.0% 0.0% 0.0% 9.19sec 1044995 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_tick ticks -2944 3347613 7439 19.85 18549 38402 19.7 148.8 19.9% 0.0% 0.0% 0.0% 23.70sec 3347613 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.8% 0.0% 0.0% 0.0% 41.62sec 0 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_damage 120696 1528655 3379 1.49 112023 231657 11.2 11.2 20.2% 0.0% 0.0% 0.0% 41.62sec 1528655 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_heal 120696 0 0 32.11 0 0 11.2 242.1 22.9% 0.0% 0.0% 0.0% 41.62sec 47116672 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_blast 8092 5394828 11926 6.57 89849 185938 49.5 49.5 19.9% 0.0% 0.0% 0.0% 9.08sec 5394828 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay ticks -15407 6075381 13501 27.87 23948 49620 106.7 209.0 19.9% 0.0% 0.0% 0.0% 4.14sec 6075381 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay_mastery 124468 1902324 4205 8.68 23961 49641 65.5 65.5 19.9% 0.0% 0.0% 0.0% 6.64sec 1902324 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_spike 73510 3123661 6905 4.52 75515 156407 34.1 34.1 19.9% 0.0% 0.0% 0.0% 12.65sec 3123661 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_death 32379 1676067 3705 2.03 89880 186281 15.3 15.3 20.1% 0.0% 0.0% 0.0% 4.95sec 1676067 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain ticks -589 4445286 9878 32.28 13924 28787 50.8 242.1 29.8% 0.0% 0.0% 0.0% 8.86sec 4445286 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain_mastery 124464 1392532 3078 10.04 13944 28837 75.7 75.7 29.9% 0.0% 0.0% 0.0% 5.89sec 1392532 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowy_apparition 87532 1690112 3736 10.73 17399 34985 82.2 80.9 19.8% 0.0% 0.0% 0.0% 5.44sec 1690112 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch ticks -34914 3363115 7474 23.61 15676 32445 30.0 177.1 19.8% 0.0% 0.0% 0.0% 15.04sec 3363115 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch_mastery 124465 1054890 2332 7.35 15697 32506 55.4 55.4 19.9% 0.0% 0.0% 0.0% 7.91sec 1054890 452.35sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend melee 0 1651204 46411 52.88 45891 92701 31.4 31.4 20.3% 0.0% 24.1% 0.0% 12.75sec 1651204 35.58sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.90sec 0 35.58sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague 2944 2585779 5716 2.51 112377 232689 18.9 18.9 20.0% 0.0% 0.0% 0.0% 24.68sec 2585779 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_mastery 124467 1004305 2220 5.91 18604 38518 44.6 44.5 19.8% 0.0% 0.0% 0.0% 9.55sec 1004305 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_tick ticks -2944 3207611 7128 19.02 18566 38434 18.9 142.6 19.8% 0.0% 0.0% 0.0% 24.68sec 3207611 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 20.2% 0.0% 0.0% 0.0% 41.58sec 0 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_damage 120696 1532411 3388 1.50 111982 231558 11.3 11.3 20.0% 0.0% 0.0% 0.0% 41.58sec 1532411 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_heal 120696 0 0 32.30 0 0 11.3 243.5 22.9% 0.0% 0.0% 0.0% 41.58sec 47375561 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_blast 8092 5155141 11396 6.27 89840 186133 47.3 47.3 19.9% 0.0% 0.0% 0.0% 9.52sec 5155141 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay ticks -15407 7204712 16010 33.06 23943 49614 123.5 248.0 19.9% 0.0% 0.0% 0.0% 3.59sec 7204712 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay_mastery 124468 2255401 4986 10.28 23960 49636 77.5 77.5 20.0% 0.0% 0.0% 0.0% 5.64sec 2255401 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.84sec 0 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_death 32379 1675963 3705 2.03 89900 186345 15.3 15.3 20.2% 0.0% 0.0% 0.0% 4.96sec 1675963 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain ticks -589 4177069 9282 33.00 13929 28822 55.8 247.5 19.8% 0.0% 0.0% 0.0% 8.07sec 4177069 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain_mastery 124464 1308256 2892 10.26 13948 28880 77.5 77.4 19.8% 0.0% 0.0% 0.0% 5.77sec 1308256 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadowy_apparition 87532 1235254 2731 7.84 17411 35012 60.1 59.1 19.8% 0.0% 0.0% 0.0% 7.41sec 1235254 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch ticks -34914 3357082 7460 23.56 15673 32446 30.0 176.7 19.8% 0.0% 0.0% 0.0% 15.08sec 3357082 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch_mastery 124465 1051059 2324 7.33 15698 32533 55.3 55.3 19.7% 0.0% 0.0% 0.0% 7.94sec 1051059 452.35sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender melee 0 4384120 37517 54.09 36384 73258 105.3 105.3 20.1% 0.0% 24.0% 0.0% 4.18sec 4384120 116.86sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.31sec 0 116.86sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague 2944 2583134 5711 2.51 112363 232777 18.9 18.9 19.9% 0.0% 0.0% 0.0% 24.67sec 2583134 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_mastery 124467 1007562 2227 5.92 18611 38507 44.7 44.7 19.9% 0.0% 0.0% 0.0% 9.53sec 1007562 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_tick ticks -2944 3210042 7133 19.02 18563 38421 18.9 142.7 19.8% 0.0% 0.0% 0.0% 24.67sec 3210042 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 20.0% 0.0% 0.0% 0.0% 41.58sec 0 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_damage 120696 1530766 3384 1.50 111973 231627 11.3 11.3 19.9% 0.0% 0.0% 0.0% 41.58sec 1530766 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_heal 120696 0 0 32.30 0 0 11.3 243.5 22.9% 0.0% 0.0% 0.0% 41.58sec 47398565 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_blast 8092 5149867 11385 6.27 89854 186018 47.3 47.3 19.8% 0.0% 0.0% 0.0% 9.52sec 5149867 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay ticks -15407 7198965 15998 33.04 23943 49618 123.4 247.8 19.9% 0.0% 0.0% 0.0% 3.59sec 7198965 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay_mastery 124468 2251575 4978 10.27 23955 49645 77.5 77.4 19.9% 0.0% 0.0% 0.0% 5.64sec 2251575 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.84sec 0 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_death 32379 1672299 3697 2.03 89918 186201 15.3 15.3 20.1% 0.0% 0.0% 0.0% 4.96sec 1672299 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain ticks -589 4540082 10089 33.01 13928 28784 55.9 247.5 29.7% 0.0% 0.0% 0.0% 8.06sec 4540082 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain_mastery 124464 1428761 3159 10.29 13947 28842 77.6 77.6 30.0% 0.0% 0.0% 0.0% 5.75sec 1428761 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadowy_apparition 87532 1710486 3781 10.86 17402 34998 83.2 81.9 19.9% 0.0% 0.0% 0.0% 5.38sec 1710486 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch ticks -34914 3355997 7458 23.56 15673 32457 30.0 176.7 19.8% 0.0% 0.0% 0.0% 15.08sec 3355997 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch_mastery 124465 1049103 2319 7.31 15695 32508 55.2 55.1 19.8% 0.0% 0.0% 0.0% 7.96sec 1049103 452.35sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender melee 0 4385281 37528 54.09 36383 73308 105.3 105.3 20.1% 0.0% 24.1% 0.0% 4.18sec 4385281 116.85sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.31sec 0 116.85sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague 2944 2530582 5594 2.47 112245 232178 18.6 18.6 19.9% 0.0% 0.0% 0.0% 25.12sec 2530582 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_mastery 124467 984311 2176 5.80 18587 38466 43.8 43.7 19.8% 0.0% 0.0% 0.0% 9.72sec 984311 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_tick ticks -2944 3149123 6998 18.69 18537 38356 18.6 140.2 19.8% 0.0% 0.0% 0.0% 25.12sec 3149123 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 dispersion 47585 0 0 0.06 0 0 0.5 0.5 0.0% 0.0% 0.0% 0.0% 160.55sec 0 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo 120644 0 0 1.38 0 0 10.4 10.4 19.7% 0.0% 0.0% 0.0% 43.11sec 0 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_damage 120696 1406354 3109 1.38 111837 231311 10.4 10.4 19.7% 0.0% 0.0% 0.0% 43.11sec 1406354 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_heal 120696 0 0 29.79 0 0 10.4 224.6 22.9% 0.0% 0.0% 0.0% 43.11sec 43709458 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_blast 8092 5001922 11058 6.11 89716 185801 46.1 46.1 19.6% 0.0% 0.0% 0.0% 9.61sec 5001922 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay ticks -15407 6639204 14754 30.48 23930 49605 112.7 228.6 19.9% 0.0% 0.0% 0.0% 3.85sec 6639204 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay_mastery 124468 2077749 4593 9.49 23950 49635 71.5 71.5 19.9% 0.0% 0.0% 0.0% 5.97sec 2077749 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_death 32379 1562264 3454 1.90 89649 185702 14.3 14.3 20.1% 0.0% 0.0% 0.0% 5.30sec 1562264 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_insanity 129249 2044609 4520 1.67 134118 277456 12.6 12.6 19.6% 0.0% 0.0% 0.0% 33.66sec 2044609 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain ticks -589 3883327 8630 30.71 13908 28783 56.4 230.4 19.8% 0.0% 0.0% 0.0% 7.81sec 3883327 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain_mastery 124464 1216510 2689 9.55 13932 28848 72.1 72.0 19.8% 0.0% 0.0% 0.0% 6.08sec 1216510 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.85sec 0 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowy_apparition 87532 1159198 2563 7.36 17396 34979 56.2 55.5 19.9% 0.0% 0.0% 0.0% 7.77sec 1159198 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch ticks -34914 3246020 7213 22.79 15662 32423 28.8 170.9 19.9% 0.0% 0.0% 0.0% 15.28sec 3246020 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch_mastery 124465 1014262 2242 7.08 15678 32481 53.4 53.4 19.7% 0.0% 0.0% 0.0% 7.99sec 1014262 452.35sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend melee 0 1654187 46461 52.90 45906 92696 31.4 31.4 20.4% 0.0% 24.0% 0.0% 12.74sec 1654187 35.60sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.88sec 0 35.60sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague 2944 2525962 5584 2.46 112220 232058 18.6 18.6 19.9% 0.0% 0.0% 0.0% 25.19sec 2525962 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_mastery 124467 983153 2173 5.79 18575 38449 43.7 43.7 19.8% 0.0% 0.0% 0.0% 9.72sec 983153 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_tick ticks -2944 3136000 6969 18.63 18528 38364 18.6 139.7 19.7% 0.0% 0.0% 0.0% 25.19sec 3136000 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 dispersion 47585 0 0 0.06 0 0 0.5 0.5 0.0% 0.0% 0.0% 0.0% 156.63sec 0 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo 120644 0 0 1.38 0 0 10.4 10.4 19.8% 0.0% 0.0% 0.0% 43.11sec 0 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_damage 120696 1405448 3107 1.38 111835 231214 10.4 10.4 19.7% 0.0% 0.0% 0.0% 43.11sec 1405448 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_heal 120696 0 0 29.81 0 0 10.4 224.7 22.8% 0.0% 0.0% 0.0% 43.11sec 43687870 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_blast 8092 4999113 11051 6.09 89698 185744 45.9 45.9 19.9% 0.0% 0.0% 0.0% 9.64sec 4999113 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay ticks -15407 6635864 14746 30.48 23932 49598 112.7 228.6 19.9% 0.0% 0.0% 0.0% 3.85sec 6635864 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay_mastery 124468 2075300 4588 9.46 23951 49629 71.4 71.3 20.0% 0.0% 0.0% 0.0% 5.98sec 2075300 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_death 32379 1561919 3453 1.90 89646 185628 14.3 14.3 20.3% 0.0% 0.0% 0.0% 5.30sec 1561919 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_insanity 129249 2050186 4532 1.67 134051 277407 12.6 12.6 19.9% 0.0% 0.0% 0.0% 33.64sec 2050186 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain ticks -589 4222392 9383 30.71 13907 28752 56.5 230.3 29.8% 0.0% 0.0% 0.0% 7.81sec 4222392 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain_mastery 124464 1321635 2922 9.56 13931 28816 72.1 72.0 29.7% 0.0% 0.0% 0.0% 6.08sec 1321635 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.84sec 0 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowy_apparition 87532 1607936 3555 10.22 17391 34937 78.0 77.0 19.9% 0.0% 0.0% 0.0% 5.64sec 1607936 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch ticks -34914 3244557 7210 22.78 15662 32423 28.8 170.8 19.9% 0.0% 0.0% 0.0% 15.29sec 3244557 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch_mastery 124465 1017586 2250 7.10 15676 32466 53.5 53.5 19.9% 0.0% 0.0% 0.0% 7.97sec 1017586 452.35sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend melee 0 1650482 46353 52.88 45888 92587 31.4 31.4 20.3% 0.0% 24.2% 0.0% 12.75sec 1650482 35.61sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.89sec 0 35.61sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague 2944 2353748 5203 2.29 112483 232718 17.2 17.2 20.1% 0.0% 0.0% 0.0% 27.37sec 2353748 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_mastery 124467 924490 2044 5.43 18618 38522 41.0 41.0 19.9% 0.0% 0.0% 0.0% 10.37sec 924490 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_tick ticks -2944 2944147 6543 17.45 18557 38417 17.2 130.9 19.8% 0.0% 0.0% 0.0% 27.37sec 2944147 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.50sec 0 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_damage 120696 1537577 3399 1.50 112058 232215 11.3 11.3 20.0% 0.0% 0.0% 0.0% 41.50sec 1537577 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_heal 120696 0 0 32.57 0 0 11.3 245.6 22.9% 0.0% 0.0% 0.0% 41.50sec 47854136 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_blast 8092 4584223 10134 5.57 89921 186232 42.0 42.0 19.9% 0.0% 0.0% 0.0% 10.74sec 4584223 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay ticks -15407 6854114 15231 31.31 24040 49841 114.8 234.8 20.0% 0.0% 0.0% 0.0% 3.86sec 6854114 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay_mastery 124468 2145309 4743 9.74 24044 49862 73.5 73.5 20.0% 0.0% 0.0% 0.0% 5.96sec 2145309 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_spike 73510 3362962 7434 4.86 75696 156913 36.6 36.6 19.9% 0.0% 0.0% 0.0% 11.87sec 3362962 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.07sec 0 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_death 32379 1696228 3750 2.05 89936 186340 15.5 15.5 20.3% 0.0% 0.0% 0.0% 4.90sec 1696228 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain ticks -589 4283515 9519 33.81 13936 28836 53.6 253.6 19.8% 0.0% 0.0% 0.0% 8.40sec 4283515 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain_mastery 124464 1343133 2969 10.51 13971 28938 79.3 79.3 19.9% 0.0% 0.0% 0.0% 5.64sec 1343133 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowy_apparition 87532 1271333 2811 8.05 17446 35068 61.7 60.7 19.9% 0.0% 0.0% 0.0% 7.24sec 1271333 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch ticks -34914 3607027 8016 25.28 15695 32502 30.0 189.6 19.8% 0.0% 0.0% 0.0% 15.09sec 3607027 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch_mastery 124465 1130188 2498 7.86 15734 32596 59.3 59.3 19.8% 0.0% 0.0% 0.0% 7.43sec 1130188 452.35sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend melee 0 1656538 46566 52.87 46024 92923 31.3 31.3 20.4% 0.0% 24.0% 0.0% 12.75sec 1656538 35.57sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.92sec 0 35.57sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague 2944 2349552 5194 2.28 112469 232774 17.2 17.2 19.9% 0.0% 0.0% 0.0% 27.38sec 2349552 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_mastery 124467 922278 2039 5.42 18602 38502 40.9 40.9 19.9% 0.0% 0.0% 0.0% 10.39sec 922278 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_tick ticks -2944 2943708 6542 17.46 18557 38411 17.2 130.9 19.8% 0.0% 0.0% 0.0% 27.38sec 2943708 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 19.9% 0.0% 0.0% 0.0% 41.49sec 0 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_damage 120696 1533895 3391 1.50 112114 231649 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.49sec 1533895 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_heal 120696 0 0 32.56 0 0 11.3 245.5 22.9% 0.0% 0.0% 0.0% 41.49sec 47835498 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_blast 8092 4584021 10134 5.57 89926 186299 42.0 42.0 19.9% 0.0% 0.0% 0.0% 10.75sec 4584021 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay ticks -15407 6861768 15248 31.34 24039 49828 114.9 235.1 20.0% 0.0% 0.0% 0.0% 3.86sec 6861768 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay_mastery 124468 2145657 4743 9.75 24046 49832 73.5 73.5 19.9% 0.0% 0.0% 0.0% 5.95sec 2145657 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_spike 73510 3353927 7414 4.85 75706 156840 36.5 36.5 19.9% 0.0% 0.0% 0.0% 11.90sec 3353927 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.07sec 0 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_death 32379 1696307 3750 2.06 89939 186448 15.5 15.5 20.2% 0.0% 0.0% 0.0% 4.90sec 1696307 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain ticks -589 4654900 10344 33.81 13932 28799 53.6 253.6 29.7% 0.0% 0.0% 0.0% 8.41sec 4654900 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain_mastery 124464 1458321 3224 10.51 13969 28893 79.3 79.2 29.7% 0.0% 0.0% 0.0% 5.64sec 1458321 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.91sec 0 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowy_apparition 87532 1749123 3867 11.08 17432 35045 84.9 83.5 19.9% 0.0% 0.0% 0.0% 5.28sec 1749123 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch ticks -34914 3608249 8018 25.28 15696 32518 30.0 189.6 19.8% 0.0% 0.0% 0.0% 15.09sec 3608249 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch_mastery 124465 1131472 2501 7.85 15732 32593 59.2 59.2 20.1% 0.0% 0.0% 0.0% 7.44sec 1131472 452.35sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend melee 0 1656232 46554 52.87 46022 92957 31.3 31.3 20.4% 0.0% 24.1% 0.0% 12.75sec 1656232 35.58sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.93sec 0 35.58sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague 2944 2252396 4979 2.19 112648 233269 16.5 16.5 19.9% 0.0% 0.0% 0.0% 28.54sec 2252396 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_mastery 124467 874613 1933 5.14 18602 38504 38.8 38.8 19.9% 0.0% 0.0% 0.0% 10.88sec 874613 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_tick ticks -2944 2790610 6201 16.51 18582 38480 16.5 123.8 19.9% 0.0% 0.0% 0.0% 28.54sec 2790610 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 19.7% 0.0% 0.0% 0.0% 41.44sec 0 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_damage 120696 1538301 3401 1.50 112066 231817 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.44sec 1538301 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_heal 120696 0 0 32.87 0 0 11.3 247.8 22.9% 0.0% 0.0% 0.0% 41.44sec 48265845 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_blast 8092 4339004 9592 5.28 89947 186292 39.8 39.8 19.8% 0.0% 0.0% 0.0% 11.36sec 4339004 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay ticks -15407 8084131 17965 36.93 24039 49826 130.8 277.0 20.0% 0.0% 0.0% 0.0% 3.40sec 8084131 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay_mastery 124468 2531499 5596 11.50 24052 49830 86.8 86.7 19.9% 0.0% 0.0% 0.0% 5.06sec 2531499 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 7.0 7.0 0.0% 0.0% 0.0% 0.0% 60.69sec 0 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.06sec 0 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_death 32379 1687704 3731 2.05 89980 186588 15.4 15.4 20.1% 0.0% 0.0% 0.0% 4.92sec 1687704 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain ticks -589 4398991 9776 34.71 13932 28831 59.9 260.4 19.9% 0.0% 0.0% 0.0% 7.52sec 4398991 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain_mastery 124464 1380698 3052 10.81 13973 28931 81.5 81.5 19.9% 0.0% 0.0% 0.0% 5.48sec 1380698 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadowy_apparition 87532 1297431 2868 8.22 17445 35073 63.0 62.0 19.8% 0.0% 0.0% 0.0% 7.09sec 1297431 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch ticks -34914 3588337 7974 25.13 15693 32506 30.0 188.4 19.9% 0.0% 0.0% 0.0% 15.12sec 3588337 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch_mastery 124465 1124901 2487 7.81 15738 32608 58.9 58.9 20.0% 0.0% 0.0% 0.0% 7.48sec 1124901 452.35sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender melee 0 4407959 37638 54.05 36475 73421 105.5 105.5 20.2% 0.0% 24.0% 0.0% 4.18sec 4407959 117.11sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.04 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.28sec 0 117.11sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague 2944 2251885 4978 2.18 112632 233250 16.5 16.5 20.0% 0.0% 0.0% 0.0% 28.55sec 2251885 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_mastery 124467 869362 1922 5.11 18605 38510 38.6 38.5 19.8% 0.0% 0.0% 0.0% 10.94sec 869362 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_tick ticks -2944 2787499 6194 16.50 18579 38457 16.5 123.8 19.8% 0.0% 0.0% 0.0% 28.55sec 2787499 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo 120644 0 0 1.50 0 0 11.3 11.3 19.5% 0.0% 0.0% 0.0% 41.43sec 0 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_damage 120696 1537587 3399 1.50 112083 231836 11.3 11.3 19.7% 0.0% 0.0% 0.0% 41.43sec 1537587 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_heal 120696 0 0 32.87 0 0 11.3 247.8 22.9% 0.0% 0.0% 0.0% 41.43sec 48277774 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_blast 8092 4341081 9597 5.28 89953 186251 39.8 39.8 19.9% 0.0% 0.0% 0.0% 11.36sec 4341081 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay ticks -15407 8084869 17966 36.94 24037 49827 130.7 277.0 20.0% 0.0% 0.0% 0.0% 3.40sec 8084869 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay_mastery 124468 2533204 5600 11.50 24045 49860 86.8 86.7 20.0% 0.0% 0.0% 0.0% 5.06sec 2533204 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 7.0 7.0 0.0% 0.0% 0.0% 0.0% 60.70sec 0 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.07sec 0 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_death 32379 1687848 3731 2.05 90015 186542 15.4 15.4 20.1% 0.0% 0.0% 0.0% 4.92sec 1687848 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain ticks -589 4779480 10621 34.71 13934 28795 59.9 260.3 29.8% 0.0% 0.0% 0.0% 7.51sec 4779480 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain_mastery 124464 1502828 3322 10.81 13972 28892 81.6 81.5 29.9% 0.0% 0.0% 0.0% 5.48sec 1502828 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadowy_apparition 87532 1778313 3931 11.27 17432 35064 86.4 85.0 19.8% 0.0% 0.0% 0.0% 5.19sec 1778313 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch ticks -34914 3590533 7979 25.14 15699 32504 29.9 188.5 19.9% 0.0% 0.0% 0.0% 15.12sec 3590533 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch_mastery 124465 1126386 2490 7.82 15740 32622 59.0 58.9 20.0% 0.0% 0.0% 0.0% 7.47sec 1126386 452.35sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender melee 0 4402003 37593 54.06 36473 73495 105.5 105.5 20.1% 0.0% 24.0% 0.0% 4.18sec 4402003 117.10sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.04 0 0 23.5 23.5 0.0% 0.0% 0.0% 0.0% 19.29sec 0 117.10sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague 2944 2183286 4827 2.12 112538 232897 16.0 16.0 20.0% 0.0% 0.0% 0.0% 29.46sec 2183286 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_mastery 124467 847652 1874 4.99 18589 38489 37.7 37.6 19.8% 0.0% 0.0% 0.0% 11.19sec 847652 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_tick ticks -2944 2704583 6010 16.03 18558 38419 16.0 120.2 19.8% 0.0% 0.0% 0.0% 29.46sec 2704583 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 dispersion 47585 0 0 0.07 0 0 0.5 0.5 0.0% 0.0% 0.0% 0.0% 149.55sec 0 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo 120644 0 0 1.40 0 0 10.5 10.5 19.9% 0.0% 0.0% 0.0% 42.91sec 0 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_damage 120696 1429275 3160 1.40 111952 231385 10.5 10.5 19.7% 0.0% 0.0% 0.0% 42.91sec 1429275 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_heal 120696 0 0 30.39 0 0 10.5 229.1 22.8% 0.0% 0.0% 0.0% 42.91sec 44588134 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_blast 8092 4190452 9264 5.10 89836 185943 38.4 38.4 19.9% 0.0% 0.0% 0.0% 11.67sec 4190452 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay ticks -15407 7543827 16764 34.46 24034 49820 119.8 258.4 20.0% 0.0% 0.0% 0.0% 3.65sec 7543827 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay_mastery 124468 2361872 5221 10.73 24042 49861 80.9 80.9 20.0% 0.0% 0.0% 0.0% 5.33sec 2361872 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.01sec 0 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_death 32379 1590564 3516 1.93 89709 185958 14.5 14.5 20.4% 0.0% 0.0% 0.0% 5.22sec 1590564 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_insanity 129249 2010756 4445 1.64 134216 277360 12.4 12.4 19.8% 0.0% 0.0% 0.0% 34.67sec 2010756 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain ticks -589 4142831 9206 32.75 13918 28796 61.4 245.6 19.8% 0.0% 0.0% 0.0% 7.22sec 4142831 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain_mastery 124464 1298867 2871 10.18 13957 28897 76.8 76.7 19.9% 0.0% 0.0% 0.0% 5.75sec 1298867 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowy_apparition 87532 1227979 2715 7.78 17422 35049 59.5 58.7 19.9% 0.0% 0.0% 0.0% 7.41sec 1227979 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch ticks -34914 3506679 7793 24.56 15691 32489 28.9 184.2 19.9% 0.0% 0.0% 0.0% 15.35sec 3506679 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch_mastery 124465 1098332 2428 7.64 15713 32554 57.7 57.6 19.9% 0.0% 0.0% 0.0% 7.49sec 1098332 452.35sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend melee 0 1657739 46580 52.87 46048 92948 31.4 31.4 20.4% 0.0% 23.9% 0.0% 12.75sec 1657739 35.59sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.90sec 0 35.59sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague 2944 2181474 4823 2.12 112539 233135 16.0 16.0 19.7% 0.0% 0.0% 0.0% 29.45sec 2181474 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_mastery 124467 848587 1876 4.99 18593 38492 37.7 37.6 19.9% 0.0% 0.0% 0.0% 11.20sec 848587 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_tick ticks -2944 2703179 6007 16.03 18566 38405 16.0 120.2 19.8% 0.0% 0.0% 0.0% 29.45sec 2703179 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 dispersion 47585 0 0 0.06 0 0 0.5 0.5 0.0% 0.0% 0.0% 0.0% 148.63sec 0 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo 120644 0 0 1.40 0 0 10.6 10.6 19.8% 0.0% 0.0% 0.0% 42.89sec 0 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_damage 120696 1432497 3167 1.40 112010 231376 10.6 10.6 19.8% 0.0% 0.0% 0.0% 42.89sec 1432497 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_heal 120696 0 0 30.43 0 0 10.6 229.4 22.9% 0.0% 0.0% 0.0% 42.89sec 44694102 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_blast 8092 4192461 9268 5.10 89836 186018 38.5 38.5 19.9% 0.0% 0.0% 0.0% 11.66sec 4192461 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay ticks -15407 7543657 16764 34.47 24035 49825 119.9 258.5 20.0% 0.0% 0.0% 0.0% 3.65sec 7543657 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay_mastery 124468 2359316 5216 10.71 24051 49840 80.8 80.8 20.0% 0.0% 0.0% 0.0% 5.35sec 2359316 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.02sec 0 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_death 32379 1590331 3516 1.93 89706 185993 14.6 14.6 20.3% 0.0% 0.0% 0.0% 5.21sec 1590331 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_insanity 129249 2022677 4472 1.65 134197 277650 12.4 12.4 19.9% 0.0% 0.0% 0.0% 34.54sec 2022677 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain ticks -589 4505659 10013 32.75 13915 28765 61.4 245.6 29.8% 0.0% 0.0% 0.0% 7.22sec 4505659 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain_mastery 124464 1413683 3125 10.18 13951 28858 76.8 76.8 30.0% 0.0% 0.0% 0.0% 5.75sec 1413683 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowy_apparition 87532 1688992 3734 10.72 17412 35012 81.9 80.8 19.8% 0.0% 0.0% 0.0% 5.41sec 1688992 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch ticks -34914 3507108 7794 24.57 15695 32496 28.9 184.3 19.9% 0.0% 0.0% 0.0% 15.35sec 3507108 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch_mastery 124465 1100076 2432 7.66 15712 32580 57.8 57.7 19.8% 0.0% 0.0% 0.0% 7.49sec 1100076 452.35sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend melee 0 1659076 46611 52.85 46056 93031 31.4 31.4 20.4% 0.0% 23.9% 0.0% 12.75sec 1659076 35.59sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.89sec 0 35.59sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague 2944 2404090 5315 2.25 117054 242273 17.0 17.0 19.7% 0.0% 0.0% 0.0% 27.67sec 2404090 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_mastery 124467 932430 2061 5.25 19403 40232 39.7 39.6 19.9% 0.0% 0.0% 0.0% 10.66sec 932430 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_tick ticks -2944 2969138 6598 16.90 19315 40025 17.0 126.8 19.8% 0.0% 0.0% 0.0% 27.67sec 2969138 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 dispersion 47585 0 0 0.02 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 165.05sec 0 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.8% 0.0% 0.0% 0.0% 41.80sec 0 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_damage 120696 1503262 3323 1.44 114000 236019 10.9 10.9 19.9% 0.0% 0.0% 0.0% 41.80sec 1503262 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_heal 120696 0 0 31.23 0 0 10.9 235.4 22.9% 0.0% 0.0% 0.0% 41.80sec 46629982 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_blast 8092 4572190 10108 5.45 91854 190088 41.1 41.1 19.7% 0.0% 0.0% 0.0% 10.85sec 4572190 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay ticks -15407 6420406 14268 29.13 24218 50215 109.6 218.5 19.9% 0.0% 0.0% 0.0% 3.98sec 6420406 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay_mastery 124468 2009605 4443 9.06 24233 50248 68.3 68.3 19.9% 0.0% 0.0% 0.0% 6.28sec 2009605 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_spike 73510 3144895 6952 4.46 77081 159861 33.6 33.6 19.8% 0.0% 0.0% 0.0% 12.63sec 3144895 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_death 32379 1857364 4106 1.97 102764 213106 14.9 14.9 20.0% 0.0% 0.0% 0.0% 5.11sec 1857364 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain ticks -589 4158057 9240 32.26 14178 29347 52.9 242.0 19.8% 0.0% 0.0% 0.0% 8.41sec 4158057 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain_mastery 124464 1304371 2884 10.02 14237 29496 75.6 75.6 19.8% 0.0% 0.0% 0.0% 5.84sec 1304371 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.91sec 0 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowy_apparition 87532 1239908 2741 7.71 17754 35715 59.0 58.1 19.9% 0.0% 0.0% 0.0% 7.47sec 1239908 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch ticks -34914 3361580 7470 23.18 15956 33049 29.4 173.9 19.8% 0.0% 0.0% 0.0% 15.11sec 3361580 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch_mastery 124465 1054840 2332 7.20 16028 33173 54.3 54.3 19.9% 0.0% 0.0% 0.0% 7.94sec 1054840 452.35sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend melee 0 1653286 46451 52.90 45902 92682 31.4 31.4 20.4% 0.0% 24.2% 0.0% 12.75sec 1653286 35.59sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.90sec 0 35.59sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague 2944 2409666 5327 2.25 117051 242581 17.0 17.0 20.0% 0.0% 0.0% 0.0% 27.68sec 2409666 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_mastery 124467 933072 2063 5.25 19402 40170 39.7 39.6 20.0% 0.0% 0.0% 0.0% 10.66sec 933072 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_tick ticks -2944 2966614 6592 16.89 19318 40022 17.0 126.7 19.8% 0.0% 0.0% 0.0% 27.68sec 2966614 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 dispersion 47585 0 0 0.02 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% 161.86sec 0 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 41.83sec 0 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_damage 120696 1507846 3333 1.44 114027 235986 10.9 10.9 20.1% 0.0% 0.0% 0.0% 41.83sec 1507846 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_heal 120696 0 0 31.22 0 0 10.9 235.4 22.9% 0.0% 0.0% 0.0% 41.83sec 46633933 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_blast 8092 4576324 10117 5.45 91841 190285 41.1 41.1 19.9% 0.0% 0.0% 0.0% 10.86sec 4576324 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay ticks -15407 6425320 14278 29.13 24220 50208 109.5 218.5 20.0% 0.0% 0.0% 0.0% 3.98sec 6425320 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay_mastery 124468 2012298 4449 9.07 24243 50220 68.4 68.4 19.9% 0.0% 0.0% 0.0% 6.27sec 2012298 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_spike 73510 3142837 6948 4.46 77052 159636 33.7 33.7 19.8% 0.0% 0.0% 0.0% 12.62sec 3142837 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_death 32379 1858805 4109 1.97 102798 213244 14.9 14.9 20.1% 0.0% 0.0% 0.0% 5.11sec 1858805 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain ticks -589 4522275 10050 32.27 14176 29309 52.9 242.0 29.8% 0.0% 0.0% 0.0% 8.40sec 4522275 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain_mastery 124464 1417450 3134 10.02 14236 29446 75.6 75.5 29.8% 0.0% 0.0% 0.0% 5.85sec 1417450 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.92sec 0 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowy_apparition 87532 1715858 3793 10.69 17747 35691 81.7 80.6 19.8% 0.0% 0.0% 0.0% 5.43sec 1715858 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch ticks -34914 3363860 7475 23.18 15958 33041 29.4 173.9 19.9% 0.0% 0.0% 0.0% 15.11sec 3363860 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch_mastery 124465 1057521 2338 7.22 16020 33200 54.5 54.4 19.8% 0.0% 0.0% 0.0% 7.92sec 1057521 452.35sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend melee 0 1651636 46405 52.89 45904 92678 31.4 31.4 20.3% 0.0% 24.1% 0.0% 12.75sec 1651636 35.59sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.10 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.93sec 0 35.59sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague 2944 2369641 5239 2.20 117397 243369 16.6 16.6 20.0% 0.0% 0.0% 0.0% 28.19sec 2369641 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_mastery 124467 909608 2011 5.12 19451 40317 38.6 38.6 19.8% 0.0% 0.0% 0.0% 10.91sec 909608 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_tick ticks -2944 2893987 6431 16.43 19379 40159 16.6 123.2 19.8% 0.0% 0.0% 0.0% 28.19sec 2893987 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.7% 0.0% 0.0% 0.0% 41.55sec 0 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_damage 120696 1562542 3454 1.49 114647 237545 11.2 11.2 19.7% 0.0% 0.0% 0.0% 41.55sec 1562542 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_heal 120696 0 0 32.30 0 0 11.2 243.5 22.9% 0.0% 0.0% 0.0% 41.55sec 48479210 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_blast 8092 4501247 9951 5.34 92222 190985 40.3 40.3 19.8% 0.0% 0.0% 0.0% 11.21sec 4501247 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay ticks -15407 7531908 16738 34.10 24262 50282 125.3 255.8 19.9% 0.0% 0.0% 0.0% 3.54sec 7531908 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay_mastery 124468 2354384 5205 10.60 24272 50347 80.0 79.9 19.9% 0.0% 0.0% 0.0% 5.47sec 2354384 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_death 32379 1919829 4244 2.03 102964 213593 15.3 15.3 20.2% 0.0% 0.0% 0.0% 4.95sec 1919829 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain ticks -589 4332660 9628 33.52 14223 29441 59.7 251.4 19.8% 0.0% 0.0% 0.0% 7.53sec 4332660 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain_mastery 124464 1358888 3004 10.40 14274 29573 78.5 78.4 20.0% 0.0% 0.0% 0.0% 5.69sec 1358888 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadowy_apparition 87532 1279744 2829 7.94 17795 35823 60.9 59.9 19.8% 0.0% 0.0% 0.0% 7.32sec 1279744 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch ticks -34914 3422322 7605 23.51 16004 33147 30.0 176.3 19.9% 0.0% 0.0% 0.0% 15.08sec 3422322 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch_mastery 124465 1073096 2372 7.30 16070 33281 55.1 55.0 19.9% 0.0% 0.0% 0.0% 7.96sec 1073096 452.35sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender melee 0 4383921 37536 54.08 36395 73315 105.3 105.3 20.1% 0.0% 24.0% 0.0% 4.18sec 4383921 116.79sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.32sec 0 116.79sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague 2944 2366555 5232 2.20 117449 243320 16.6 16.6 19.8% 0.0% 0.0% 0.0% 28.19sec 2366555 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_mastery 124467 911008 2014 5.12 19449 40309 38.7 38.6 19.9% 0.0% 0.0% 0.0% 10.90sec 911008 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_tick ticks -2944 2895635 6435 16.44 19387 40162 16.6 123.3 19.8% 0.0% 0.0% 0.0% 28.19sec 2895635 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo 120644 0 0 1.49 0 0 11.3 11.3 19.9% 0.0% 0.0% 0.0% 41.54sec 0 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_damage 120696 1563947 3457 1.49 114668 237420 11.3 11.3 19.8% 0.0% 0.0% 0.0% 41.54sec 1563947 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_heal 120696 0 0 32.33 0 0 11.3 243.7 22.9% 0.0% 0.0% 0.0% 41.54sec 48516569 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_blast 8092 4507623 9965 5.34 92236 191017 40.3 40.3 19.9% 0.0% 0.0% 0.0% 11.20sec 4507623 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay ticks -15407 7528546 16730 34.08 24266 50296 125.3 255.6 19.9% 0.0% 0.0% 0.0% 3.54sec 7528546 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay_mastery 124468 2351734 5199 10.58 24276 50302 79.8 79.8 20.0% 0.0% 0.0% 0.0% 5.47sec 2351734 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_death 32379 1924861 4255 2.03 102994 213717 15.3 15.3 20.4% 0.0% 0.0% 0.0% 4.96sec 1924861 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain ticks -589 4716307 10481 33.52 14222 29415 59.7 251.4 29.9% 0.0% 0.0% 0.0% 7.52sec 4716307 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain_mastery 124464 1478476 3268 10.42 14278 29533 78.6 78.5 29.8% 0.0% 0.0% 0.0% 5.68sec 1478476 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadowy_apparition 87532 1769785 3912 10.98 17796 35800 84.2 82.8 19.9% 0.0% 0.0% 0.0% 5.32sec 1769785 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch ticks -34914 3420980 7602 23.49 16004 33147 30.0 176.2 19.9% 0.0% 0.0% 0.0% 15.08sec 3420980 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch_mastery 124465 1072351 2371 7.30 16069 33292 55.1 55.0 19.8% 0.0% 0.0% 0.0% 7.96sec 1072351 452.35sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender melee 0 4382576 37522 54.08 36395 73324 105.3 105.3 20.1% 0.0% 24.0% 0.0% 4.18sec 4382576 116.80sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.32sec 0 116.80sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague 2944 2258217 4992 2.11 117087 242078 15.9 15.9 19.9% 0.0% 0.0% 0.0% 29.55sec 2258217 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_mastery 124467 865103 1912 4.88 19392 40160 36.8 36.8 19.9% 0.0% 0.0% 0.0% 11.42sec 865103 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_tick ticks -2944 2756231 6125 15.68 19315 40010 15.9 117.6 19.9% 0.0% 0.0% 0.0% 29.55sec 2756231 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 dispersion 47585 0 0 0.15 0 0 1.1 1.1 0.0% 0.0% 0.0% 0.0% 154.03sec 0 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo 120644 0 0 1.30 0 0 9.8 9.8 19.9% 0.0% 0.0% 0.0% 44.96sec 0 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_damage 120696 1344934 2973 1.30 113724 235344 9.8 9.8 19.6% 0.0% 0.0% 0.0% 44.96sec 1344934 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_heal 120696 0 0 28.45 0 0 9.8 214.5 22.9% 0.0% 0.0% 0.0% 44.96sec 42461772 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_blast 8092 4177545 9235 5.00 91422 189272 37.7 37.7 19.8% 0.0% 0.0% 0.0% 11.61sec 4177545 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay ticks -15407 6677720 14839 30.34 24175 50116 108.9 227.6 19.9% 0.0% 0.0% 0.0% 3.91sec 6677720 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay_mastery 124468 2091065 4623 9.44 24199 50157 71.2 71.2 20.0% 0.0% 0.0% 0.0% 5.89sec 2091065 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_death 32379 1707304 3774 1.82 102497 212425 13.7 13.7 20.1% 0.0% 0.0% 0.0% 5.53sec 1707304 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_insanity 129249 2130051 4709 1.72 136004 281883 12.9 12.9 19.6% 0.0% 0.0% 0.0% 32.48sec 2130051 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain ticks -589 3843791 8542 29.98 14115 29208 57.2 224.9 19.7% 0.0% 0.0% 0.0% 7.58sec 3843791 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain_mastery 124464 1209497 2674 9.33 14174 29352 70.3 70.3 20.0% 0.0% 0.0% 0.0% 6.14sec 1209497 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.82sec 0 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowy_apparition 87532 1148097 2538 7.17 17683 35545 54.7 54.1 19.9% 0.0% 0.0% 0.0% 7.88sec 1148097 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch ticks -34914 3085341 6856 21.34 15905 32929 26.9 160.1 19.8% 0.0% 0.0% 0.0% 16.00sec 3085341 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch_mastery 124465 969469 2143 6.64 15953 33073 50.1 50.1 19.9% 0.0% 0.0% 0.0% 8.35sec 969469 452.35sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend melee 0 1653584 46431 52.95 45940 92696 31.4 31.4 20.2% 0.0% 24.3% 0.0% 12.73sec 1653584 35.61sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.88sec 0 35.61sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague 2944 2256359 4988 2.11 116975 242398 15.9 15.9 20.0% 0.0% 0.0% 0.0% 29.61sec 2256359 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_mastery 124467 859859 1901 4.86 19384 40137 36.7 36.6 19.8% 0.0% 0.0% 0.0% 11.47sec 859859 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_tick ticks -2944 2745452 6101 15.65 19302 40000 15.9 117.4 19.8% 0.0% 0.0% 0.0% 29.61sec 2745452 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 dispersion 47585 0 0 0.15 0 0 1.1 1.1 0.0% 0.0% 0.0% 0.0% 153.90sec 0 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo 120644 0 0 1.30 0 0 9.8 9.8 19.8% 0.0% 0.0% 0.0% 44.95sec 0 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_damage 120696 1346787 2977 1.30 113695 235243 9.8 9.8 19.9% 0.0% 0.0% 0.0% 44.95sec 1346787 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_heal 120696 0 0 28.39 0 0 9.8 214.1 23.0% 0.0% 0.0% 0.0% 44.95sec 42379074 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_blast 8092 4164812 9207 4.99 91382 189248 37.6 37.6 19.8% 0.0% 0.0% 0.0% 11.63sec 4164812 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay ticks -15407 6670772 14824 30.32 24172 50096 108.9 227.4 19.9% 0.0% 0.0% 0.0% 3.91sec 6670772 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay_mastery 124468 2090074 4621 9.44 24192 50143 71.2 71.2 19.9% 0.0% 0.0% 0.0% 5.89sec 2090074 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_death 32379 1706434 3772 1.81 102425 212577 13.7 13.7 20.3% 0.0% 0.0% 0.0% 5.55sec 1706434 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_insanity 129249 2137840 4726 1.72 136037 281748 12.9 12.9 20.0% 0.0% 0.0% 0.0% 32.53sec 2137840 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain ticks -589 4172824 9273 29.93 14107 29157 57.1 224.5 29.8% 0.0% 0.0% 0.0% 7.58sec 4172824 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain_mastery 124464 1306862 2889 9.29 14168 29301 70.1 70.0 29.7% 0.0% 0.0% 0.0% 6.15sec 1306862 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.81sec 0 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowy_apparition 87532 1589491 3514 9.93 17667 35551 75.6 74.8 20.0% 0.0% 0.0% 0.0% 5.72sec 1589491 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch ticks -34914 3078123 6840 21.30 15900 32912 26.8 159.7 19.8% 0.0% 0.0% 0.0% 16.02sec 3078123 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch_mastery 124465 964112 2131 6.61 15942 33041 49.9 49.8 19.9% 0.0% 0.0% 0.0% 8.36sec 964112 452.35sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend melee 0 1658524 46566 52.97 45913 92650 31.4 31.4 20.5% 0.0% 24.0% 0.0% 12.72sec 1658524 35.62sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.09 0 0 6.0 6.0 0.0% 0.0% 0.0% 0.0% 74.88sec 0 35.62sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=558|1:|0|&chxp=1,1,-nan,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.17% 8.17%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.44% 8.44%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.44%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.04% 11.04%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.08% 11.08%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.05% 11.05%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.69% 10.69%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.69%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.83% 10.83%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.26% 11.26%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.26%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.45% 10.45%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1562772.92
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 452.35
Minimum 348.13
Maximum 558.35
Spread ( max - min ) 210.22
Range [ ( max - min ) / 2 * 100% ] 23.24%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 49992
Mean 1565787.96
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 845076497 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.