close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 casting,cooldown=30,duration=3,first=15
1 movement,cooldown=30,duration=5
2 stun,cooldown=60,duration=2
3 invulnerable,cooldown=120,duration=3

priest_90_di_fdcl_no2PT14 : 114062 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114061.8 114061.8 21.64 / 0.02% 4036 / 3.5% 21.2 5206.4 5147.8 Mana 0.51% 47.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:303909|236477|137404|129999|91671|91067|77681|44141&chds=0,607818&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++303909++devouring_plague,9482C9,0,0,15|t++236477++halo,9482C9,1,0,15|t++137404++shadow_word_pain,9482C9,2,0,15|t++129999++vampiric_touch,9482C9,3,0,15|t++91671++shadow_word_death,9482C9,4,0,15|t++91067++mind_blast,9482C9,5,0,15|t++77681++mind_spike,4A79D3,6,0,15|t++44141++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,13,11,8,6,6,6,5,4,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|devouring_plague|halo_damage|mind_flay|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:46666555654356846667642210zyxwwxxyz10zyxwvuuttttuutsssrpmlkkklllmlmmmlklllklmnopppoonnmllllmmnnnmllkkjjjjjlmnomlkkkjijkllmmnooonnmlmnoooppponnnmmlkkjjkklmmmmmmmlllllmnopppomnoooooopqrsssrrqqpqqrqpppppppooonnnnoopqqrrrrqqppppooppqqomlkkjihggghhijjjjjjijlllmnopqqqqqponmmlllmmmmmllkjjjiijkllmmlllmllkllmnnopppoonnnonnmnnooonnnnmmmmmmnopqqrsssssssttuvvvusrpqpppooopqqrrrrqqpqrstsssttttssrqqppppqqrrrrssrrrrqqqqqqrqppppppoooooooppqqrrrsttttuvwxxyyzzzzyyyyyyyyxyyxxxwwvvuuuuusqqqqpponnmnmnnnooppoqsststtvvwwwxxxxwwvvvvvwvwwwxwwwvvuuuuutsssrrsssrtttttttttuu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6996,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114062|max=163033&chxp=1,1,70,100&chtt=priest_90_di_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,56,56,56,128,184,216,352,384,600,728,1016,1232,1312,1512,1864,2216,2248,2256,2632,2776,2680,2744,2520,2720,2712,2304,2024,2040,1816,1328,1104,944,752,560,344,400,344,192,160,192,96,56,32,8,24,8,16,24&chds=0,2776&chbh=5&chxt=x&chxl=0:|min=106038|avg=114062|max=123326&chxp=0,1,46,100&chtt=priest_90_di_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.4,16.4,16.0,15.5,15.5,5.9,3.9,2.8,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 87.3s|shadow_word_pain 74.2s|mind_spike 72.0s|vampiric_touch 70.1s|mind_blast 69.8s|devouring_plague 26.6s|shadow_word_death 17.4s|halo 12.7s|shadowfiend 2.4s|waiting 2.3s&chtt=priest_90_di_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no2PT14 114062
devouring_plague 6776 (17951) 5.9% (15.7%) 22.4 20.59sec 361355 303909 112346 232677 136351 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.40 22.40 0.00 0.00 1.1891 0.0000 3053911.02 3053911.02 0.00 303908.81 303908.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.93 80.05% 112345.68 102399 137090 112371.66 106231 118550 2014258 2014258 0.00
crit 4.47 19.95% 232676.79 210941 282405 230688.44 0 282405 1039653 1039653 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2662 2.3% 53.3 8.01sec 22522 0 18595 38494 22548 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.30 53.24 0.00 0.00 0.0000 0.0000 1200381.83 1200381.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.66 80.14% 18595.48 17006 22766 18597.33 17655 19585 793336 793336 0.00
crit 10.57 19.86% 38493.76 35032 46897 38497.69 35032 46897 407046 407046 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8513 7.5% 22.4 20.59sec 171409 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.5 18576 38455 22519 19.8% 0.0% 28.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.40 22.40 170.48 170.48 0.0000 0.7531 3839102.58 3839102.58 0.00 29903.05 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.7 80.17% 18576.34 17006 29423 18578.20 17687 19580 2538826 2538826 0.00
crit 33.8 19.83% 38455.27 35032 60128 38453.44 35919 41400 1300277 1300277 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6667) 0.0% (5.8%) 10.8 43.25sec 278788 236477 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 10.78 0.00 0.00 1.1790 0.0000 0.00 0.00 0.00 236476.54 236476.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.66 80.36% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.64% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6667 5.8% 10.8 43.25sec 278788 0 115154 238258 139392 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.78 21.55 0.00 0.00 0.0000 0.0000 3004434.38 3004434.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.31 80.31% 115154.33 104363 139821 115160.33 107322 122528 1993260 1993260 0.00
crit 4.24 19.69% 238258.04 214987 288030 235797.39 0 288030 1011174 1011174 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.25sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.78 228.48 0.00 0.00 0.0000 0.0000 0.00 44724010.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.89 76.98% 0.00 0 0 0.00 0 0 0 27632023 100.00
crit 52.60 23.02% 0.00 0 0 0.00 0 0 0 17091988 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14092 12.4% 58.2 7.69sec 109163 91067 89952 186312 109161 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.19 58.19 0.00 0.00 1.1987 0.0000 6352714.24 6352714.24 0.00 91066.59 91066.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.59 80.06% 89952.10 82079 110390 89967.48 86984 95498 4191149 4191149 0.00
crit 11.60 19.94% 186311.93 169082 227403 186342.80 169082 212821 2161565 2161565 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 6512 (8555) 5.7% (7.5%) 55.5 7.75sec 69345 44141 0 0 0 0.0% 0.0% 0.0% 0.0% 100.1 24098 49985 29284 20.0% 0.0% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.55 55.55 100.13 100.13 1.5710 0.7327 2932104.98 2932104.98 0.00 44140.52 44140.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.1 79.97% 24098.33 21797 29181 24105.14 23160 25293 1929596 1929596 0.00
crit 20.1 20.03% 49984.73 44901 60113 50000.39 46140 55815 1002509 1002509 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2043 1.8% 31.4 13.19sec 29308 0 24118 50029 29318 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.39 31.38 0.00 0.00 0.0000 0.0000 919994.21 919994.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.08 79.93% 24118.13 21797 29181 24126.69 22455 25896 604947 604947 0.00
crit 6.30 20.07% 50028.85 44901 60113 49934.03 0 60113 315048 315048 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 12410 10.9% 61.1 7.08sec 91534 77681 75448 156309 91534 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.12 61.12 0.00 0.00 1.1783 0.0000 5594289.39 5594289.39 0.00 77681.20 77681.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.96 80.11% 75448.10 68964 93036 75456.62 72228 78841 3693847 3693847 0.00
crit 12.16 19.89% 156308.64 142066 191655 156329.83 142066 173207 1900442 1900442 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3538 3.1% 14.6 4.96sec 109586 91671 90037 186799 109584 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.56 14.56 0.00 0.00 1.1954 0.0000 1595259.48 1595259.48 0.00 91671.04 91671.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.62 79.80% 90036.95 79678 107383 90126.27 82482 100325 1045894 1045894 0.00
crit 2.94 20.20% 186798.55 164137 221210 179446.12 0 221210 549365 549365 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17328 (22604) 15.2% (19.8%) 62.8 7.17sec 162319 137404 0 0 0 0.0% 0.0% 0.0% 0.0% 449.3 14331 29667 17387 19.9% 0.0% 193.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.77 62.77 449.25 449.25 1.1813 1.9438 7811031.32 7811031.32 0.00 10754.84 137403.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 359.7 80.08% 14331.05 12783 17966 14333.54 13925 14758 5155457 5155457 0.00
crit 89.5 19.92% 29666.63 26333 37009 29671.26 28498 30960 2655574 2655574 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5276 4.6% 140.5 3.18sec 16928 0 13979 28943 16942 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.50 140.38 0.00 0.00 0.0000 0.0000 2378404.78 2378404.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.58 80.19% 13978.66 12783 17110 13981.29 13542 14497 1573662 1573662 0.00
crit 27.80 19.81% 28942.51 26333 35247 28947.25 27264 30977 804743 804743 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4382 3.8% 94.2 4.74sec 20980 0 17766 35728 21339 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.19 92.60 0.00 0.00 0.0000 0.0000 1976032.87 1976032.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.18 80.11% 17766.46 15875 22484 17769.99 17100 18411 1317995 1317995 0.00
crit 18.42 19.89% 35728.31 31750 44968 35738.92 32558 39001 658038 658038 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15482 (20203) 13.6% (17.7%) 59.0 7.54sec 154240 129999 0 0 0 0.0% 0.0% 0.0% 0.0% 357.4 16105 33352 19530 19.9% 0.0% 177.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.05 59.05 357.36 357.36 1.1865 2.2358 6979484.88 6979484.88 0.00 10480.11 129999.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.4 80.14% 16104.97 14287 20366 16107.11 15647 16650 4612257 4612257 0.00
crit 71.0 19.86% 33352.35 29431 41955 33357.76 31792 35049 2367228 2367228 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4721 4.1% 111.8 3.93sec 19029 0 15708 32547 19044 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.84 111.75 0.00 0.00 0.0000 0.0000 2128125.99 2128125.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.61 80.19% 15707.93 14287 19397 15711.07 15177 16332 1407635 1407635 0.00
crit 22.14 19.81% 32546.91 29431 39957 32550.49 30097 35228 720491 720491 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46205 / 3659
melee 46205 3.2% 31.2 12.62sec 52349 51518 45643 92157 52348 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.16 31.16 0.00 0.00 1.0161 0.0000 1630949.16 1630949.16 0.00 51517.76 51517.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.36 55.73% 45642.53 36329 55931 45660.54 41518 51452 792530 792530 0.00
crit 6.31 20.25% 92156.71 72658 111863 92052.80 0 111863 581449 581449 0.00
glance 7.48 24.02% 34344.79 27247 41949 34341.95 0 41949 256970 256970 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.42%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.4 2.1 15.8sec 14.7sec 9.02% 45.52%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.02%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.62%
glyph_mind_spike 37.1 24.0 11.8sec 7.1sec 43.56% 69.81%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.55%
  • glyph_mind_spike_2:15.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.4sec 20.5sec 43.68% 43.94%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.68%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.19% 42.19%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.19%

    Trigger Attempt Success

    • trigger_pct:14.43%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.43% 49.52%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.43%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 40.5 30.0 10.8sec 6.2sec 45.99% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.79%
  • surge_of_darkness_2:12.21%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.50%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no2PT14
devouring_plague Shadow Orb 22.4 67.2 3.0 3.0 120452.1
halo Mana 10.8 436460.4 40500.0 40500.1 6.9
mind_blast Mana 58.2 271173.6 4659.8 4659.7 23.4
mind_flay Mana 55.6 166650.2 3000.0 3000.0 23.1
shadow_word_death Mana 14.6 113550.5 7800.0 7800.3 14.0
shadow_word_pain Mana 62.8 828609.4 13200.0 13199.8 12.3
vampiric_touch Mana 59.0 531437.8 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.16 153878.35 (6.63%) 4939.07 126519.89 45.12%
Shadow Orbs from Mind Blast Shadow Orb 58.19 58.19 (88.79%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.35 7.35 (11.21%) 1.00 0.00 0.00%
Devouring Plague Health Health 223.72 0.00 (-nan%) 0.00 3106707.95 100.00%
Vampiric Touch Mana Mana 469.12 1764147.65 (75.99%) 3760.58 715289.95 28.85%
mp5_regen Mana 1803.34 403436.45 (17.38%) 223.72 137565.89 25.43%
Resource RPS-Gain RPS-Loss
Mana 5147.82 5206.41
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 273581.81 120600.00 300000.00
Shadow Orb 1.35 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.6%
shadowfiend-Mana Cap 25.6%
lightwell-Mana Cap 25.6%

Procs

Count Interval
Shadowy Recall Extra Tick 336.7 1.3sec
Shadowy Apparition Procced 94.2 4.7sec
Divine Insight Mind Blast CD Reset 51.9 14.7sec
FDCL Mind Spike proc 70.5 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 114061.79
Minimum 106037.80
Maximum 123325.81
Spread ( max - min ) 17288.01
Range [ ( max - min ) / 2 * 100% ] 7.58%
Standard Deviation 2469.1053
5th Percentile 110052.94
95th Percentile 118124.15
( 95th Percentile - 5th Percentile ) 8071.21
Mean Distribution
Standard Deviation 11.0431
95.00% Confidence Intervall ( 114040.15 - 114083.44 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1800
0.1 Scale Factor Error with Delta=300 52043
0.05 Scale Factor Error with Delta=300 208172
0.01 Scale Factor Error with Delta=300 5204306
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114061.79
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49765271.96
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 353.34
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.80 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.56 shadow_word_death,if=active_enemies<=5
F 59.62 mind_blast,if=active_enemies<=6&cooldown_react
G 44.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.58 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.11 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.78 halo,if=talent.halo.enabled
M 14.60 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.99 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 43.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 39.98 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.84 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFRTJGGHHFRTRTWFMJRHFGHJFRTLRFGHHJMRFGTJRFHGHJFDFGRTHFHRTGLFMWGRHHFTRQFQQQFHDFGFGHJTGRFHMTFHGLTTHFGRTHTRFHGMRWHFHRTRTTFHGTGFHLMTBWWFHGHRTQFTQQQFHMHGRTFGJRRWFHHLTFMRGFTHGHTFTJGFJGHHDQFRTTFGHHGLRQFMWWRWHFHTGQQFTHHGQFMTFRGJRHFHLTGRQQFMRHRGHQFTQFTRWWWRWFHHMRGRTFTFQQHFHJGJLDFGBGHHFJRJRTTFGDEEGFHFHDEEWWFLHJEDEFGHTRPEEFGHMRHEEF9GHHRTEDEFGLRHFTEDEGFHR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_fdcl_no4PT14 : 117047 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
117046.5 117046.5 21.56 / 0.02% 4068 / 3.5% 21.8 5206.9 5147.8 Mana 0.51% 47.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:304067|236552|149305|129972|91564|90931|77566|44104&chds=0,608133&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++304067++devouring_plague,9482C9,0,0,15|t++236552++halo,9482C9,1,0,15|t++149305++shadow_word_pain,9482C9,2,0,15|t++129972++vampiric_touch,9482C9,3,0,15|t++91564++shadow_word_death,9482C9,4,0,15|t++90931++mind_blast,9482C9,5,0,15|t++77566++mind_spike,4A79D3,6,0,15|t++44104++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,11,8,6,6,6,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|devouring_plague_tick|devouring_plague|halo_damage|mind_flay|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|devouring_plague_mastery|mind_flay_mastery&chtt=priest_90_di_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:355655556543568566676432110zyxxxyy0100zywvuuuttuuutsssspnllklllmmmmmmlllmlklnopppppoonmmllmmnnnnnmllkkjjjklmnonmlkkjjjllmmnnoooonmmmnooopqpoonnnmllkkkkllmmmmnnmmmllmmnopqponopopooopqrssssrrqqqrrqppppppppoonnnnoppqqrrrrrqqppppopqqqomllkjiihghhiijjjjkjjklmmmnopqrrqqqponmmmmmmmmmmlkkjjijjklmmmllmmmlllmnnnoppppoonoonnmnooponnnnnmmmmnnopqrrsssssssttuvvvusrpqpppooopqqrrrrrqprsstststtttssrqqpppqqqrrrssssrrrqqqqqqrqppqqppooooooppqqrrrrsuuttuvwxxyyzzzzzyyyyyyyyyyyyxxwwvvuuuutrrqqpponnnnmnnoopppoqsttsttvvwwwxxxxwwvvwvvwwwwwwwwwvvvuuuutsttsstsrsrrqqqpppppo&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7039,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117047|max=166272&chxp=1,1,70,100&chtt=priest_90_di_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,16,8,16,72,80,184,200,352,384,536,752,1168,1128,1408,1848,2168,2288,2728,2728,2616,2864,3272,3072,2944,2624,2224,2240,1976,1584,1200,1064,1008,720,592,520,432,208,240,192,88,112,64,24,16,16,8&chds=0,3272&chbh=5&chxt=x&chxl=0:|min=107675|avg=117047|max=126026&chxp=0,1,51,100&chtt=priest_90_di_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:19.4,16.4,15.9,15.5,15.5,5.9,3.9,2.8,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 87.5s|shadow_word_pain 74.2s|mind_spike 71.7s|vampiric_touch 70.0s|mind_blast 69.8s|devouring_plague 26.6s|shadow_word_death 17.4s|halo 12.7s|shadowfiend 2.4s|waiting 2.3s&chtt=priest_90_di_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no4PT14 117047
devouring_plague 6781 (17966) 5.8% (15.4%) 22.4 20.59sec 361615 304067 112377 232712 136415 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.40 22.40 0.00 0.00 1.1893 0.0000 3055599.07 3055599.07 0.00 304066.55 304066.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.93 80.03% 112377.18 102399 137090 112406.82 104047 118818 2014408 2014408 0.00
crit 4.47 19.97% 232711.70 210941 282405 230873.59 0 282405 1041191 1041191 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2667 2.3% 53.4 7.99sec 22516 0 18597 38477 22544 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.43 53.36 0.00 0.00 0.0000 0.0000 1202978.69 1202978.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.77 80.15% 18597.20 17006 22766 18600.16 17691 19833 795357 795357 0.00
crit 10.59 19.85% 38477.14 35032 46897 38481.50 35032 43504 407622 407622 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8518 7.3% 22.4 20.59sec 171497 0 0 0 0 0.0% 0.0% 0.0% 0.0% 170.5 18580 38473 22525 19.8% 0.0% 28.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.40 22.40 170.54 170.54 0.0000 0.7532 3841451.18 3841451.18 0.00 29906.66 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 136.7 80.17% 18580.05 17006 29890 18583.06 17723 19475 2540233 2540233 0.00
crit 33.8 19.83% 38473.06 35032 61574 38476.69 35820 41675 1301219 1301219 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6673) 0.0% (5.7%) 10.8 43.21sec 278906 236552 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.1791 0.0000 0.00 0.00 0.00 236552.41 236552.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.64 80.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6673 5.7% 10.8 43.21sec 278906 0 115118 238266 139452 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 21.57 0.00 0.00 0.0000 0.0000 3008473.61 3008473.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.31 80.24% 115118.36 104363 139821 115135.69 105928 123286 1992758 1992758 0.00
crit 4.26 19.76% 238265.68 214987 288030 235209.75 0 288030 1015716 1015716 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.21sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.79 228.54 0.00 0.00 0.0000 0.0000 0.00 44703748.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.06 77.04% 0.00 0 0 0.00 0 0 0 27653655 100.00
crit 52.48 22.96% 0.00 0 0 0.00 0 0 0 17050094 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14078 12.0% 58.2 7.69sec 108993 90931 89953 186171 108994 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.23 58.23 0.00 0.00 1.1987 0.0000 6346142.83 6346142.83 0.00 90930.68 90930.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.70 80.21% 89953.21 82079 110390 89970.50 86923 92977 4201110 4201110 0.00
crit 11.52 19.79% 186171.12 169082 227403 186212.48 169082 213140 2145033 2145033 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 6532 (8576) 5.6% (7.3%) 55.7 7.73sec 69310 44104 0 0 0 0.0% 0.0% 0.0% 0.0% 100.4 24094 49989 29275 20.0% 0.0% 16.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.71 55.71 100.45 100.45 1.5715 0.7327 2940567.18 2940567.18 0.00 44103.79 44103.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.4 80.00% 24094.39 21797 29181 24101.51 22938 25247 1936103 1936103 0.00
crit 20.1 20.00% 49988.66 44901 60113 50004.86 45984 54754 1004464 1004464 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2044 1.7% 31.4 13.17sec 29307 0 24115 49992 29316 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.42 31.41 0.00 0.00 0.0000 0.0000 920719.58 920719.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.10 79.90% 24115.34 21797 29181 24122.47 22586 26627 605189 605189 0.00
crit 6.31 20.10% 49992.16 44901 60113 49919.22 0 60113 315531 315531 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 12340 10.5% 60.9 7.11sec 91401 77566 75430 156232 91400 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.87 60.87 0.00 0.00 1.1784 0.0000 5563704.52 5563704.52 0.00 77565.62 77565.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.84 80.24% 75430.08 68964 93036 75441.10 72375 78876 3684035 3684035 0.00
crit 12.03 19.76% 156232.39 142066 191655 156273.60 142066 177459 1879670 1879670 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3532 3.0% 14.6 4.96sec 109453 91564 90073 186766 109451 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.55 14.55 0.00 0.00 1.1954 0.0000 1592839.37 1592839.37 0.00 91563.54 91563.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.64 79.96% 90073.17 79678 107383 90154.08 82395 98967 1048107 1048107 0.00
crit 2.92 20.04% 186766.10 164137 221210 179217.41 0 221210 544733 544733 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18837 (24569) 16.1% (21.0%) 62.8 7.17sec 176358 149305 0 0 0 0.0% 0.0% 0.0% 0.0% 449.3 14328 29629 18898 29.9% 0.0% 193.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.80 62.80 449.32 449.32 1.1812 1.9436 8491258.50 8491258.50 0.00 11689.62 149305.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 315.1 70.13% 14328.35 12783 17966 14330.63 14004 14732 4515218 4515218 0.00
crit 134.2 29.87% 29629.25 26333 37009 29633.97 28671 30778 3976041 3976041 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5732 4.9% 140.4 3.18sec 18402 0 13975 28903 18418 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.44 140.32 0.00 0.00 0.0000 0.0000 2584349.51 2584349.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.55 70.24% 13975.37 12783 17110 13978.34 13505 14541 1377338 1377338 0.00
crit 41.76 29.76% 28902.71 26333 35247 28908.90 27672 30392 1207011 1207011 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2246 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5464 4.7% 117.5 3.81sec 20964 0 17764 35706 21322 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.53 115.55 0.00 0.00 0.0000 0.0000 2463838.39 2463838.39 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.64 80.17% 17764.32 15875 22484 17767.76 17286 18287 1645651 1645651 0.00
crit 22.91 19.83% 35705.63 31750 44968 35714.80 33497 38795 818187 818187 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15480 (20195) 13.2% (17.3%) 59.0 7.54sec 154205 129972 0 0 0 0.0% 0.0% 0.0% 0.0% 357.4 16104 33354 19525 19.8% 0.0% 177.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.04 59.04 357.39 357.39 1.1864 2.2359 6978167.82 6978167.82 0.00 10474.38 129972.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.5 80.16% 16103.65 14287 20366 16106.25 15673 16605 4613656 4613656 0.00
crit 70.9 19.84% 33354.16 29431 41955 33358.47 31643 35023 2364512 2364512 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4715 4.0% 111.7 3.93sec 19025 0 15706 32539 19040 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.71 111.62 0.00 0.00 0.0000 0.0000 2125335.27 2125335.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.51 80.19% 15706.12 14287 19397 15709.57 15182 16363 1405873 1405873 0.00
crit 22.11 19.81% 32539.12 29431 39957 32544.68 30354 35284 719462 719462 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46148 / 3655
melee 46148 3.1% 31.1 12.62sec 52292 51451 45641 92160 52291 20.2% 0.0% 24.3% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.15 31.15 0.00 0.00 1.0164 0.0000 1628885.24 1628885.24 0.00 51450.94 51450.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.30 55.54% 45640.64 36329 55931 45656.37 40767 51377 789605 789605 0.00
crit 6.29 20.20% 92159.69 72658 111863 92066.65 0 111863 580022 580022 0.00
glance 7.56 24.26% 34312.57 27247 41949 34303.82 0 41949 259259 259259 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.43%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.5 2.1 15.8sec 14.6sec 9.09% 45.71%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.09%

Trigger Attempt Success

  • trigger_pct:5.03%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.41%
glyph_mind_spike 37.0 23.8 11.8sec 7.1sec 43.43% 69.48%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.51%
  • glyph_mind_spike_2:14.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.6sec 43.63% 43.87%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.63%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.17% 42.17%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.17%

    Trigger Attempt Success

    • trigger_pct:14.40%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.43% 49.51%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.43%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 40.4 29.8 10.8sec 6.2sec 45.85% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.75%
  • surge_of_darkness_2:12.10%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no4PT14
devouring_plague Shadow Orb 22.4 67.2 3.0 3.0 120538.7
halo Mana 10.8 436862.2 40500.0 40500.1 6.9
mind_blast Mana 58.2 270292.3 4642.2 4642.2 23.5
mind_flay Mana 55.7 167131.7 3000.0 3000.0 23.1
shadow_word_death Mana 14.6 113513.1 7800.0 7800.1 14.0
shadow_word_pain Mana 62.8 828989.6 13200.0 13200.1 13.4
vampiric_touch Mana 59.0 531316.8 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.15 153651.98 (6.62%) 4932.64 126698.74 45.19%
Shadow Orbs from Mind Blast Shadow Orb 58.22 58.22 (88.79%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.35 7.35 (11.21%) 1.00 0.00 0.00%
Devouring Plague Health Health 223.90 0.00 (-nan%) 0.00 3109236.42 100.00%
Vampiric Touch Mana Mana 469.01 1764182.64 (75.99%) 3761.51 715010.16 28.84%
mp5_regen Mana 1803.34 403611.22 (17.39%) 223.81 137391.12 25.40%
Resource RPS-Gain RPS-Loss
Mana 5147.79 5206.90
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 273338.26 132900.00 300000.00
Shadow Orb 1.37 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 25.6%
shadowfiend-Mana Cap 25.6%
lightwell-Mana Cap 25.6%

Procs

Count Interval
Shadowy Recall Extra Tick 336.7 1.3sec
Shadowy Apparition Procced 117.5 3.8sec
Divine Insight Mind Blast CD Reset 52.2 14.6sec
FDCL Mind Spike proc 70.3 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 117046.54
Minimum 107675.25
Maximum 126026.09
Spread ( max - min ) 18350.85
Range [ ( max - min ) / 2 * 100% ] 7.84%
Standard Deviation 2459.3725
5th Percentile 113125.79
95th Percentile 121262.29
( 95th Percentile - 5th Percentile ) 8136.50
Mean Distribution
Standard Deviation 10.9995
95.00% Confidence Intervall ( 117024.98 - 117068.10 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1696
0.1 Scale Factor Error with Delta=300 51633
0.05 Scale Factor Error with Delta=300 206534
0.01 Scale Factor Error with Delta=300 5163358
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 117046.54
Distribution Chart

Damage

Sample Data
Count 49992
Mean 51115425.52
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 352.90
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.81 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.55 shadow_word_death,if=active_enemies<=5
F 59.64 mind_blast,if=active_enemies<=6&cooldown_react
G 44.93 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.58 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.01 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.79 halo,if=talent.halo.enabled
M 14.59 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.57 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.65 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 42.86 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 40.06 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.87 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTQFTRTGGHHFMTRTQQQQFJJFRTFGGHHMRTFLTRFHHGFGJMRWFHHTGFRTHGFHJLMRWWFGHHTRQFTRRTHFGDFGHRGWWFHRLRHGRQFMRTRHTFGHFTGWFMHJRHTFTRQQQFHGGJLHFJMJRBWFHTGHTFTTHTFGHMGJRWFLRHHTQFJJRTGGFHHMRJFRTGWFGHHRRQQQQFMTLTRFHGFGHTWFMWHFHTGFJRTHJGFHJLMRFGWHHTQFRTTFGHGHMRFTWWWWHFHJGFJLMRTFHGHFTGFGBDFHHTQFRTGGEEFDFHHJEELWFGMFEEHHHJFDEEGFGHFDEERW9FHTHEDEFGJJHLEEFGHJD

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no2PT14 : 111776 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
111775.7 111775.7 20.15 / 0.02% 3778 / 3.4% 18.1 5636.6 5576.1 Mana 0.48% 42.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:302696|236895|129753|119932|91772|89944|45087&chds=0,605393&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302696++devouring_plague,9482C9,0,0,15|t++236895++halo,9482C9,1,0,15|t++129753++vampiric_touch,9482C9,2,0,15|t++119932++shadow_word_pain,9482C9,3,0,15|t++91772++shadow_word_death,9482C9,4,0,15|t++89944++mind_blast,9482C9,5,0,15|t++45087++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,13,11,10,8,7,6,5,5,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_flay|mindbender: melee|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:z13676566653567466686431ywwvutstttvxwvutsrrrrrrqrrqpooonllkklmnopqqrrrqqrrqqrsssrqponlkjiiiijkkkjihhhhhghhijklkjihhgiillmopqrstttsrstuvuuutrqpnmljjhggghiijijjjjiiiijklmnnmmlkkkkkjjkklmnnnnoonnoooooooppoonnlllklllmmnnnnnnmmmmmmmnnnljihggggggghiklmnopqqrsstuuuuuuttsqonmkjhhhhhhhhhhggggghhijkjjjjjjjjklmnopqqrsstttutsssttsrqponmmllkkjklmnnoppqqqrrrssttrqponllkjjjjkklllmnnnpqrrrstuuuuutsrrrqpooooooopppoooooooooonmnnnmmllmnnopqrstvwxz000112343322100zyxxwvuuuuuuuuuuutttsssrppppoommmmnnoppqrstuxz0001123221200zyxwwvuttttuuuuuuuuuttttsrrrrqqpoonnmmmlllkkj&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6887,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=111776|max=162311&chxp=1,1,69,100&chtt=priest_90_di_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:32,48,32,16,64,120,144,280,352,392,608,1032,1064,1264,1280,1920,1920,2360,2528,2512,2832,3136,2880,2624,2784,2432,2144,2200,1928,1744,1256,1312,984,840,784,528,360,336,264,208,136,88,72,32,64,16,16,8,8,8&chds=0,3136&chbh=5&chxt=x&chxl=0:|min=104384|avg=111776|max=120721&chxp=0,1,45,100&chtt=priest_90_di_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.7,19.3,15.5,14.5,5.5,3.8,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 142.9s|shadow_word_pain 87.1s|vampiric_touch 69.7s|mind_blast 65.4s|devouring_plague 25.0s|shadow_word_death 17.3s|halo 12.8s|mindbender 8.3s|waiting 2.2s&chtt=priest_90_di_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no2PT14 111776
devouring_plague 6342 (16759) 5.7% (15.0%) 21.0 22.05sec 360232 302696 112426 232911 136232 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.98 20.98 0.00 0.00 1.1901 0.0000 2858162.54 2858162.54 0.00 302696.44 302696.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.83 80.24% 112425.74 102399 137090 112455.44 106181 118345 1892675 1892675 0.00
crit 4.15 19.76% 232911.30 210941 282405 230389.69 0 282405 965488 965488 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2484 2.2% 49.7 8.57sec 22543 0 18610 38540 22574 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.71 49.64 0.00 0.00 0.0000 0.0000 1120610.62 1120610.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.77 80.11% 18609.64 17006 22766 18611.38 17610 19923 740034 740034 0.00
crit 9.87 19.89% 38539.91 35032 46897 38531.14 35032 44793 380576 380576 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7933 7.1% 21.0 22.05sec 170587 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.9 18586 38469 22530 19.8% 0.0% 26.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.98 20.98 158.86 158.86 0.0000 0.7538 3578951.65 3578951.65 0.00 29889.86 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.98 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.4 80.17% 18586.26 17006 32196 18588.23 17782 19608 2366968 2366968 0.00
crit 31.5 19.83% 38468.54 35032 66324 38471.48 36077 41670 1211984 1211984 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6732) 0.0% (6.0%) 10.9 42.96sec 279299 236895 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 10.86 0.00 0.00 1.1790 0.0000 0.00 0.00 0.00 236895.44 236895.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.33% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.67% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6732 6.0% 10.9 42.96sec 279299 0 115086 238213 139651 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 21.72 0.00 0.00 0.0000 0.0000 3032735.43 3032735.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 80.05% 115085.51 104363 139821 115105.43 108150 123787 2000698 2000698 0.00
crit 4.33 19.95% 238212.55 214987 288030 236134.97 0 288030 1032038 1032038 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.96sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.86 228.79 0.00 0.00 0.0000 0.0000 0.00 44723879.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.39 77.09% 0.00 0 0 0.00 0 0 0 27700077 100.00
crit 52.41 22.91% 0.00 0 0 0.00 0 0 0 17023802 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13054 11.7% 53.9 8.31sec 109111 89944 89954 186310 109109 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.94 53.94 0.00 0.00 1.2131 0.0000 5885227.52 5885227.52 0.00 89944.18 89944.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.21 80.12% 89954.32 82079 110390 89970.95 86919 93551 3887371 3887371 0.00
crit 10.72 19.88% 186309.53 169082 227403 186361.30 169082 222230 1997857 1997857 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10907 (14318) 9.7% (12.8%) 88.9 4.93sec 72511 45087 0 0 0 0.0% 0.0% 0.0% 0.0% 168.3 24017 49788 29163 20.0% 0.0% 27.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.87 88.87 168.35 168.35 1.6083 0.7358 4909478.36 4909478.36 0.00 45086.59 45086.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.7 80.03% 24016.86 21797 29181 24022.32 23340 24881 3235825 3235825 0.00
crit 33.6 19.97% 49788.22 44901 60113 49801.58 46995 53153 1673654 1673654 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3411 3.0% 52.6 8.13sec 29169 0 24036 49811 29180 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.62 52.60 0.00 0.00 0.0000 0.0000 1534838.20 1534838.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.10 80.04% 24035.58 21797 29181 24040.79 22860 25682 1011913 1011913 0.00
crit 10.50 19.96% 49811.09 44901 60113 49808.32 0 60113 522925 522925 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1986 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3524 3.2% 14.5 4.99sec 109649 91772 90057 186689 109648 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 1.1948 0.0000 1588947.82 1588947.82 0.00 91772.43 91772.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.73% 90056.66 79678 107383 90144.12 82482 98467 1040444 1040444 0.00
crit 2.94 20.27% 186689.00 164137 221210 179665.21 0 221210 548503 548503 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17752 (23161) 15.9% (20.7%) 73.7 6.10sec 141669 119932 0 0 0 0.0% 0.0% 0.0% 0.0% 460.9 14319 29645 17363 19.9% 0.0% 194.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.70 73.70 460.92 460.92 1.1813 1.8981 8003215.76 8003215.76 0.00 10854.55 119931.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 369.4 80.14% 14319.35 12783 17966 14321.86 13944 14710 5289185 5289185 0.00
crit 91.6 19.86% 29644.77 26333 37009 29650.35 28491 31038 2714031 2714031 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5409 4.8% 144.0 3.10sec 16934 0 13978 28936 16948 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.98 143.87 0.00 0.00 0.0000 0.0000 2438284.27 2438284.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 115.29 80.14% 13977.54 12783 17110 13980.31 13589 14450 1611518 1611518 0.00
crit 28.57 19.86% 28935.95 26333 35247 28939.91 27421 30914 826766 826766 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4435 4.0% 95.4 4.68sec 20969 0 17757 35716 21331 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.36 93.75 0.00 0.00 0.0000 0.0000 1999685.19 1999685.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.09 80.10% 17757.24 15875 22484 17760.85 17195 18596 1333433 1333433 0.00
crit 18.65 19.90% 35715.92 31750 44968 35724.95 33039 39063 666252 666252 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15369 (20062) 13.8% (18.0%) 58.7 7.58sec 154186 129753 0 0 0 0.0% 0.0% 0.0% 0.0% 355.0 16091 33324 19515 19.9% 0.0% 175.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.65 58.65 355.04 355.04 1.1883 2.2348 6928370.26 6928370.26 0.00 10477.93 129752.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 284.5 80.14% 16091.32 14287 20366 16093.58 15591 16597 4578139 4578139 0.00
crit 70.5 19.86% 33324.21 29431 41955 33328.39 32052 35311 2350231 2350231 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4693 4.2% 111.2 3.95sec 19028 0 15708 32529 19042 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.17 111.09 0.00 0.00 0.0000 0.0000 2115394.67 2115394.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.07 80.18% 15707.74 14287 19397 15711.17 15245 16437 1399088 1399088 0.00
crit 22.02 19.82% 32528.70 29431 39957 32534.61 30305 35233 716306 716306 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37589 / 9731
melee 37589 8.7% 105.2 4.17sec 41647 39084 36431 73342 41647 20.0% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.22 105.22 0.00 0.00 1.0656 0.0000 4382185.63 4382185.63 0.00 39084.43 39084.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.80 55.88% 36431.21 29063 44745 36443.79 34611 38721 2141991 2141991 0.00
crit 21.09 20.04% 73341.83 58126 89490 73360.05 67004 80243 1546703 1546703 0.00
glance 25.34 24.08% 27370.89 21797 33559 27377.31 25181 30033 693491 693491 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.43%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.7 2.6 15.7sec 14.3sec 10.56% 48.43%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.56%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.62%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.52% 43.77%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.52%

    Trigger Attempt Success

    • trigger_pct:1.71%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.31% 42.31%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.31%

    Trigger Attempt Success

    • trigger_pct:14.32%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.39% 49.51%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no2PT14
devouring_plague Shadow Orb 21.0 62.9 3.0 3.0 120075.5
halo Mana 10.9 439765.2 40500.0 40500.1 6.9
mind_blast Mana 53.9 221673.6 4109.7 4109.8 26.5
mind_flay Mana 88.9 266618.4 3000.0 3000.0 24.2
shadow_word_death Mana 14.5 113036.4 7800.0 7800.3 14.1
shadow_word_pain Mana 73.7 972884.4 13200.0 13200.0 10.7
vampiric_touch Mana 58.7 527892.5 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.22 289136.18 (11.50%) 2747.88 171834.64 37.28%
Shadow Orbs from Mind Blast Shadow Orb 53.94 53.94 (88.06%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.32 7.32 (11.94%) 1.00 0.00 0.00%
Devouring Plague Health Health 208.50 0.00 (-nan%) 0.00 2895367.07 100.00%
Vampiric Touch Mana Mana 466.13 1811290.79 (72.03%) 3885.83 652191.61 26.47%
mp5_regen Mana 1803.34 414157.33 (16.47%) 229.66 126845.01 23.45%
Resource RPS-Gain RPS-Loss
Mana 5576.07 5636.58
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 272713.71 139080.95 300000.00
Shadow Orb 1.31 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.6%
shadowfiend-Mana Cap 23.6%
lightwell-Mana Cap 23.6%

Procs

Count Interval
Shadowy Recall Extra Tick 357.2 1.2sec
Shadowy Apparition Procced 95.4 4.7sec
Divine Insight Mind Blast CD Reset 53.5 14.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no2PT14 Damage Per Second
Count 49992
Mean 111775.73
Minimum 104383.88
Maximum 120720.64
Spread ( max - min ) 16336.76
Range [ ( max - min ) / 2 * 100% ] 7.31%
Standard Deviation 2298.7301
5th Percentile 108120.36
95th Percentile 115676.93
( 95th Percentile - 5th Percentile ) 7556.56
Mean Distribution
Standard Deviation 10.2811
95.00% Confidence Intervall ( 111755.58 - 111795.88 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1624
0.1 Scale Factor Error with Delta=300 45108
0.05 Scale Factor Error with Delta=300 180434
0.01 Scale Factor Error with Delta=300 4510862
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 111775.73
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45993902.31
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 316.52
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.77 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.75 mind_blast,if=active_enemies<=6&cooldown_react
G 43.55 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.43 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.86 halo,if=talent.halo.enabled
M 14.21 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.79 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.54 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.08 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 30.16 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTGGFHHFMTWWWWWFHHGTFLTHHGFTGTAWWFHHMTQFGTHHFGTLTWFGHHDFTTFHGHTGTFMTGAWHHFLTGTTFHHTGTFMTGWWWHFHFTQFMTHGFHGFLTWWAFHHGMTFTHHGFTGTWFMWHHLTFTTGFHHTGTFMTFGAGHHTFTTHGFHLGMTWFWWHFHTFGMQQQHFGHTFTWGLAFHHMTFTGFGHHTWWFMFTHHTGFTLTGTFHHMTGGWFAHHTQQFTEDEGFGHHLEEWWFMTHEEGFHTEEFGDFHHEEG9FHAMLEEGFHTHEDEFGTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no4PT14 : 114885 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114884.7 114884.7 19.80 / 0.02% 3697 / 3.2% 18.6 5640.8 5580.7 Mana 0.48% 42.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:303014|236891|130351|129743|91728|90011|45065&chds=0,606027&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++303014++devouring_plague,9482C9,0,0,15|t++236891++halo,9482C9,1,0,15|t++130351++shadow_word_pain,9482C9,2,0,15|t++129743++vampiric_touch,9482C9,3,0,15|t++91728++shadow_word_death,9482C9,4,0,15|t++90011++mind_blast,9482C9,5,0,15|t++45065++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,12,10,9,8,6,6,6,5,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_flay|mindbender: melee|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_mb_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:z13565555543567466686431yxxwutsttuvxwvutsrrrrrrrrrqqoopnlllllmoppqrrrrqqrrqqrssssrqonlkkjjjjkkkkkiiihhhhhhijklkjihhhijlmnopqsstttsrstuvuuutrqpomlkjihhhhijjjjjjjjjijjlmmnnnmllkkkkkkklmnnnnnoonooooooppppooonmmllllmmnnnnnnnnmmmmmmnnnljiihgggggghjklmnopqqrssttuuuuuttsqonmljihhiiihhhhhgggghiijkjjjjjjjkklmnopqqrsstttutsssttsrqppnmnmlkkkklmnoopqqqrrrrssttrqponmlkkkkkkkllmmnnnpqrrrstuuuuttsrrrqpooooooopppooooooooooonnnnnnmmmnnopqrsuvwxz000112343322100zyxxwvuuuuuuuuuuuttttttrppppoonmmnnnoppqrsttwz00z0022221100zyxxwvuuutuuuuuuuuuuttttsrrrrqqponllkjjiiihhg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6914,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114885|max=166171&chxp=1,1,69,100&chtt=priest_90_di_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,0,8,16,16,32,64,72,72,176,144,416,440,648,960,1232,1328,2048,2200,2352,2592,2928,3320,3168,3400,2864,3208,2888,2584,2216,1928,1392,1280,984,880,600,488,344,192,128,72,120,80,24,32,16,32&chds=0,3400&chbh=5&chxt=x&chxl=0:|min=104863|avg=114885|max=123225&chxp=0,1,55,100&chtt=priest_90_di_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.7,19.3,15.5,14.5,5.5,3.8,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 142.9s|shadow_word_pain 87.2s|vampiric_touch 69.7s|mind_blast 65.3s|devouring_plague 24.9s|shadow_word_death 17.3s|halo 12.8s|mindbender 8.3s|waiting 2.2s&chtt=priest_90_di_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no4PT14 114885
devouring_plague 6343 (16751) 5.5% (14.6%) 21.0 22.09sec 360575 303014 112506 232739 136478 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 0.00 0.00 1.1900 0.0000 2859236.64 2859236.64 0.00 303013.52 303013.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.77 80.06% 112506.25 102399 137090 112531.07 105738 119024 1887093 1887093 0.00
crit 4.18 19.94% 232739.09 210941 282405 230263.98 0 282405 972144 972144 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2479 2.2% 49.6 8.59sec 22549 0 18617 38519 22579 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.60 49.53 0.00 0.00 0.0000 0.0000 1118361.86 1118361.86 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.67 80.09% 18616.53 17006 22766 18618.69 17676 19705 738476 738476 0.00
crit 9.86 19.91% 38518.57 35032 46897 38527.31 0 43173 379886 379886 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7929 6.9% 21.0 22.09sec 170715 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.6 18594 38495 22547 19.9% 0.0% 26.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.95 20.95 158.63 158.63 0.0000 0.7536 3576528.47 3576528.47 0.00 29917.84 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.1 80.14% 18594.19 17006 31698 18595.74 17811 19549 2363748 2363748 0.00
crit 31.5 19.86% 38494.53 35032 65298 38494.68 35910 41916 1212781 1212781 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6729) 0.0% (5.9%) 10.9 42.96sec 279287 236891 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 10.86 0.00 0.00 1.1790 0.0000 0.00 0.00 0.00 236890.78 236890.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 80.28% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.72% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6729 5.9% 10.9 42.96sec 279287 0 115091 238129 139645 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 21.71 0.00 0.00 0.0000 0.0000 3032201.95 3032201.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 80.04% 115090.61 104363 139821 115112.16 108264 122994 2000350 2000350 0.00
crit 4.33 19.96% 238129.16 214987 288030 235963.70 0 288030 1031851 1031851 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.96sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.86 228.76 0.00 0.00 0.0000 0.0000 0.00 44715955.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.35 77.09% 0.00 0 0 0.00 0 0 0 27690323 100.00
crit 52.42 22.91% 0.00 0 0 0.00 0 0 0 17025633 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13039 11.4% 53.9 8.32sec 109185 90011 89955 186297 109185 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.85 53.85 0.00 0.00 1.2130 0.0000 5880133.18 5880133.18 0.00 90010.76 90010.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.11 80.04% 89955.41 82079 110390 89969.76 86512 93184 3877577 3877577 0.00
crit 10.75 19.96% 186297.04 169082 227403 186312.29 169082 209691 2002556 2002556 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10903 (14310) 9.5% (12.4%) 88.9 4.93sec 72468 45065 0 0 0 0.0% 0.0% 0.0% 0.0% 168.3 24016 49793 29162 20.0% 0.0% 27.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.89 88.89 168.29 168.29 1.6081 0.7358 4907656.74 4907656.74 0.00 45065.30 45065.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.7 80.04% 24016.50 21797 29181 24021.17 23200 24707 3234951 3234951 0.00
crit 33.6 19.96% 49793.19 44901 60113 49805.52 46965 53040 1672706 1672706 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3407 3.0% 52.6 8.13sec 29165 0 24038 49846 29176 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.59 52.57 0.00 0.00 0.0000 0.0000 1533796.93 1533796.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.10 80.09% 24038.14 21797 29181 24043.33 22625 25274 1012114 1012114 0.00
crit 10.47 19.91% 49845.58 44901 60113 49848.81 44901 59213 521683 521683 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1984 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3524 3.1% 14.5 4.99sec 109610 91728 90085 186603 109611 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 1.1950 0.0000 1588639.04 1588639.04 0.00 91728.10 91728.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.56 79.77% 90084.83 79678 107383 90166.09 83045 99319 1041516 1041516 0.00
crit 2.93 20.23% 186603.29 164137 221210 178839.07 0 221210 547123 547123 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19306 (25205) 16.8% (21.9%) 73.8 6.09sec 153981 130351 0 0 0 0.0% 0.0% 0.0% 0.0% 461.1 14318 29604 18877 29.8% 0.0% 194.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.80 73.80 461.07 461.07 1.1813 1.8978 8703851.73 8703851.73 0.00 11809.77 130351.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 323.6 70.17% 14318.47 12783 17966 14320.58 13909 14715 4632796 4632796 0.00
crit 137.5 29.83% 29603.75 26333 37009 29608.78 28603 30699 4071055 4071055 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5900 5.1% 144.4 3.09sec 18416 0 13976 28898 18432 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.41 144.28 0.00 0.00 0.0000 0.0000 2659389.77 2659389.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.20 70.14% 13976.38 12783 17110 13978.95 13579 14432 1414452 1414452 0.00
crit 43.08 29.86% 28897.77 26333 35247 28902.83 27531 30415 1244937 1244937 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5522 4.8% 118.7 3.77sec 20971 0 17757 35713 21333 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.73 116.72 0.00 0.00 0.0000 0.0000 2489952.49 2489952.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.47 80.08% 17757.19 15875 22484 17760.38 17254 18301 1659796 1659796 0.00
crit 23.25 19.92% 35712.55 31750 44968 35723.19 33314 38679 830157 830157 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15374 (20063) 13.4% (17.5%) 58.7 7.58sec 154158 129743 0 0 0 0.0% 0.0% 0.0% 0.0% 355.1 16093 33331 19517 19.9% 0.0% 176.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.67 58.67 355.13 355.13 1.1882 2.2350 6930967.64 6930967.64 0.00 10475.77 129742.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.67 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 284.6 80.14% 16093.32 14287 20366 16095.30 15603 16632 4580206 4580206 0.00
crit 70.5 19.86% 33330.67 29431 41955 33334.35 31932 34975 2350762 2350762 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4689 4.1% 111.1 3.95sec 19029 0 15709 32529 19043 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.10 111.02 0.00 0.00 0.0000 0.0000 2114190.60 2114190.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.02 80.18% 15709.14 14287 19397 15711.69 15158 16252 1398360 1398360 0.00
crit 22.01 19.82% 32528.57 29431 39957 32533.99 29804 36246 715830 715830 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37628 / 9742
melee 37628 8.5% 105.2 4.17sec 41696 39130 36433 73346 41696 20.1% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.22 105.22 0.00 0.00 1.0656 0.0000 4387325.14 4387325.14 0.00 39130.27 39130.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.91 55.99% 36433.00 29063 44745 36442.70 34655 38248 2146399 2146399 0.00
crit 21.16 20.11% 73346.30 58126 89490 73369.38 67105 81330 1552312 1552312 0.00
glance 25.14 23.90% 27386.09 21797 33559 27394.02 25353 30422 688614 688614 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.43%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.6 2.6 15.7sec 14.3sec 10.49% 48.25%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.49%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.53%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.66% 43.91%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.66%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.30% 42.30%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.30%

    Trigger Attempt Success

    • trigger_pct:14.31%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.39% 49.52%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.94%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no4PT14
devouring_plague Shadow Orb 21.0 62.9 3.0 3.0 120191.6
halo Mana 10.9 439700.4 40500.0 40499.5 6.9
mind_blast Mana 53.9 222179.0 4125.5 4125.5 26.5
mind_flay Mana 88.9 266658.7 3000.0 3000.0 24.2
shadow_word_death Mana 14.5 113053.8 7800.0 7800.3 14.1
shadow_word_pain Mana 73.8 974117.8 13200.0 13200.0 11.7
vampiric_touch Mana 58.7 528068.2 9000.0 9000.0 17.1
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.22 289091.36 (11.49%) 2747.41 171885.77 37.29%
Shadow Orbs from Mind Blast Shadow Orb 53.85 53.85 (88.04%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.32 7.32 (11.96%) 1.00 0.00 0.00%
Devouring Plague Health Health 208.16 0.00 (-nan%) 0.00 2890634.52 100.00%
Vampiric Touch Mana Mana 466.15 1813325.51 (72.05%) 3890.01 650511.61 26.40%
mp5_regen Mana 1803.34 414239.00 (16.46%) 229.71 126763.34 23.43%
Resource RPS-Gain RPS-Loss
Mana 5580.66 5640.81
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 272877.08 142452.38 300000.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.6%
shadowfiend-Mana Cap 23.6%
lightwell-Mana Cap 23.6%

Procs

Count Interval
Shadowy Recall Extra Tick 357.4 1.2sec
Shadowy Apparition Procced 118.7 3.8sec
Divine Insight Mind Blast CD Reset 53.2 14.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no4PT14 Damage Per Second
Count 49992
Mean 114884.75
Minimum 104862.94
Maximum 123225.17
Spread ( max - min ) 18362.23
Range [ ( max - min ) / 2 * 100% ] 7.99%
Standard Deviation 2258.5730
5th Percentile 111271.99
95th Percentile 118665.27
( 95th Percentile - 5th Percentile ) 7393.28
Mean Distribution
Standard Deviation 10.1015
95.00% Confidence Intervall ( 114864.95 - 114904.55 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1484
0.1 Scale Factor Error with Delta=300 43546
0.05 Scale Factor Error with Delta=300 174185
0.01 Scale Factor Error with Delta=300 4354636
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114884.75
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47394907.05
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 316.59
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.70 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.66 mind_blast,if=active_enemies<=6&cooldown_react
G 43.54 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.42 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.86 halo,if=talent.halo.enabled
M 14.25 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.78 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 17.70 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 54.03 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 30.26 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTQFTGGHHQQQQQQQQFMTWWWWWFHHGTFTLTHFHMGTGQFTAWWFHHTQFGTHHTFGLMTWWWGFHHTFTHHGFGMTGAWFHHLTGTFTHHTGFMTWGWWFHHTFTQFHGFGHLMTQFWWAFHHGTFTHGFHTGWWWWFHHLMTQFTTGTHFGHTGWWAFGHHMTQFTLHGHFGTWFMTHHTFTGTGFHHTQFLGWHAFHMTTFFHGGHTQFMWWWWHTFHTGLTTFTHTGFHMTGGWFAHHTFTTEDEFGGHHLEEWFHMTHEEFGTHTEDEFGHQQQFED9EFAGHHLEEFGMTEEHFGHW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no2PT14 : 110993 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
110992.6 110992.6 21.17 / 0.02% 3972 / 3.6% 17.9 6000.3 5907.6 Mana 0.41% 43.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:302509|236247|143421|130161|111299|91747|89737|45095&chds=0,605019&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302509++devouring_plague,9482C9,0,0,15|t++236247++halo,9482C9,1,0,15|t++143421++shadow_word_insanity,9482C9,2,0,15|t++130161++vampiric_touch,9482C9,3,0,15|t++111299++shadow_word_pain,9482C9,4,0,15|t++91747++shadow_word_death,9482C9,5,0,15|t++89737++mind_blast,9482C9,6,0,15|t++45095++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,12,9,9,7,6,6,5,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:3445434656535684666753210zzxvutuuvwxxwvussrqqqqqqrqpoonlihhhhhhiiiiiiiiijiijlmnnnnmmmllkjjjkklmmlkkjjijjjjklnonlkkjiihiikkllmmmmlkjklllmnnnmmlkjihhhggghhijijjjjjjjjklmnoonnmmnnnnnnoprrrqpppooppqpooppqponmmllllmmnooppqppponnnnnooppnlkkjihgffffgghhhiihghijkkmnopppoonmlkjjjkkkkjjiihhhgghiijkkjjjjkjjiijklmmnnmmmmlmnmmlmnoonnnmlllkkkllmnoppqqqppqqqrsstusqpoooonnnnoopqpppppopqrsrrrrrrrqponnnnnnoopppqqqqqqqppqqqrrpoooonnnmmmmmnnooppppqsssstuvwwxxxxxxxxwwwwwwvwwwvvuuutttsssrppppoonmmmmlmmnnooooqssssttuuuuuvuuutttttttttuuuuuuuuutuuuutsssrstssruuuvvvvwwww&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6720,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110993|max=165170&chxp=1,1,67,100&chtt=priest_90_di_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:32,16,24,24,88,104,160,256,352,544,736,952,1240,1504,1736,1976,2496,2720,2880,3088,3312,3352,3160,2880,2736,2256,2056,1848,1632,1128,1184,856,704,512,336,328,192,184,144,64,40,64,24,24,16,16,8,0,0,8&chds=0,3352&chbh=5&chxt=x&chxl=0:|min=102914|avg=110993|max=121789&chxp=0,1,43,100&chtt=priest_90_di_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:26.7,19.7,15.6,14.3,6.4,5.5,3.8,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 120.4s|shadow_word_pain 88.9s|vampiric_touch 70.2s|mind_blast 64.5s|shadow_word_insanity 29.1s|devouring_plague 24.6s|shadow_word_death 17.3s|halo 12.7s|shadowfiend 2.4s|waiting 1.8s&chtt=priest_90_di_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no2PT14 110993
devouring_plague 6265 (16526) 5.6% (14.9%) 20.7 22.38sec 360064 302509 112422 232573 136428 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.69 20.69 0.00 0.00 1.1903 0.0000 2823149.98 2823149.98 0.00 302509.46 302509.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.56 80.02% 112422.13 102399 137090 112452.68 106763 120819 1861706 1861706 0.00
crit 4.13 19.98% 232572.57 210941 282405 230562.65 0 282405 961444 961444 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2445 2.2% 49.0 8.70sec 22527 0 18597 38524 22559 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.95 48.88 0.00 0.00 0.0000 0.0000 1102742.29 1102742.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.16 80.12% 18596.78 17006 22766 18598.94 17679 19808 728331 728331 0.00
crit 9.72 19.88% 38523.65 35032 46897 38530.06 0 44568 374411 374411 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7817 7.0% 20.7 22.38sec 170351 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.6 18572 38450 22514 19.8% 0.0% 26.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.69 20.69 156.58 156.58 0.0000 0.7535 3525218.18 3525218.18 0.00 29878.02 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.5 80.17% 18571.82 17006 31684 18573.19 17673 19391 2331192 2331192 0.00
crit 31.1 19.83% 38450.21 35032 65270 38448.82 36166 41556 1194026 1194026 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6633) 0.0% (6.0%) 10.7 43.55sec 279059 236247 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.71 10.71 0.00 0.00 1.1813 0.0000 0.00 0.00 0.00 236246.52 236246.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.59 80.21% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.79% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6633 6.0% 10.7 43.55sec 279059 0 115109 238353 139529 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.71 21.43 0.00 0.00 0.0000 0.0000 2989935.96 2989935.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.18 80.19% 115109.16 104363 139821 115112.38 107843 123366 1977898 1977898 0.00
crit 4.25 19.81% 238352.99 214987 288030 235967.14 0 288030 1012037 1012037 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.7 43.55sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.71 227.69 0.00 0.00 0.0000 0.0000 0.00 44516194.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.51 77.08% 0.00 0 0 0.00 0 0 0 27560167 100.00
crit 52.18 22.92% 0.00 0 0 0.00 0 0 0 16956028 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12849 11.6% 53.1 8.45sec 109146 89737 89973 186319 109146 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.07 53.07 0.00 0.00 1.2163 0.0000 5792052.05 5792052.05 0.00 89736.65 89736.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.51 80.10% 89973.29 82079 110390 89988.52 87009 93245 3824468 3824468 0.00
crit 10.56 19.90% 186318.92 169082 227403 186375.24 169082 210287 1967584 1967584 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 9188 (12059) 8.3% (10.9%) 75.2 5.80sec 72142 45095 0 0 0 0.0% 0.0% 0.0% 0.0% 142.3 23949 49642 29063 19.9% 0.0% 23.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.25 75.25 142.32 142.32 1.5998 0.7314 4136233.78 4136233.78 0.00 45095.06 45095.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.0 80.09% 23948.88 21797 29181 23954.43 23138 24836 2729918 2729918 0.00
crit 28.3 19.91% 49642.50 44901 60113 49652.68 46881 53431 1406316 1406316 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2871 2.6% 44.4 9.53sec 29073 0 23968 49681 29082 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.45 44.43 0.00 0.00 0.0000 0.0000 1292174.26 1292174.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.59 80.11% 23968.49 21797 29181 23974.76 22825 25696 853150 853150 0.00
crit 8.84 19.89% 49681.37 44901 60113 49680.43 0 60113 439025 439025 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3524 3.2% 14.5 4.99sec 109656 91747 90062 186768 109654 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.49 14.49 0.00 0.00 1.1953 0.0000 1588774.36 1588774.36 0.00 91746.51 91746.51
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.74% 90062.35 79678 107383 90145.24 83187 100466 1040515 1040515 0.00
crit 2.94 20.26% 186768.02 164137 221210 179519.29 0 221210 548259 548259 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9235 8.3% 24.6 17.56sec 169586 143421 139888 290179 169585 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.58 24.58 0.00 0.00 1.1824 0.0000 4167954.86 4167954.86 0.00 143420.90 143420.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.72 80.24% 139888.22 122772 173880 139948.02 130925 149096 2758699 2758699 0.00
crit 4.86 19.76% 290178.72 252910 358194 288604.23 0 358194 1409256 1409256 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 16817 (21941) 15.2% (19.8%) 75.0 6.00sec 131941 111299 0 0 0 0.0% 0.0% 0.0% 0.0% 436.5 14318 29643 17364 19.9% 0.0% 180.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.95 74.95 436.52 436.52 1.1855 1.8687 7579934.18 7579934.18 0.00 10932.51 111298.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 349.7 80.12% 14317.64 12783 17966 14320.43 14010 14718 5007474 5007474 0.00
crit 86.8 19.88% 29642.91 26333 37009 29648.47 28702 30883 2572460 2572460 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5124 4.6% 136.4 3.27sec 16932 0 13980 28930 16946 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.40 136.29 0.00 0.00 0.0000 0.0000 2309530.71 2309530.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 109.24 80.16% 13979.59 12783 17110 13982.34 13505 14474 1527188 1527188 0.00
crit 27.04 19.84% 28930.39 26333 35247 28935.79 27229 30785 782343 782343 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4293 3.9% 92.3 4.84sec 20970 0 17757 35682 21335 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.28 90.70 0.00 0.00 0.0000 0.0000 1935201.15 1935201.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 72.60 80.04% 17756.94 15875 22484 17760.70 17172 18392 1289067 1289067 0.00
crit 18.11 19.96% 35682.21 31750 44968 35689.56 33134 39206 646134 646134 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15538 (20272) 14.0% (18.3%) 59.2 7.52sec 154412 130161 0 0 0 0.0% 0.0% 0.0% 0.0% 358.5 16109 33361 19537 19.9% 0.0% 177.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.18 59.18 358.50 358.50 1.1863 2.2351 7003955.84 7003955.84 0.00 10486.21 130161.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.18 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 287.3 80.13% 16108.73 14287 20366 16111.26 15587 16581 4627437 4627437 0.00
crit 71.2 19.87% 33361.32 29431 41955 33364.87 32059 35344 2376519 2376519 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4735 4.3% 112.1 3.92sec 19037 0 15711 32559 19052 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.13 112.04 0.00 0.00 0.0000 0.0000 2134520.66 2134520.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.83 80.17% 15711.31 14287 19397 15714.51 15169 16429 1411281 1411281 0.00
crit 22.21 19.83% 32558.85 29431 39957 32564.69 30113 35270 723240 723240 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46210 / 3660
melee 46210 3.3% 31.2 12.61sec 52334 51515 45625 92198 52334 20.2% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0159 0.0000 1631286.59 1631286.59 0.00 51515.40 51515.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.40 55.84% 45625.20 36329 55931 45642.10 40973 52380 794073 794073 0.00
crit 6.30 20.22% 92198.24 72658 111863 92050.71 0 111863 580960 580960 0.00
glance 7.47 23.95% 34325.89 27247 41949 34319.93 0 41949 256254 256254 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1996 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.49%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 26.3 2.4 16.5sec 15.1sec 10.08% 46.46%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.08%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.62%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.63% 43.88%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.63%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.22% 42.22%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.22%

    Trigger Attempt Success

    • trigger_pct:14.35%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.39% 49.54%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.38% 77.49%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no2PT14
devouring_plague Shadow Orb 20.7 62.1 3.0 3.0 120020.0
halo Mana 10.7 433933.2 40500.0 40500.2 6.9
mind_blast Mana 53.1 226861.9 4275.0 4275.0 25.5
mind_flay Mana 75.2 225737.3 3000.0 3000.0 24.0
shadow_word_death Mana 14.5 113015.1 7800.0 7800.2 14.1
shadow_word_insanity Mana 24.6 184327.2 7500.0 7499.9 22.6
shadow_word_pain Mana 75.0 989379.1 13200.0 13199.9 10.0
vampiric_touch Mana 59.2 532643.0 9000.0 9000.0 17.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 170559.89 (6.40%) 5471.80 109976.59 39.20%
Shadow Orbs from Mind Blast Shadow Orb 53.07 53.07 (87.89%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.31 7.31 (12.11%) 1.00 0.00 0.00%
Devouring Plague Health Health 205.46 0.00 (-nan%) 0.00 2853145.11 100.00%
Vampiric Touch Mana Mana 470.53 2038158.19 (76.50%) 4331.58 448938.29 18.05%
mp5_regen Mana 1803.34 455377.44 (17.09%) 252.52 85624.90 15.83%
Resource RPS-Gain RPS-Loss
Mana 5907.61 6000.30
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 258192.94 123300.00 300000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 16.0%
shadowfiend-Mana Cap 16.0%
lightwell-Mana Cap 16.0%

Procs

Count Interval
Shadowy Recall Extra Tick 341.6 1.3sec
Shadowy Apparition Procced 92.3 4.8sec
Divine Insight Mind Blast CD Reset 50.4 15.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no2PT14 Damage Per Second
Count 49992
Mean 110992.65
Minimum 102914.35
Maximum 121788.58
Spread ( max - min ) 18874.22
Range [ ( max - min ) / 2 * 100% ] 8.50%
Standard Deviation 2415.2315
5th Percentile 107133.84
95th Percentile 115077.20
( 95th Percentile - 5th Percentile ) 7943.36
Mean Distribution
Standard Deviation 10.8021
95.00% Confidence Intervall ( 110971.48 - 111013.82 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1818
0.1 Scale Factor Error with Delta=300 49796
0.05 Scale Factor Error with Delta=300 199187
0.01 Scale Factor Error with Delta=300 4979677
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 110992.65
Distribution Chart

Damage

Sample Data
Count 49992
Mean 48381378.27
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 326.42
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.21 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.49 shadow_word_death,if=active_enemies<=5
F 56.03 mind_blast,if=active_enemies<=6&cooldown_react
G 45.75 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.65 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 24.58 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.71 halo,if=talent.halo.enabled
M 13.48 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.48 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.48 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.35 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 29.21 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTFIGGHHTFMTWWWFWHFHGTFLTHHGFIGMTWWWFHHTIGFTHHIFGMLIGWWWWFHHTFGQFTHHIGFMTGIGFHHLTFTIGHGHFTWFMWHHIGFTTHFHGIGLTFBDFHHTIGGFTTFHHMTFIGFGWWHHLFMTFTHHGIFGTGFMHHIGTFTTIGHHFLIGTWFMWHHTFIGTQQFTHHIGQFMTIGWWLFHHTIGFTHHGTFMTIGWFWHHTQFTLIGTHFHGMTBGGFHHTQFTIGEDEGFHHLWEEWFMTHHEEGFTIEDEFGHHGEE9FHMTHFEEFGIDFGHEEHLQQFMW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no4PT14 : 113999 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113999.2 113999.2 21.38 / 0.02% 4014 / 3.5% 18.4 6000.4 5906.8 Mana 0.41% 43.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:302380|235773|143699|130136|121078|91685|89781|45110&chds=0,604760&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++302380++devouring_plague,9482C9,0,0,15|t++235773++halo,9482C9,1,0,15|t++143699++shadow_word_insanity,9482C9,2,0,15|t++130136++vampiric_touch,9482C9,3,0,15|t++121078++shadow_word_pain,9482C9,4,0,15|t++91685++shadow_word_death,9482C9,5,0,15|t++89781++mind_blast,9482C9,6,0,15|t++45110++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,8,8,7,6,6,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_swi_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:244443465643568466676322100yvvuuvwwyxwvutssrqqqqrrqpponmiihhhiiijijjjjijjjjjlmnonnnmmllkkkkkllmmmlkkjjjjjklmnonmlkjiihjjkllmnmmmmljkllmmnnonmllkjiihhhhhiijjjkkkjjjjlmnnoonnmnnnnnnnoprsrqqpppoppqpooppqppnmmlllmmnnooppqqppoonnnnopppnmlkjihgffffgghhiiihhijkklmnopppoonmmkkkkkkkkkjjiihhhhhijjkkkjkkkjjjjkklmmnnnnmmmmnmmmmnopnnnmmllkkllmmnopqqqqqqqqrrsttusrqopoonnnnoppqpppppopqrsrrrrsrrqppnonnnoopppqqqqqqqqqqqqqrrpoooooonmmmmmnnoopppprsssstuvwwxxyyxyxxxwwwwwwwwwvvuuutttsssrppppoonmmmmlmnnoooooqssssttuuuuuvvuuuttttttttuuuuuuuuuuuuuvustsstttsstttttttttss&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6763,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113999|max=168552&chxp=1,1,68,100&chtt=priest_90_di_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,24,88,80,144,112,192,464,552,864,1176,1336,1696,2120,2224,2552,2952,3200,2816,3104,3376,3176,2744,2560,2496,2008,1448,1528,1296,848,544,640,440,304,304,200,96,112,40,32,40,8,8,16,8,0,8&chds=0,3376&chbh=5&chxt=x&chxl=0:|min=105084|avg=113999|max=124574&chxp=0,1,46,100&chtt=priest_90_di_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:26.7,19.7,15.6,14.3,6.5,5.5,3.8,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 120.4s|shadow_word_pain 88.8s|vampiric_touch 70.2s|mind_blast 64.5s|shadow_word_insanity 29.1s|devouring_plague 24.6s|shadow_word_death 17.3s|halo 12.7s|shadowfiend 2.4s|waiting 1.8s&chtt=priest_90_di_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no4PT14 113999
devouring_plague 6253 (16506) 5.5% (14.5%) 20.7 22.40sec 359897 302380 112393 232622 136315 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.68 20.68 0.00 0.00 1.1902 0.0000 2818385.98 2818385.98 0.00 302380.10 302380.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.56 80.11% 112392.93 102399 137090 112424.25 106172 118151 1861543 1861543 0.00
crit 4.11 19.89% 232622.18 210941 282405 229720.84 0 282405 956843 956843 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2442 2.1% 48.9 8.70sec 22503 0 18602 38497 22533 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.94 48.87 0.00 0.00 0.0000 0.0000 1101219.83 1101219.83 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.22 80.24% 18602.23 17006 22766 18603.98 17593 19786 729497 729497 0.00
crit 9.66 19.76% 38497.48 35032 46897 38499.31 0 45197 371723 371723 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7810 6.9% 20.7 22.40sec 170325 0 0 0 0 0.0% 0.0% 0.0% 0.0% 156.4 18569 38444 22520 19.9% 0.0% 26.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.68 20.68 156.38 156.38 0.0000 0.7534 3521666.09 3521666.09 0.00 29889.72 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 125.3 80.12% 18569.25 17006 31124 18571.04 17806 19464 2326614 2326614 0.00
crit 31.1 19.88% 38444.35 35032 64115 38444.62 36104 41583 1195052 1195052 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6624) 0.0% (5.8%) 10.7 43.55sec 278382 235773 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 10.72 0.00 0.00 1.1807 0.0000 0.00 0.00 0.00 235772.72 235772.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.61 80.31% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.11 19.69% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6624 5.8% 10.7 43.55sec 278382 0 115170 238300 139191 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.72 21.45 0.00 0.00 0.0000 0.0000 2985354.23 2985354.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.26 80.49% 115170.15 104363 139821 115164.74 107739 123007 1988270 1988270 0.00
crit 4.18 19.51% 238299.76 214987 288030 235939.32 0 288030 997084 997084 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.7 43.55sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.72 227.78 0.00 0.00 0.0000 0.0000 0.00 44565060.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.51 77.05% 0.00 0 0 0.00 0 0 0 27574538 100.00
crit 52.27 22.95% 0.00 0 0 0.00 0 0 0 16990522 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12844 11.3% 53.0 8.45sec 109220 89781 89980 186413 109220 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.01 53.01 0.00 0.00 1.2165 0.0000 5789996.14 5789996.14 0.00 89781.30 89781.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.43 80.05% 89979.77 82079 110390 89995.33 87026 93191 3818284 3818284 0.00
crit 10.58 19.95% 186413.47 169082 227403 186408.88 0 209691 1971713 1971713 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 9186 (12065) 8.1% (10.6%) 75.3 5.80sec 72152 45110 0 0 0 0.0% 0.0% 0.0% 0.0% 142.3 23953 49652 29055 19.9% 0.0% 23.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.28 75.28 142.33 142.33 1.5995 0.7315 4135442.18 4135442.18 0.00 45109.80 45109.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.28 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 114.1 80.15% 23952.58 21797 29181 23957.77 23017 24842 2732413 2732413 0.00
crit 28.3 19.85% 49652.25 44901 60113 49672.17 46681 53378 1403029 1403029 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2879 2.5% 44.6 9.50sec 29074 0 23972 49666 29086 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.57 44.55 0.00 0.00 0.0000 0.0000 1295868.25 1295868.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.69 80.10% 23972.42 21797 29181 23976.53 22726 25645 855488 855488 0.00
crit 8.87 19.90% 49665.87 44901 60113 49650.90 0 60113 440380 440380 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3523 3.1% 14.5 4.99sec 109578 91685 90027 186708 109578 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.50 14.50 0.00 0.00 1.1952 0.0000 1588720.68 1588720.68 0.00 91685.17 91685.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.57 79.78% 90027.34 79678 107383 90123.49 83304 99239 1041302 1041302 0.00
crit 2.93 20.22% 186708.26 164137 221210 179167.24 0 221210 547419 547419 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9267 8.1% 24.6 17.50sec 169937 143699 139820 289785 169939 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.62 24.62 0.00 0.00 1.1826 0.0000 4183235.09 4183235.09 0.00 143699.46 143699.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.67 79.92% 139820.44 122772 173880 139886.99 129665 149338 2750648 2750648 0.00
crit 4.94 20.08% 289784.96 252910 358194 288239.42 0 358194 1432587 1432587 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18277 (23857) 16.0% (20.9%) 74.9 6.00sec 143545 121078 0 0 0 0.0% 0.0% 0.0% 0.0% 436.4 14314 29597 18877 29.9% 0.0% 180.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.92 74.92 436.44 436.44 1.1856 1.8687 8238728.16 8238728.16 0.00 11890.37 121078.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 306.1 70.14% 14314.05 12783 17966 14316.54 13978 14724 4381982 4381982 0.00
crit 130.3 29.86% 29597.40 26333 37009 29602.62 28734 30597 3856746 3856746 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5580 4.9% 136.6 3.27sec 18412 0 13977 28892 18429 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 136.59 136.47 0.00 0.00 0.0000 0.0000 2514938.33 2514938.33 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.74 70.15% 13977.31 12783 17110 13979.79 13503 14443 1338166 1338166 0.00
crit 40.73 29.85% 28892.03 26333 35247 28898.02 27504 30742 1176772 1176772 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.90sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2239 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5383 4.7% 115.9 3.86sec 20952 0 17753 35692 21306 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.85 113.92 0.00 0.00 0.0000 0.0000 2427298.89 2427298.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.36 80.19% 17752.93 15875 22484 17755.98 17278 18297 1621842 1621842 0.00
crit 22.57 19.81% 35691.61 31750 44968 35699.31 33464 38636 805457 805457 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15531 (20268) 13.6% (17.8%) 59.2 7.52sec 154391 130136 0 0 0 0.0% 0.0% 0.0% 0.0% 358.4 16111 33349 19531 19.8% 0.0% 177.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.17 59.17 358.43 358.43 1.1864 2.2353 7000520.40 7000520.40 0.00 10483.74 130136.13
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 287.3 80.16% 16110.84 14287 20366 16113.25 15676 16609 4628733 4628733 0.00
crit 71.1 19.84% 33348.52 29431 41955 33353.32 31763 35080 2371787 2371787 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4737 4.2% 112.1 3.92sec 19040 0 15711 32540 19055 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.13 112.04 0.00 0.00 0.0000 0.0000 2134905.59 2134905.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.77 80.13% 15710.53 14287 19397 15713.31 15156 16499 1410371 1410371 0.00
crit 22.27 19.87% 32539.82 29431 39957 32548.18 30152 35029 724535 724535 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46239 / 3662
melee 46239 3.2% 31.2 12.61sec 52378 51552 45646 92148 52377 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.16 31.16 0.00 0.00 1.0160 0.0000 1632336.00 1632336.00 0.00 51551.79 51551.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.36 55.70% 45645.62 36329 55931 45662.72 41345 51648 792393 792393 0.00
crit 6.33 20.32% 92148.42 72658 111863 92088.06 0 111863 583447 583447 0.00
glance 7.47 23.98% 34320.35 27247 41949 34327.65 0 41949 256496 256496 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.50%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 26.3 2.3 16.5sec 15.1sec 10.07% 46.48%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.07%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.47%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.6sec 43.58% 43.84%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.58%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.22% 42.22%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.22%

    Trigger Attempt Success

    • trigger_pct:14.40%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.39% 49.51%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.39%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.25% 14.25%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.48%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no4PT14
devouring_plague Shadow Orb 20.7 62.0 3.0 3.0 119964.5
halo Mana 10.7 434322.0 40500.0 40500.2 6.9
mind_blast Mana 53.0 226669.0 4275.8 4275.8 25.5
mind_flay Mana 75.3 225827.0 3000.0 3000.0 24.1
shadow_word_death Mana 14.5 113092.5 7800.0 7800.3 14.0
shadow_word_insanity Mana 24.6 184621.2 7500.0 7499.9 22.7
shadow_word_pain Mana 74.9 988870.1 13200.0 13199.9 10.9
vampiric_touch Mana 59.2 532535.0 9000.0 9000.0 17.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.16 170676.77 (6.41%) 5476.62 109804.99 39.15%
Shadow Orbs from Mind Blast Shadow Orb 53.01 53.01 (87.86%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.32 7.32 (12.14%) 1.00 0.00 0.00%
Devouring Plague Health Health 205.25 0.00 (-nan%) 0.00 2850283.36 100.00%
Vampiric Touch Mana Mana 470.46 2037698.78 (76.50%) 4331.25 448974.34 18.06%
mp5_regen Mana 1803.34 455357.47 (17.09%) 252.51 85644.86 15.83%
Resource RPS-Gain RPS-Loss
Mana 5906.80 6000.39
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 257798.18 114600.00 300000.00
Shadow Orb 1.31 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 16.0%
shadowfiend-Mana Cap 16.0%
lightwell-Mana Cap 16.0%

Procs

Count Interval
Shadowy Recall Extra Tick 341.9 1.3sec
Shadowy Apparition Procced 115.9 3.9sec
Divine Insight Mind Blast CD Reset 50.4 15.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no4PT14 Damage Per Second
Count 49992
Mean 113999.15
Minimum 105083.95
Maximum 124573.51
Spread ( max - min ) 19489.56
Range [ ( max - min ) / 2 * 100% ] 8.55%
Standard Deviation 2439.1604
5th Percentile 110137.53
95th Percentile 118166.47
( 95th Percentile - 5th Percentile ) 8028.94
Mean Distribution
Standard Deviation 10.9091
95.00% Confidence Intervall ( 113977.77 - 114020.53 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1758
0.1 Scale Factor Error with Delta=300 50788
0.05 Scale Factor Error with Delta=300 203153
0.01 Scale Factor Error with Delta=300 5078838
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113999.15
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49736279.85
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 326.54
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.50 shadow_word_death,if=active_enemies<=5
F 56.01 mind_blast,if=active_enemies<=6&cooldown_react
G 45.76 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.64 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 24.62 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.72 halo,if=talent.halo.enabled
M 13.45 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.50 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.57 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.42 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 29.16 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGFHHLTFTTIGHGFHMFTQQQQQQQFWWWWWHHFGMTTQFLHHFIGIGTQFWWWFHHMTIGFTHHIFGTIGLWFHHTFMTIGFHHGTFTGGWHHFMTLTTFHHFGGTQFWWWWHHQFIDFGTTHHFIGLTIFBGMHHFGTTFHGHTFIGMWWFLHFHGTFMTHGHTFIGTGWFHHTIFGLTHHGFMTIGWWWFHHTFTIGHHIFGMLTFIGHHTIFGTTFHHGMTQIFGWFWWWHHLFIGMTTFHHIFGTIGTBGWFHHMTIGQFTLEEHGHFMTEEFGHQQHFDEEGTTFIEDEGHHFTIEEG9LFHHDEEGTFTIGEDEFHHTI

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no2PT14 : 114227 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
114227.2 114227.2 20.35 / 0.02% 3791 / 3.3% 20.3 5451.6 5397.3 Mana 0.28% 45.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311609|244828|141799|141376|94803|91822|79231|47398&chds=0,623217&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311609++devouring_plague,9482C9,0,0,15|t++244828++halo,9482C9,1,0,15|t++141799++shadow_word_pain,9482C9,2,0,15|t++141376++vampiric_touch,9482C9,3,0,15|t++94803++shadow_word_death,9482C9,4,0,15|t++91822++mind_blast,9482C9,5,0,15|t++79231++mind_spike,4A79D3,6,0,15|t++47398++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,12,10,7,6,6,5,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:466676666542468465664200zxwvtttuuuvvusrqpnmmmlmmnonmmmmjhggggghhhggggfeefeegijkkkkkjjjjihhhhhhihgfeeeddeefghijihhhgffghhijjkllllllklmnnnopommmllkjihhhhhhiiiiiiihhhhiijkllkjijjjkjjijklmmlllkkkkllkjjjjkkkjjjiihiijjkkllllllkkkjjjjkkkihgffeddddefghjjkklllmnnoopqrrqqponlkjihhgghhhhgggffeeefgghhhghiihhhghhiijkjjjiihiihhghhiiiihhhhgggghijklmmmnnnnnnnnooppnmljjjjjjjklmnpopppqqrstvuvuuuutsrqppoooonoooonnnnnmmmllllllkjkklkkjjjjjjjkklmmmmopoooppqqqrrssssssrrrrsssssssrrrqppppppommmlkkkjjjjkklmnooooqsuuuvuuvvwwwwvvuutssrrrqqqqrrrqqqpppoonnnnmnnnmlmmlllllllll&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6341,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=114227|max=180137&chxp=1,1,63,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,40,40,56,80,144,240,344,384,432,800,1016,1264,1456,1856,2176,2400,2480,2576,2752,2920,2744,3056,3120,2592,2432,2144,1872,1624,1440,1288,1128,712,648,496,424,216,240,104,72,40,56,24,16,0,16,0,0,0,8&chds=0,3120&chbh=5&chxt=x&chxl=0:|min=106726|avg=114227|max=124098&chxp=0,1,43,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.9,17.1,16.8,15.2,12.1,4.7,3.8,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 103.3s|mind_spike 77.2s|shadow_word_pain 75.9s|vampiric_touch 68.7s|mind_blast 54.6s|devouring_plague 21.3s|shadow_word_death 17.0s|halo 12.5s|shadowfiend 2.4s|waiting 1.3s&chtt=priest_90_pi_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no2PT14 114227
devouring_plague 5558 (14718) 4.9% (12.9%) 18.4 25.40sec 361361 311609 112507 233100 136362 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.37 18.37 0.00 0.00 1.1597 0.0000 2504452.89 2504452.89 0.00 311608.64 311608.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.73 80.22% 112507.33 102399 137090 112530.48 105778 120018 1657475 1657475 0.00
crit 3.63 19.78% 233099.84 210941 282405 229254.30 0 282405 846978 846978 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2185 1.9% 43.7 9.70sec 22558 0 18615 38530 22591 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.70 43.64 0.00 0.00 0.0000 0.0000 985802.16 985802.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.92 80.03% 18615.12 17006 22766 18616.55 17576 19792 650123 650123 0.00
crit 8.71 19.97% 38530.20 35032 46897 38521.34 0 46897 335679 335679 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6976 6.1% 18.4 25.40sec 171319 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.8 18571 38430 22505 19.8% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.37 18.37 139.81 139.81 0.0000 0.7382 3146385.82 3146385.82 0.00 30487.05 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.37 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.1 80.19% 18571.13 17006 22766 18572.66 17807 19483 2082133 2082133 0.00
crit 27.7 19.81% 38430.02 35032 46897 38430.69 36185 40957 1064253 1064253 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6768) 0.0% (5.9%) 10.9 42.71sec 278821 244828 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 10.94 0.00 0.00 1.1389 0.0000 0.00 0.00 0.00 244828.25 244828.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.77 80.14% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 19.86% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6768 5.9% 10.9 42.71sec 278821 0 115076 238129 139411 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 21.87 0.00 0.00 0.0000 0.0000 3049580.73 3049580.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.55 80.22% 115075.96 104363 139821 115104.18 107719 122673 2019473 2019473 0.00
crit 4.33 19.78% 238128.88 214987 288030 235694.46 0 288030 1030108 1030108 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.71sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.94 230.39 0.00 0.00 0.0000 0.0000 0.00 45053515.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.47 77.03% 0.00 0 0 0.00 0 0 0 27866033 100.00
crit 52.92 22.97% 0.00 0 0 0.00 0 0 0 17187483 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11115 9.7% 46.0 9.77sec 109008 91822 89955 186286 109009 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.97 45.97 0.00 0.00 1.1872 0.0000 5010988.41 5010988.41 0.00 91821.75 91821.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.88 80.22% 89955.03 82079 110390 89969.70 87086 93181 3317272 3317272 0.00
crit 9.09 19.78% 186286.46 169082 227403 186348.19 0 215303 1693717 1693717 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8268 (10864) 7.2% (9.5%) 66.9 6.51sec 73173 47398 0 0 0 0.0% 0.0% 0.0% 0.0% 126.9 24165 50110 29368 20.1% 0.0% 19.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.90 66.90 126.86 126.86 1.5438 0.6948 3725751.02 3725751.02 0.00 47397.86 47397.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.4 79.95% 24165.50 21797 29181 24172.47 23111 25110 2450970 2450970 0.00
crit 25.4 20.05% 50109.66 44901 60113 50118.25 46465 54748 1274781 1274781 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2595 2.3% 39.8 10.64sec 29400 0 24183 50141 29414 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.77 39.76 0.00 0.00 0.0000 0.0000 1169357.76 1169357.76 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.74 79.85% 24183.21 21797 29181 24188.91 22633 25611 767673 767673 0.00
crit 8.01 20.15% 50141.22 44901 60113 50126.51 0 60113 401685 401685 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13567 11.9% 66.7 6.54sec 91660 79231 75550 156569 91660 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.73 66.73 0.00 0.00 1.1569 0.0000 6116884.72 6116884.72 0.00 79231.18 79231.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.47 80.12% 75550.04 68964 93036 75560.62 72521 78710 4039280 4039280 0.00
crit 13.27 19.88% 156569.36 142066 191655 156604.95 143042 173583 2077605 2077605 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3582 3.1% 14.7 4.92sec 109944 94803 90126 186973 109946 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 1.1597 0.0000 1616020.39 1616020.39 0.00 94803.50 94803.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.69 79.54% 90126.50 79678 107383 90192.64 83141 98967 1053660 1053660 0.00
crit 3.01 20.46% 186972.95 164137 221210 180254.26 0 221210 562360 562360 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18316 (23884) 16.0% (20.9%) 65.7 6.85sec 163784 141799 0 0 0 0.0% 0.0% 0.0% 0.0% 473.0 14384 29790 17450 19.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.72 65.72 473.02 473.02 1.1550 1.8549 8254469.35 8254469.35 0.00 11290.72 141799.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.72 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 378.9 80.09% 14383.51 12783 17966 14386.44 14025 14750 5449298 5449298 0.00
crit 94.2 19.91% 29790.04 26333 37009 29795.19 28570 31106 2805171 2805171 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5568 4.9% 147.8 3.02sec 16977 0 13999 29004 16992 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.81 147.68 0.00 0.00 0.0000 0.0000 2509369.84 2509369.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 118.22 80.05% 13999.43 12783 17110 14002.21 13578 14430 1655060 1655060 0.00
crit 29.45 19.95% 29004.29 26333 35247 29011.85 27245 30724 854310 854310 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2243 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4523 4.0% 97.1 4.60sec 20995 0 17791 35779 21360 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.14 95.48 0.00 0.00 0.0000 0.0000 2039495.50 2039495.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.54 80.16% 17791.32 15875 22484 17795.01 17225 18451 1361804 1361804 0.00
crit 18.94 19.84% 35778.83 31750 44968 35786.03 33184 38873 677692 677692 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16499 (21533) 14.4% (18.9%) 59.2 7.52sec 163813 141376 0 0 0 0.0% 0.0% 0.0% 0.0% 380.2 16129 33411 19562 19.9% 0.0% 180.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.25 59.25 380.16 380.16 1.1587 2.1424 7436690.79 7436690.79 0.00 10990.47 141375.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.25 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.6 80.14% 16129.24 14287 20366 16132.44 15653 16671 4913761 4913761 0.00
crit 75.5 19.86% 33411.24 29431 41955 33416.08 31876 35225 2522930 2522930 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5034 4.4% 118.8 3.71sec 19098 0 15747 32638 19112 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.80 118.71 0.00 0.00 0.0000 0.0000 2268901.42 2268901.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.06 80.08% 15747.24 14287 19397 15750.95 15248 16315 1496985 1496985 0.00
crit 23.65 19.92% 32637.58 29431 39957 32643.99 30396 35700 771916 771916 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46382 / 3673
melee 46382 3.2% 31.2 12.61sec 52493 51747 45733 92427 52493 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.19 31.19 0.00 0.00 1.0145 0.0000 1637106.10 1637106.10 0.00 51746.57 51746.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.36 55.68% 45732.66 36329 55931 45751.72 41588 52310 794081 794081 0.00
crit 6.33 20.29% 92426.82 72658 111863 92346.16 0 111863 584806 584806 0.00
glance 7.50 24.04% 34445.29 27247 41949 34442.01 0 41949 258220 258220 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1377 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.35%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.16% 20.16%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.16%

    Trigger Attempt Success

    • trigger_pct:15.56%
glyph_mind_spike 37.4 29.3 11.8sec 6.5sec 50.62% 72.90%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.59%
  • glyph_mind_spike_2:19.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.3sec 20.2sec 44.41% 44.85%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.41%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.33% 42.33%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.33%

    Trigger Attempt Success

    • trigger_pct:14.45%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.53% 20.57%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.52% 49.44%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.52%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 44.5 30.5 9.9sec 5.9sec 44.07% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.18%
  • surge_of_darkness_2:10.89%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.57%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no2PT14
devouring_plague Shadow Orb 18.4 55.1 3.0 3.0 120453.1
halo Mana 10.9 416920.6 38118.7 38118.7 7.3
mind_blast Mana 46.0 397639.6 8650.1 8650.2 12.6
mind_flay Mana 66.9 189966.6 2839.6 2839.6 25.8
shadow_word_death Mana 14.7 110332.2 7506.1 7506.4 14.6
shadow_word_pain Mana 65.7 830709.6 12640.2 12640.2 13.0
vampiric_touch Mana 59.2 512902.9 8656.9 8656.9 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.19 140373.23 (5.77%) 4500.97 140313.01 49.99%
Shadow Orbs from Mind Blast Shadow Orb 45.97 45.97 (86.08%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.43 7.43 (13.92%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.45 0.00 (-nan%) 0.00 2547477.50 100.00%
Vampiric Touch Mana Mana 498.87 1883778.18 (77.40%) 3776.06 753322.14 28.57%
mp5_regen Mana 1803.34 409824.42 (16.84%) 227.26 131177.91 24.25%
Resource RPS-Gain RPS-Loss
Mana 5397.32 5451.64
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 275511.23 139860.00 300000.00
Shadow Orb 1.30 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.4%
shadowfiend-Mana Cap 24.4%
lightwell-Mana Cap 24.4%

Procs

Count Interval
Shadowy Recall Extra Tick 349.8 1.3sec
Shadowy Apparition Procced 97.1 4.6sec
FDCL Mind Spike proc 74.9 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 114227.19
Minimum 106726.11
Maximum 124097.57
Spread ( max - min ) 17371.45
Range [ ( max - min ) / 2 * 100% ] 7.60%
Standard Deviation 2321.9281
5th Percentile 110527.59
95th Percentile 118109.34
( 95th Percentile - 5th Percentile ) 7581.75
Mean Distribution
Standard Deviation 10.3848
95.00% Confidence Intervall ( 114206.84 - 114247.55 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1587
0.1 Scale Factor Error with Delta=300 46023
0.05 Scale Factor Error with Delta=300 184094
0.01 Scale Factor Error with Delta=300 4602366
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 114227.19
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49834150.80
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 342.96
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.59 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.70 shadow_word_death,if=active_enemies<=5
F 48.13 mind_blast,if=active_enemies<=6&cooldown_react
G 44.92 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.69 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.30 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.94 halo,if=talent.halo.enabled
M 13.77 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.76 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.22 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 48.43 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 44.43 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.80 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTJFRRTGGHFHMRTWWWRFHTHGJRQFRLTHRFGHMTGQFRRWHHFJRTRGQFTHHJRGFJJLJMRFGHHJRTFGRTHHQFMGRRTQFCGWWHHTFLTGTRTQFHHMGJRTFRGWWRWFHHTQFJMRGHHGFLJRTBFRHGHRGFMRTHFHTRTGQFGJRWHHLFMTGQFRHHRGTFTRGCWGFHHMRRRTFRTLGHGFHTRWRFMRHHTGFRTRRGJFHHRTFGLMHGFHTTFGHHRRTGFMRWWWWHFGHTLTFRTHJGHRFGMTGBCRFHHRTFGTEEGHFHJDJEELFGRHGEDEFHHJRTEEFGHGHDEER9FRHRTEDEFGGHLTEEFHMRR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no4PT14 : 117406 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
117405.8 117405.8 20.37 / 0.02% 3880 / 3.3% 20.8 5454.0 5400.1 Mana 0.28% 45.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311714|245301|154018|141475|94586|91930|79247|47335&chds=0,623428&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++311714++devouring_plague,9482C9,0,0,15|t++245301++halo,9482C9,1,0,15|t++154018++shadow_word_pain,9482C9,2,0,15|t++141475++vampiric_touch,9482C9,3,0,15|t++94586++shadow_word_death,9482C9,4,0,15|t++91930++mind_blast,9482C9,5,0,15|t++79247++mind_spike,4A79D3,6,0,15|t++47335++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,12,10,7,6,6,5,5,5,4,3,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:465666666532468465675200zxwvuttuuuwvutrqponmmmmnnonnmmmjhggghhhhhghhgfeffffgijkkkkkkjjjihhhhhhiigffeeeeeefghijihhhhgfgiiijkklllllllmmnnooponmmmllkjihhhhiiiiiiiihhhhijklllkjjjkkkkjjjklmmllllkkkllkkjjkkkkkkjjiiijjjklllllllkkkjjjjkkkjhgffeeddeefhijjkklllmnnooqqrrqqponlljjhhhhhhhhhggfffeefghhihhhiiihhhhiijjkkjjjiiijihhiijjiiiiihhgghijkllmmnnnnnnnnnooppomljjjjjjjklmopopppqqrstvuuuuuutsrqpppoooooooooonnnnmmllllllkjkklkkkjjjjjjkklmmnnoppooppqqqrrssstsssrrrssssssssrrqqppppponmmmllkkjjjklmmnoopprsuuuuuuvvwwwwvvuutssrrrqqrrrrrqqqppppponoonnoonmmmlllllkkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6382,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=117406|max=183964&chxp=1,1,64,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,48,80,88,56,128,152,248,520,472,752,832,1080,1248,1480,1952,2016,2448,2368,2304,2872,2976,2672,2752,2488,2600,2336,1968,1784,1592,1464,1320,856,824,656,656,408,424,200,272,168,128,64,80,56,40,8,0,24&chds=0,2976&chbh=5&chxt=x&chxl=0:|min=109873|avg=117406|max=125864&chxp=0,1,47,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.9,17.1,16.9,15.2,12.1,4.7,3.8,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 103.4s|mind_spike 77.1s|shadow_word_pain 76.0s|vampiric_touch 68.6s|mind_blast 54.5s|devouring_plague 21.3s|shadow_word_death 17.0s|halo 12.5s|shadowfiend 2.4s|waiting 1.3s&chtt=priest_90_pi_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no4PT14 117406
devouring_plague 5558 (14713) 4.7% (12.5%) 18.3 25.42sec 361496 311714 112528 232906 136524 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 0.00 0.00 1.1597 0.0000 2505168.75 2505168.75 0.00 311713.79 311713.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.69 80.07% 112528.40 102399 137090 112552.88 105993 118471 1653226 1653226 0.00
crit 3.66 19.93% 232905.75 210941 282405 228807.08 0 282405 851942 851942 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2186 1.9% 43.7 9.70sec 22549 0 18615 38552 22578 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.72 43.66 0.00 0.00 0.0000 0.0000 985726.91 985726.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.98 80.12% 18614.68 17006 22766 18616.78 17699 19825 651111 651111 0.00
crit 8.68 19.88% 38551.86 35032 46897 38544.71 0 44793 334616 334616 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6969 5.9% 18.3 25.42sec 171251 0 0 0 0 0.0% 0.0% 0.0% 0.0% 139.6 18572 38430 22507 19.8% 0.0% 22.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.35 18.35 139.62 139.62 0.0000 0.7383 3142373.86 3142373.86 0.00 30484.22 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.0 80.19% 18572.36 17006 22766 18573.46 17759 19436 2079259 2079259 0.00
crit 27.7 19.81% 38430.28 35032 46897 38431.38 36169 41311 1063115 1063115 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6786) 0.0% (5.8%) 10.9 42.70sec 279314 245301 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 10.95 0.00 0.00 1.1387 0.0000 0.00 0.00 0.00 245301.32 245301.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.80 80.41% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.59% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6786 5.8% 10.9 42.70sec 279314 0 115100 238188 139659 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 21.89 0.00 0.00 0.0000 0.0000 3057435.64 3057435.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.52 80.05% 115100.44 104363 139821 115129.07 107930 123231 2017124 2017124 0.00
crit 4.37 19.95% 238188.13 214987 288030 235649.37 0 288030 1040311 1040311 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.70sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.95 230.44 0.00 0.00 0.0000 0.0000 0.00 45064256.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 177.56 77.05% 0.00 0 0 0.00 0 0 0 27884112 100.00
crit 52.88 22.95% 0.00 0 0 0.00 0 0 0 17180144 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11126 9.5% 45.9 9.78sec 109131 91930 89943 186366 109131 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.94 45.94 0.00 0.00 1.1871 0.0000 5013944.14 5013944.14 0.00 91929.82 91929.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.80 80.10% 89942.87 82079 110390 89957.82 86423 93216 3310043 3310043 0.00
crit 9.14 19.90% 186366.45 169082 227403 186380.45 169082 210779 1703902 1703902 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 8272 (10860) 7.0% (9.2%) 66.9 6.51sec 73087 47335 0 0 0 0.0% 0.0% 0.0% 0.0% 126.9 24161 50127 29360 20.0% 0.0% 19.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.94 66.94 126.94 126.94 1.5440 0.6948 3726850.63 3726850.63 0.00 47335.32 47335.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.5 79.98% 24160.65 21797 29181 24168.39 23262 25290 2452756 2452756 0.00
crit 25.4 20.02% 50127.10 44901 60113 50144.12 46331 54792 1274095 1274095 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2589 2.2% 39.7 10.69sec 29373 0 24191 50167 29387 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.70 39.68 0.00 0.00 0.0000 0.0000 1165965.14 1165965.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.74 80.00% 24190.97 21797 29181 24199.69 22586 26160 767839 767839 0.00
crit 7.94 20.00% 50166.74 44901 60113 50185.23 0 60113 398126 398126 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13551 11.6% 66.7 6.54sec 91675 79247 75566 156476 91676 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.65 66.65 0.00 0.00 1.1568 0.0000 6110304.33 6110304.33 0.00 79246.54 79246.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 53.38 80.09% 75566.35 68964 93036 75574.15 72252 79159 4033825 4033825 0.00
crit 13.27 19.91% 156476.13 142066 191655 156486.53 143824 171633 2076479 2076479 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3574 3.0% 14.7 4.92sec 109685 94586 90073 187051 109684 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 1.1597 0.0000 1611928.78 1611928.78 0.00 94585.66 94585.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.72 79.78% 90072.73 79678 107383 90137.98 82934 100169 1056008 1056008 0.00
crit 2.97 20.22% 187051.07 164137 221210 179809.72 0 221210 555921 555921 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19919 (25971) 17.0% (22.1%) 65.8 6.84sec 177889 154018 0 0 0 0.0% 0.0% 0.0% 0.0% 473.0 14381 29750 18977 29.9% 0.0% 194.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.79 65.79 473.01 473.01 1.1550 1.8548 8976227.72 8976227.72 0.00 12276.63 154017.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 331.6 70.10% 14381.28 12783 17966 14384.27 14062 14808 4768545 4768545 0.00
crit 141.4 29.90% 29750.47 26333 37009 29756.32 28725 30790 4207683 4207683 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6052 5.2% 147.8 3.02sec 18451 0 13997 28953 18468 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.81 147.68 0.00 0.00 0.0000 0.0000 2727280.54 2727280.54 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.54 70.11% 13997.30 12783 17110 14000.53 13544 14556 1449216 1449216 0.00
crit 44.14 29.89% 28952.69 26333 35247 28958.63 27524 30521 1278064 1278064 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2245 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5605 4.8% 120.4 3.72sec 20996 0 17785 35780 21356 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.36 118.33 0.00 0.00 0.0000 0.0000 2527115.12 2527115.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.85 80.16% 17784.68 15875 22484 17788.67 17307 18333 1686915 1686915 0.00
crit 23.48 19.84% 35779.82 31750 44968 35788.47 33214 38653 840200 840200 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16500 (21543) 14.1% (18.4%) 59.2 7.52sec 163919 141475 0 0 0 0.0% 0.0% 0.0% 0.0% 380.2 16130 33414 19563 19.9% 0.0% 180.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.24 59.24 380.18 380.18 1.1586 2.1424 7437689.01 7437689.01 0.00 10995.90 141475.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.7 80.13% 16130.03 14287 20366 16133.50 15587 16679 4914160 4914160 0.00
crit 75.5 19.87% 33413.69 29431 41955 33419.13 31858 35043 2523529 2523529 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5044 4.3% 119.0 3.70sec 19095 0 15747 32630 19112 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.04 118.94 0.00 0.00 0.0000 0.0000 2273164.37 2273164.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.24 80.07% 15747.31 14287 19397 15751.06 15263 16405 1499730 1499730 0.00
crit 23.70 19.93% 32630.01 29431 39957 32638.61 30430 35460 773434 773434 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46420 / 3676
melee 46420 3.1% 31.2 12.60sec 52521 51782 45744 92377 52522 20.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.19 31.19 0.00 0.00 1.0143 0.0000 1638135.68 1638135.68 0.00 51782.38 51782.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.35 55.61% 45743.72 36329 55931 45763.04 41145 51709 793481 793481 0.00
crit 6.35 20.37% 92377.03 72658 111863 92329.48 0 111863 587045 587045 0.00
glance 7.49 24.01% 34399.07 27247 41949 34397.45 0 41949 257609 257609 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1379 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.35%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.63%
glyph_mind_spike 37.4 29.2 11.8sec 6.5sec 50.74% 72.85%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.68%
  • glyph_mind_spike_2:19.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.3sec 20.2sec 44.40% 44.87%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.40%

    Trigger Attempt Success

    • trigger_pct:1.71%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.33% 42.33%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.33%

    Trigger Attempt Success

    • trigger_pct:14.52%
power_infusion 4.3 0.0 121.4sec 121.1sec 18.53% 20.56%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.51% 49.48%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.51%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 44.5 30.4 9.9sec 5.9sec 44.08% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.20%
  • surge_of_darkness_2:10.88%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.38% 77.53%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no4PT14
devouring_plague Shadow Orb 18.3 55.0 3.0 3.0 120499.0
halo Mana 10.9 417207.0 38114.2 38114.2 7.3
mind_blast Mana 45.9 397416.4 8650.0 8650.0 12.6
mind_flay Mana 66.9 190084.7 2839.4 2839.4 25.7
shadow_word_death Mana 14.7 110301.2 7505.3 7505.6 14.6
shadow_word_pain Mana 65.8 831647.3 12640.8 12640.7 14.1
vampiric_touch Mana 59.2 512886.2 8657.5 8657.5 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.19 140237.20 (5.76%) 4496.19 140474.96 50.04%
Shadow Orbs from Mind Blast Shadow Orb 45.94 45.94 (86.09%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.42 7.42 (13.91%) 1.00 0.00 0.00%
Devouring Plague Health Health 183.27 0.00 (-nan%) 0.00 2545060.12 100.00%
Vampiric Touch Mana Mana 499.12 1885143.18 (77.41%) 3776.91 752776.02 28.54%
mp5_regen Mana 1803.34 409829.03 (16.83%) 227.26 131173.31 24.25%
Resource RPS-Gain RPS-Loss
Mana 5400.06 5454.01
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 275671.31 138360.00 300000.00
Shadow Orb 1.32 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 24.4%
shadowfiend-Mana Cap 24.4%
lightwell-Mana Cap 24.4%

Procs

Count Interval
Shadowy Recall Extra Tick 350.0 1.3sec
Shadowy Apparition Procced 120.4 3.7sec
FDCL Mind Spike proc 74.9 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 117405.76
Minimum 109873.49
Maximum 125864.43
Spread ( max - min ) 15990.94
Range [ ( max - min ) / 2 * 100% ] 6.81%
Standard Deviation 2324.0769
5th Percentile 113647.01
95th Percentile 121407.87
( 95th Percentile - 5th Percentile ) 7760.86
Mean Distribution
Standard Deviation 10.3944
95.00% Confidence Intervall ( 117385.38 - 117426.13 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1505
0.1 Scale Factor Error with Delta=300 46108
0.05 Scale Factor Error with Delta=300 184435
0.01 Scale Factor Error with Delta=300 4610888
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 117405.76
Distribution Chart

Damage

Sample Data
Count 49992
Mean 51261174.94
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 342.97
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.58 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.70 shadow_word_death,if=active_enemies<=5
F 48.10 mind_blast,if=active_enemies<=6&cooldown_react
G 44.88 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.68 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.26 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.95 halo,if=talent.halo.enabled
M 13.77 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.76 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.17 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 48.39 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 44.54 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.91 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTRTFTGGHHFMJRTWWFRWHHGJRFRTLTFHHGMGRQFTWWWHFHTGFMHRHTGLFTWWGHFHTJFMRTHGGHFRTCGWWFHHLRTGRQFMRRTHRGFHTGWWWWFHHRTQFTGJHHGFJLMRTBFWHGHTQFJRTRTHFHGJGJDFRWWWHHLFRTRRGTFMHHGRTFTGCGWFHHRTRTFMTLTGGFHHRTWRFRTHHGJFMJRTGQFHHJRRGFJLRHHFGJMRTRFGRHHRTFGJRWWWRFGHHJMRTFLTHGFHGJRTFBCGHHMTFTRGTEEFGHHJLDEEGJFHHJEDEFGRTEEFGHHMTEE9GFRHHJEDEFGJLRRGEEFHHMT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no2PT14 : 110453 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
110453.4 110453.4 17.84 / 0.02% 3359 / 3.0% 16.9 5958.9 5891.0 Mana 0.29% 39.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:308159|243775|140512|119646|94486|86129|48663&chds=0,616319&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++308159++devouring_plague,9482C9,0,0,15|t++243775++halo,9482C9,1,0,15|t++140512++vampiric_touch,9482C9,2,0,15|t++119646++shadow_word_pain,9482C9,3,0,15|t++94486++shadow_word_death,9482C9,4,0,15|t++86129++mind_blast,9482C9,5,0,15|t++48663++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,16,13,10,9,7,6,6,5,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mindbender: melee|mind_blast|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague|shadowy_apparition|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb_no2PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024786565431346243441ywurpqomlmnooqqrqponmmmmmmllmlkihhfeccdefhikklmmmmmmnmmoqoonmkihfedcdcdeeffgecdcccddefgghffedccdcghjkmnpqqrrrqrsstttsspnlkihffedcbbccdccddedeeefhihhiiihgggghgfeffghghhiiiiiiijjjikllmmlkkihhgghhiihhhhgfeddefgghffedccedddehikmlnnooopqqrstssssronlikhhfedddededdccccbcdfeefeeeeeeeffgghijlklllmmnnmmmnnnnmlkjihigffffghiijjkkkkkkllmlmmkjihgeffeeefghiikklmoqrsstuvvvvuusrpqponmkkjkjkjjjjjjijjjiiihhiiiiihiijjjkmmnoqrsuvuutvvwvvvuuutttsrqpppppqqqqqqpppopooonllkjiihhhiijkmmpqrstwyz0022222210zxxwvutrqqppooooonnnnnonnnmllllkkjiijjjiiiiiihh&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6169,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110453|max=179047&chxp=1,1,62,100&chtt=priest_90_pi_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,16,16,24,96,160,136,184,376,400,632,816,928,1160,1568,1808,2064,2456,2504,2872,2840,3184,2896,2672,2728,2568,2136,1880,2040,1824,1464,1288,976,656,616,360,544,328,224,176,112,88,64,32,16,16,16,8,8&chds=0,3184&chbh=5&chxt=x&chxl=0:|min=103454|avg=110453|max=118313&chxp=0,1,47,100&chtt=priest_90_pi_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.8,20.6,15.2,11.1,4.2,3.8,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 161.4s|shadow_word_pain 92.7s|vampiric_touch 68.3s|mind_blast 49.9s|devouring_plague 18.8s|shadow_word_death 16.9s|halo 12.6s|mindbender 7.9s|waiting 1.3s&chtt=priest_90_pi_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no2PT14 110453
devouring_plague 4901 (12812) 4.4% (11.6%) 16.2 28.52sec 356778 308159 112433 232626 136430 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 0.00 0.00 1.1578 0.0000 2209424.97 2209424.97 0.00 308159.40 308159.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.96 80.04% 112433.15 102399 137090 112468.50 106085 119480 1457349 1457349 0.00
crit 3.23 19.96% 232626.47 210941 282405 225783.05 0 282405 752076 752076 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1888 1.7% 37.9 10.93sec 22469 0 18547 38403 22505 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.90 37.83 0.00 0.00 0.0000 0.0000 851484.96 851484.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.29 80.06% 18546.76 17006 22766 18548.32 17459 19908 561812 561812 0.00
crit 7.54 19.94% 38402.95 35032 46897 38349.14 0 44793 289673 289673 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6023 5.5% 16.2 28.52sec 167774 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.9 18534 38358 22468 19.8% 0.0% 19.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 120.93 120.93 0.0000 0.7358 2717078.79 2717078.79 0.00 30534.46 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.9 80.15% 18533.64 17006 22766 18534.40 17677 19587 1796381 1796381 0.00
crit 24.0 19.85% 38357.53 35032 46897 38354.47 35720 41575 920698 920698 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6833) 0.0% (6.2%) 11.0 42.33sec 278918 243775 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 11.04 0.00 0.00 1.1442 0.0000 0.00 0.00 0.00 243775.04 243775.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.85 80.20% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.19 19.80% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6833 6.2% 11.0 42.33sec 278918 0 115072 237997 139457 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 22.08 0.00 0.00 0.0000 0.0000 3078635.00 3078635.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.70 80.16% 115072.31 104363 139821 115103.57 106734 122292 2036312 2036312 0.00
crit 4.38 19.84% 237997.39 214987 288030 235979.13 0 288030 1042323 1042323 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.33sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.04 233.00 0.00 0.00 0.0000 0.0000 0.00 45535902.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.54 77.05% 0.00 0 0 0.00 0 0 0 28178969 100.00
crit 53.47 22.95% 0.00 0 0 0.00 0 0 0 17356934 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9527 8.6% 39.4 11.44sec 109060 86129 89854 186013 109060 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.40 39.40 0.00 0.00 1.2662 0.0000 4297170.30 4297170.30 0.00 86129.45 86129.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.53 80.03% 89854.47 82079 110390 89871.76 86396 93101 2833325 2833325 0.00
crit 7.87 19.97% 186013.03 169082 227403 186003.53 0 227403 1463846 1463846 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13291 (17448) 12.0% (15.8%) 100.2 4.39sec 78411 48663 0 0 0 0.0% 0.0% 0.0% 0.0% 204.5 24096 49952 29273 20.0% 0.0% 31.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.19 100.19 204.45 204.45 1.6113 0.7028 5984751.57 5984751.57 0.00 48662.55 48662.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.5 79.98% 24096.00 21797 29181 24101.33 23506 24880 3940169 3940169 0.00
crit 40.9 20.02% 49952.43 44901 60113 49962.98 47575 52702 2044583 2044583 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4157 3.8% 63.9 6.77sec 29271 0 24107 49994 29285 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.93 63.90 0.00 0.00 0.0000 0.0000 1871379.48 1871379.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.12 79.99% 24106.63 21797 29181 24111.90 23055 25692 1232251 1232251 0.00
crit 12.78 20.01% 49994.46 44901 60113 49997.00 44901 57859 639129 639129 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1442 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3550 3.2% 14.6 4.94sec 109666 94486 90137 186872 109667 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1607 0.0000 1601068.25 1601068.25 0.00 94486.18 94486.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.65 79.81% 90136.99 79678 107383 90218.77 80380 97776 1050282 1050282 0.00
crit 2.95 20.19% 186872.21 164137 221210 179985.50 0 221210 550786 550786 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18874 (24615) 17.1% (22.3%) 80.1 5.61sec 138577 119646 0 0 0 0.0% 0.0% 0.0% 0.0% 487.7 14373 29773 17441 19.9% 0.0% 194.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.06 80.06 487.73 487.73 1.1582 1.8013 8506268.91 8506268.91 0.00 11422.33 119646.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.06 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 390.6 80.08% 14372.93 12783 17966 14375.78 14051 14698 5613686 5613686 0.00
crit 97.2 19.92% 29773.47 26333 37009 29780.05 28779 30979 2892583 2892583 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5741 5.2% 152.5 2.93sec 16968 0 13999 28992 16983 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.52 152.39 0.00 0.00 0.0000 0.0000 2587913.13 2587913.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.06 80.10% 13999.07 12783 17110 14001.34 13615 14471 1708727 1708727 0.00
crit 30.33 19.90% 28991.58 26333 35247 28997.88 27394 31035 879186 879186 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4593 4.2% 98.6 4.53sec 21004 0 17787 35765 21370 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.60 96.91 0.00 0.00 0.0000 0.0000 2071039.45 2071039.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.59 80.07% 17786.90 15875 22484 17790.73 17200 18447 1380166 1380166 0.00
crit 19.32 19.93% 35764.67 31750 44968 35771.15 32768 39231 690874 690874 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16316 (21305) 14.8% (19.3%) 58.8 7.57sec 163268 140512 0 0 0 0.0% 0.0% 0.0% 0.0% 375.9 16133 33410 19561 19.8% 0.0% 178.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.80 58.80 375.89 375.89 1.1619 2.1462 7352962.66 7352962.66 0.00 10971.65 140512.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.3 80.16% 16133.28 14287 20366 16136.11 15661 16665 4861043 4861043 0.00
crit 74.6 19.84% 33410.43 29431 41955 33416.21 31907 35205 2491919 2491919 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4989 4.5% 117.7 3.74sec 19102 0 15755 32637 19117 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.68 117.59 0.00 0.00 0.0000 0.0000 2247956.66 2247956.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.17 80.09% 15755.39 14287 19397 15758.38 15139 16298 1483685 1483685 0.00
crit 23.42 19.91% 32636.77 29431 39957 32645.85 30031 35389 764272 764272 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37658 / 9770
melee 37658 8.8% 105.4 4.17sec 41748 39153 36488 73494 41748 20.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.38 105.38 0.00 0.00 1.0663 0.0000 4399576.00 4399576.00 0.00 39153.28 39153.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.84 55.84% 36487.86 29063 44745 36498.54 34712 38549 2147063 2147063 0.00
crit 21.19 20.11% 73493.74 58126 89490 73515.09 67406 80588 1557410 1557410 0.00
glance 25.35 24.05% 27421.38 21797 33559 27429.37 24750 29850 695103 695103 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 1.1244 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.24%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.73%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.5 36.3sec 20.1sec 44.56% 45.12%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.56%

    Trigger Attempt Success

    • trigger_pct:1.73%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.43% 42.43%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.43%

    Trigger Attempt Success

    • trigger_pct:14.33%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.51%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.48% 49.54%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.48%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.91%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no2PT14
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 118925.1
halo Mana 11.0 418728.5 37936.0 37936.0 7.4
mind_blast Mana 39.4 343428.2 8716.0 8716.0 12.5
mind_flay Mana 100.2 286176.5 2856.3 2856.3 27.5
shadow_word_death Mana 14.6 109723.7 7515.3 7515.6 14.6
shadow_word_pain Mana 80.1 1018702.9 12724.7 12724.5 10.9
vampiric_touch Mana 58.8 510452.6 8680.4 8680.5 18.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.38 284924.43 (10.73%) 2703.68 176757.15 38.29%
Shadow Orbs from Mind Blast Shadow Orb 39.40 39.40 (84.25%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.75%) 1.00 0.00 0.00%
Devouring Plague Health Health 158.76 0.00 (-nan%) 0.00 2204695.97 100.00%
Vampiric Touch Mana Mana 493.48 1947853.90 (73.32%) 3947.19 660260.18 25.32%
mp5_regen Mana 1803.34 423805.37 (15.95%) 235.01 117196.96 21.66%
Resource RPS-Gain RPS-Loss
Mana 5890.95 5958.87
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 269368.87 98172.38 300000.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.8%
shadowfiend-Mana Cap 21.8%
lightwell-Mana Cap 21.8%

Procs

Count Interval
Shadowy Recall Extra Tick 371.7 1.2sec
Shadowy Apparition Procced 98.6 4.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no2PT14 Damage Per Second
Count 49992
Mean 110453.44
Minimum 103453.94
Maximum 118313.47
Spread ( max - min ) 14859.52
Range [ ( max - min ) / 2 * 100% ] 6.73%
Standard Deviation 2035.0118
5th Percentile 107192.22
95th Percentile 113909.82
( 95th Percentile - 5th Percentile ) 6717.60
Mean Distribution
Standard Deviation 9.1016
95.00% Confidence Intervall ( 110435.60 - 110471.28 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1303
0.1 Scale Factor Error with Delta=300 35352
0.05 Scale Factor Error with Delta=300 141409
0.01 Scale Factor Error with Delta=300 3535228
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 110453.44
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45377134.13
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 297.99
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.15 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 44.86 mind_blast,if=active_enemies<=6&cooldown_react
G 43.65 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.44 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.04 halo,if=talent.halo.enabled
M 12.04 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.86 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.31 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.40 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.41 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHFTWWWWWFHGHMTFLTHGHFGTAWWFHHMTGFTHHGTFLTWWGWFHHMTQFTHHGTFGTCGAWFHHLMTGTFTGHFHTGWWWWFHHTFTGLHHGFMTWAWFGHHTQFTHHTFGGMLWWWWFHHTGFTHHGFMTGCGAFHHTLTFTGHGHFTWWWWFHHMGTFTHHLFGTGWWWAFHHTQFGMTGHHTFTWWWLWFGHHTFMTHHGFGTGWCWFAHHTGFLMTEEHGHFTEDEGFHHTGEEQFTEDEFGHHGEE9FAHLHDEEFGTGTHEDEFHT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no4PT14 : 113630 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113630.2 113630.2 17.78 / 0.02% 3336 / 2.9% 17.4 5958.8 5891.0 Mana 0.29% 39.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:307988|243599|140490|130104|94572|86053|48634&chds=0,615976&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++307988++devouring_plague,9482C9,0,0,15|t++243599++halo,9482C9,1,0,15|t++140490++vampiric_touch,9482C9,2,0,15|t++130104++shadow_word_pain,9482C9,3,0,15|t++94572++shadow_word_death,9482C9,4,0,15|t++86053++mind_blast,9482C9,5,0,15|t++48634++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,16,13,9,9,7,6,6,5,5,5,4,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mindbender: melee|mind_blast|halo_damage|shadow_word_pain_mastery|devouring_plague_tick|shadowy_apparition|vampiric_touch_mastery|devouring_plague|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb_no4PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:024786565532356343442zxvrpqpnmmnopqqsqqponnmmmnlmmlkiihgeddeeghjklmmmnmnnonmoqopnmkjhffeddddeffghedddddddefgghgfeddcedhijlmopqqrrrrrssttustpnmkjhggedccccddcddeeeefffhiiijiiihhghhhffffghhhiiijjjjijkkjkmmmmlkkjihhhhiiiiiiiggfeeeggghgfeddceeeefhikmmonoppqrrssussttrpnmjkiigfeeeeeedddcccccefefffefffefffghijkllllmnnnnnmmnnnnmllkjhihgggggiijkkkklllllmmmmnkjihgffffeffghjjkkmmoqrsttvvvvvuusrqqponnkkkkkkkjkkjjjjjkjijihiijiiiijjjklmmnoqrsuvuuuvvwwvvvvututsrqppppqqqqqqqqpppppoonllkjijiiiijklmnpqrstwz001223332210yywvutsrqqppooooooooopooonmmmlklkjijjjiiiihhgf&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6241,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113630|max=182057&chxp=1,1,62,100&chtt=priest_90_pi_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,16,16,56,72,72,184,248,296,560,560,848,984,1264,1448,1720,2120,2600,2424,2632,2896,3104,2968,2800,2664,2552,2344,2112,2120,1472,1272,1216,960,848,600,464,448,280,224,168,104,72,80,24,8,8,24,0,16&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=106654|avg=113630|max=121506&chxp=0,1,47,100&chtt=priest_90_pi_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.8,20.6,15.2,11.1,4.2,3.8,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 161.4s|shadow_word_pain 92.7s|vampiric_touch 68.4s|mind_blast 49.9s|devouring_plague 18.7s|shadow_word_death 17.0s|halo 12.6s|mindbender 7.9s|waiting 1.3s&chtt=priest_90_pi_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no4PT14 113630
devouring_plague 4890 (12796) 4.3% (11.3%) 16.2 28.54sec 356537 307988 112422 232858 136176 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 0.00 0.00 1.1576 0.0000 2204119.31 2204119.31 0.00 307987.82 307987.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.99 80.28% 112421.89 102399 137090 112451.24 105223 119008 1460712 1460712 0.00
crit 3.19 19.72% 232858.19 210941 282405 226723.49 0 282405 743407 743407 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1883 1.7% 37.8 10.95sec 22449 0 18548 38416 22488 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.84 37.77 0.00 0.00 0.0000 0.0000 849375.67 849375.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.28 80.17% 18547.99 17006 22766 18549.99 17467 19730 561647 561647 0.00
crit 7.49 19.83% 38415.76 35032 46897 38393.05 0 44436 287729 287729 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6023 5.3% 16.2 28.54sec 167882 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.9 18536 38357 22472 19.9% 0.0% 19.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.19 120.92 120.92 0.0000 0.7359 2717272.89 2717272.89 0.00 30538.70 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.9 80.14% 18536.18 17006 22766 18537.50 17726 19524 1796288 1796288 0.00
crit 24.0 19.86% 38356.71 35032 46897 38358.68 35746 41593 920985 920985 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6828) 0.0% (6.0%) 11.0 42.34sec 278719 243599 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 11.04 0.00 0.00 1.1442 0.0000 0.00 0.00 0.00 243599.14 243599.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.83 80.02% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.98% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6828 6.0% 11.0 42.34sec 278719 0 115111 237890 139359 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 22.07 0.00 0.00 0.0000 0.0000 3076169.89 3076169.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 80.25% 115111.11 104363 139821 115148.09 107663 121922 2039097 2039097 0.00
crit 4.36 19.75% 237890.37 214987 288030 236108.42 0 288030 1037073 1037073 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.34sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.04 232.98 0.00 0.00 0.0000 0.0000 0.00 45527058.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.53 77.06% 0.00 0 0 0.00 0 0 0 28177924 100.00
crit 53.45 22.94% 0.00 0 0 0.00 0 0 0 17349135 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9514 8.4% 39.4 11.45sec 108983 86053 89835 186033 108982 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.38 39.38 0.00 0.00 1.2665 0.0000 4291484.89 4291484.89 0.00 86053.44 86053.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.54 80.10% 89835.31 82079 110390 89851.07 86300 93039 2833354 2833354 0.00
crit 7.84 19.90% 186032.52 169082 227403 186009.72 0 215595 1458131 1458131 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13290 (17436) 11.7% (15.3%) 100.2 4.39sec 78358 48634 0 0 0 0.0% 0.0% 0.0% 0.0% 204.4 24094 49938 29273 20.0% 0.0% 31.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.20 100.20 204.43 204.43 1.6112 0.7028 5984347.09 5984347.09 0.00 48634.46 48634.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 100.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 163.5 79.96% 24094.11 21797 29181 24098.85 23452 24765 3938601 3938601 0.00
crit 41.0 20.04% 49938.00 44901 60113 49951.16 47454 53215 2045746 2045746 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4146 3.6% 63.8 6.79sec 29278 0 24108 49994 29292 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.78 63.75 0.00 0.00 0.0000 0.0000 1867248.90 1867248.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.98 79.97% 24108.10 21797 29181 24114.67 22830 25531 1229051 1229051 0.00
crit 12.77 20.03% 49993.71 44901 60113 50013.07 44901 56576 638197 638197 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.71sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.93 6.93 0.00 0.00 1.1439 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.09sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3558 3.1% 14.6 4.94sec 109777 94572 90167 186780 109777 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 14.61 0.00 0.00 1.1608 0.0000 1604125.57 1604125.57 0.00 94571.72 94571.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.65 79.70% 90166.62 79678 107383 90252.41 82836 100319 1050123 1050123 0.00
crit 2.97 20.30% 186779.68 164137 221210 178427.51 0 221210 554003 554003 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 20516 (26761) 18.1% (23.6%) 80.0 5.61sec 150694 130104 0 0 0 0.0% 0.0% 0.0% 0.0% 487.7 14368 29722 18961 29.9% 0.0% 194.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.04 80.04 487.71 487.71 1.1583 1.8013 9247179.03 9247179.03 0.00 12419.52 130103.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.04 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 341.8 70.09% 14368.45 12783 17966 14371.20 14024 14770 4911699 4911699 0.00
crit 145.9 29.91% 29722.45 26333 37009 29728.29 28801 30804 4335480 4335480 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6245 5.5% 152.7 2.93sec 18435 0 13992 28946 18452 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 152.69 152.55 0.00 0.00 0.0000 0.0000 2814883.11 2814883.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 107.06 70.18% 13992.45 12783 17110 13994.78 13545 14445 1497968 1497968 0.00
crit 45.50 29.82% 28945.74 26333 35247 28952.36 27746 30327 1316916 1316916 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5660 5.0% 121.6 3.69sec 20995 0 17778 35754 21358 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 121.56 119.50 0.00 0.00 0.0000 0.0000 2552199.61 2552199.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.70 80.09% 17778.22 15875 22484 17781.80 17327 18335 1701399 1701399 0.00
crit 23.80 19.91% 35753.82 31750 44968 35761.51 33427 38367 850800 850800 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16327 (21305) 14.4% (18.8%) 58.8 7.57sec 163247 140490 0 0 0 0.0% 0.0% 0.0% 0.0% 376.0 16131 33416 19571 19.9% 0.0% 178.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.82 58.82 375.99 375.99 1.1620 2.1461 7358535.25 7358535.25 0.00 10971.08 140490.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 301.2 80.10% 16130.86 14287 20366 16133.43 15598 16734 4858006 4858006 0.00
crit 74.8 19.90% 33415.66 29431 41955 33420.68 31959 35168 2500530 2500530 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4979 4.4% 117.5 3.75sec 19103 0 15755 32648 19119 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.48 117.38 0.00 0.00 0.0000 0.0000 2244129.20 2244129.20 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.00 80.09% 15754.81 14287 19397 15757.85 15191 16335 1480986 1480986 0.00
crit 23.37 19.91% 32648.46 29431 39957 32652.37 30091 35757 763143 763143 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37668 / 9772
melee 37668 8.6% 105.4 4.17sec 41753 39159 36480 73475 41753 20.1% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.38 105.38 0.00 0.00 1.0662 0.0000 4399857.79 4399857.79 0.00 39159.27 39159.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.05 56.04% 36480.19 29063 44745 36490.15 34864 38581 2154110 2154110 0.00
crit 21.18 20.10% 73474.62 58126 89490 73492.45 64608 81538 1556114 1556114 0.00
glance 25.15 23.87% 27420.26 21797 33559 27428.37 25501 30107 689634 689634 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.44 23.44 0.00 0.00 1.1243 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.44 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.24%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.15% 20.15%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.15%

    Trigger Attempt Success

    • trigger_pct:15.66%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.3 36.4sec 20.2sec 44.29% 44.84%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.29%

    Trigger Attempt Success

    • trigger_pct:1.72%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.46% 42.46%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.46%

    Trigger Attempt Success

    • trigger_pct:14.40%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.51%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.47% 49.53%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.34% 4.34%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.34%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no4PT14
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 118844.5
halo Mana 11.0 418794.6 37945.3 37945.3 7.3
mind_blast Mana 39.4 343218.5 8716.1 8716.1 12.5
mind_flay Mana 100.2 286185.8 2856.1 2856.1 27.4
shadow_word_death Mana 14.6 109835.0 7516.2 7516.5 14.6
shadow_word_pain Mana 80.0 1018534.4 12724.9 12724.8 11.8
vampiric_touch Mana 58.8 510620.3 8680.6 8680.6 18.8
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.38 284988.59 (10.73%) 2704.41 176672.67 38.27%
Shadow Orbs from Mind Blast Shadow Orb 39.38 39.38 (84.23%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.77%) 1.00 0.00 0.00%
Devouring Plague Health Health 158.69 0.00 (-nan%) 0.00 2203647.26 100.00%
Vampiric Touch Mana Mana 493.37 1947792.23 (73.32%) 3947.92 660307.45 25.32%
mp5_regen Mana 1803.34 423809.87 (15.95%) 235.01 117192.46 21.66%
Resource RPS-Gain RPS-Loss
Mana 5890.97 5958.82
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 269398.56 126432.38 300000.00
Shadow Orb 1.20 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.8%
shadowfiend-Mana Cap 21.8%
lightwell-Mana Cap 21.8%

Procs

Count Interval
Shadowy Recall Extra Tick 371.4 1.2sec
Shadowy Apparition Procced 121.6 3.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no4PT14 Damage Per Second
Count 49992
Mean 113630.18
Minimum 106654.39
Maximum 121505.92
Spread ( max - min ) 14851.53
Range [ ( max - min ) / 2 * 100% ] 6.54%
Standard Deviation 2028.8556
5th Percentile 110389.21
95th Percentile 117060.46
( 95th Percentile - 5th Percentile ) 6671.25
Mean Distribution
Standard Deviation 9.0740
95.00% Confidence Intervall ( 113612.39 - 113647.96 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1224
0.1 Scale Factor Error with Delta=300 35138
0.05 Scale Factor Error with Delta=300 140554
0.01 Scale Factor Error with Delta=300 3513871
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113630.18
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46811070.41
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 298.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.93 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.17 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.61 shadow_word_death,if=active_enemies<=5
F 44.86 mind_blast,if=active_enemies<=6&cooldown_react
G 43.65 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.45 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.04 halo,if=talent.halo.enabled
M 12.02 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.87 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.33 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.39 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.40 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWWFHHGMTFLTHHTGFGTAWWFHHMTGFTHHTGTFLTWWWGHFHMTQFTHHGGTFTCGAWFHHLMTGTFTGHFHTGWWWWFHHTFMGLHHGTFTWAWFGHHTQFMTHHGFGTLWWWFHHTFGTHHGFMTGCGAFHHTLTFTGHGHQFMTWWWWFHHTGTFTHHLGFMTGWWWAFHHTQFGTHGHTFMTWWLWFGHHTFTHGFHGTGWCWFAHHMTGLFTEETGFHHDEEGWWFTHEDEHHFTEEGGFHHDEEL9FATEDEFGGHHTEEQFMTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no2PT14 : 109979 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
109978.7 109978.7 18.44 / 0.02% 3409 / 3.1% 16.9 6285.8 6180.1 Mana 0.24% 41.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309561|240170|145120|141767|112750|94454|85901|49195&chds=0,619122&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309561++devouring_plague,9482C9,0,0,15|t++240170++halo,9482C9,1,0,15|t++145120++shadow_word_insanity,9482C9,2,0,15|t++141767++vampiric_touch,9482C9,3,0,15|t++112750++shadow_word_pain,9482C9,4,0,15|t++94454++shadow_word_death,9482C9,5,0,15|t++85901++mind_blast,9482C9,6,0,15|t++49195++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,16,11,9,9,6,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague|shadowy_apparition|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_swi_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:576875666431356233330xuusqrpnnnopqrrtrqppoonooonnonlkjhfdbbbbceefegfggfghhhhkmlnnmkiihhffffghhijjhffeeeefghiijihggfdddfghijklkllmmlmmmnnpopnmlkjjijhgeddeffeeeeffeeddeghhiiihiiijkjjikmnonomllklllkjmmlnmmkjihjhikjkllmmnlkkjiiiijlkllihggfdfddddeffhghiijjjklnorqrrrrqppnpnljihihheeddddccbbcdddeeeffhgghghhijjkjkjkkjjjjihjkjkjjiiihihhgghijklmlllllllmnoopppnmllkmkkkkmnoqppqqqqrssututuuutsqpnoommmlmmmmmmmmmmmlllmllllkkkkjkjijiiijkkllmmnopppprssttuuuttutttssssssssrrqqqppoppppommmmlmlkkkklmnnoppqqsuvvvwvvwwwwvututtsrrqqqpqqqrsssrrrsrrqpoonnnponnmllllllkkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6260,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109979|max=175689&chxp=1,1,63,100&chtt=priest_90_pi_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,0,48,32,88,96,176,280,400,528,704,1184,1312,1616,1864,2408,2104,2352,3024,2912,3080,3064,2848,2848,2392,2536,2192,1944,1392,1392,1088,944,768,552,440,376,216,184,192,80,72,72,56,32,24,32,8,0,24&chds=0,3080&chbh=5&chxt=x&chxl=0:|min=102897|avg=109979|max=118640&chxp=0,1,45,100&chtt=priest_90_pi_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.6,20.8,15.2,11.0,6.4,4.1,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 138.0s|shadow_word_pain 93.7s|vampiric_touch 68.5s|mind_blast 49.7s|shadow_word_insanity 29.0s|devouring_plague 18.6s|shadow_word_death 16.9s|halo 12.6s|shadowfiend 2.4s|waiting 1.1s&chtt=priest_90_pi_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no2PT14 109979
devouring_plague 4867 (12796) 4.4% (11.6%) 16.1 28.73sec 358589 309561 112433 232827 136321 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 0.00 0.00 1.1584 0.0000 2193439.73 2193439.73 0.00 309561.08 309561.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.90 80.16% 112433.21 102399 137090 112463.25 104449 119583 1450199 1450199 0.00
crit 3.19 19.84% 232827.21 210941 282405 225023.51 0 282405 743241 743241 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1892 1.7% 37.9 10.93sec 22517 0 18586 38457 22557 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.90 37.83 0.00 0.00 0.0000 0.0000 853371.09 853371.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.27 80.01% 18585.96 17006 22766 18588.49 17416 19941 562598 562598 0.00
crit 7.56 19.99% 38456.66 35032 46897 38450.16 0 46897 290773 290773 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6037 5.5% 16.1 28.73sec 169236 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.2 18532 38369 22464 19.8% 0.0% 19.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.09 16.09 121.22 121.22 0.0000 0.7379 2723098.10 2723098.10 0.00 30442.34 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.2 80.18% 18532.16 17006 22766 18533.85 17607 19642 1801185 1801185 0.00
crit 24.0 19.82% 38368.86 35032 46897 38370.55 35709 41907 921913 921913 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6692) 0.0% (6.1%) 10.8 43.40sec 279243 240170 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 10.80 0.00 0.00 1.1627 0.0000 0.00 0.00 0.00 240170.00 240170.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.68 80.37% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.12 19.63% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6692 6.1% 10.8 43.40sec 279243 0 115213 238107 139624 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.80 21.60 0.00 0.00 0.0000 0.0000 3015814.65 3015814.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.31 80.14% 115212.56 104363 139821 115226.35 106450 124048 1994303 1994303 0.00
crit 4.29 19.86% 238107.13 214987 288030 235516.32 0 288030 1021512 1021512 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.40sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.80 225.15 0.00 0.00 0.0000 0.0000 0.00 44049111.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.50 77.06% 0.00 0 0 0.00 0 0 0 27262780 100.00
crit 51.64 22.94% 0.00 0 0 0.00 0 0 0 16786331 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9469 8.6% 39.2 11.52sec 109056 85901 89851 185983 109056 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.15 39.15 0.00 0.00 1.2696 0.0000 4269612.47 4269612.47 0.00 85900.78 85900.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.33 80.02% 89851.05 82079 110390 89869.00 86876 94500 2814992 2814992 0.00
crit 7.82 19.98% 185983.24 169082 227403 186003.10 0 214864 1454620 1454620 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11482 (15082) 10.4% (13.7%) 86.7 5.06sec 78314 49195 0 0 0 0.0% 0.0% 0.0% 0.0% 176.4 24114 50019 29310 20.1% 0.0% 27.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.70 86.70 176.36 176.36 1.5919 0.6963 5168950.42 5168950.42 0.00 49194.56 49194.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.0 79.95% 24114.43 21797 29181 24120.12 23200 24855 3399886 3399886 0.00
crit 35.4 20.05% 50018.77 44901 60113 50030.89 47006 53306 1769064 1769064 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3600 3.3% 55.3 7.77sec 29311 0 24136 50031 29327 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.29 55.26 0.00 0.00 0.0000 0.0000 1620734.68 1620734.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.18 79.95% 24135.62 21797 29181 24141.87 22979 25636 1066432 1066432 0.00
crit 11.08 20.05% 50031.45 44901 60113 50042.28 44901 57033 554303 554303 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3550 3.2% 14.6 4.95sec 109556 94454 90090 186924 109554 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 14.61 0.00 0.00 1.1599 0.0000 1601002.77 1601002.77 0.00 94454.44 94454.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.68 79.90% 90090.45 79678 107383 90165.95 83886 99961 1051897 1051897 0.00
crit 2.94 20.10% 186924.06 164137 221210 179617.33 0 221210 549106 549106 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9308 8.5% 25.1 16.06sec 167650 145120 138418 286383 167646 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.08 25.08 0.00 0.00 1.1553 0.0000 4204116.74 4204116.74 0.00 145119.67 145119.67
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.12 80.24% 138418.13 122772 173880 138452.76 130835 148573 2785354 2785354 0.00
crit 4.95 19.76% 286383.05 252910 358194 284556.88 0 358194 1418763 1418763 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 17980 (23439) 16.4% (21.3%) 80.8 5.56sec 130664 112750 0 0 0 0.0% 0.0% 0.0% 0.0% 463.9 14392 29826 17468 19.9% 0.0% 181.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.84 80.84 463.86 463.86 1.1589 1.7658 8102848.83 8102848.83 0.00 11572.63 112749.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 371.4 80.07% 14391.96 12783 17966 14395.18 14020 14811 5345221 5345221 0.00
crit 92.5 19.93% 29826.01 26333 37009 29832.41 28662 31343 2757627 2757627 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5459 5.0% 145.1 3.08sec 16954 0 14002 29010 16968 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.12 145.00 0.00 0.00 0.0000 0.0000 2460319.79 2460319.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.34 80.24% 14002.22 12783 17110 14004.79 13522 14443 1629047 1629047 0.00
crit 28.65 19.76% 29010.05 26333 35247 29014.91 27325 30970 831272 831272 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2248 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4454 4.1% 95.5 4.68sec 21018 0 17787 35774 21375 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.53 93.93 0.00 0.00 0.0000 0.0000 2007751.65 2007751.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.19 80.05% 17786.54 15875 22484 17789.93 17219 18423 1337327 1337327 0.00
crit 18.74 19.95% 35773.94 31750 44968 35783.63 33139 39167 670425 670425 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16489 (21524) 15.0% (19.6%) 59.2 7.52sec 163931 141767 0 0 0 0.0% 0.0% 0.0% 0.0% 380.1 16123 33404 19556 19.9% 0.0% 180.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.20 59.20 380.14 380.14 1.1564 2.1412 7434172.48 7434172.48 0.00 10997.45 141766.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.6 80.13% 16123.45 14287 20366 16126.49 15643 16719 4911500 4911500 0.00
crit 75.5 19.87% 33404.12 29431 41955 33410.60 31931 35396 2522673 2522673 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5035 4.6% 119.0 3.70sec 19079 0 15748 32619 19094 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.99 118.89 0.00 0.00 0.0000 0.0000 2270195.64 2270195.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.31 80.16% 15747.77 14287 19397 15750.94 15279 16325 1500937 1500937 0.00
crit 23.58 19.84% 32618.55 29431 39957 32629.31 30397 35709 769258 769258 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46283 / 3665
melee 46283 3.3% 31.2 12.61sec 52375 51636 45721 92401 52376 20.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0143 0.0000 1633087.95 1633087.95 0.00 51635.88 51635.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 55.79% 45721.34 36329 55931 45742.73 40835 52135 795322 795322 0.00
crit 6.27 20.11% 92401.06 72658 111863 92320.52 0 111863 579305 579305 0.00
glance 7.52 24.11% 34386.83 27247 41949 34410.12 27247 41949 258460 258460 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.51sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1380 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.36%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.80%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.2sec 20.2sec 44.48% 45.01%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.48%

    Trigger Attempt Success

    • trigger_pct:1.76%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.33% 42.33%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.33%

    Trigger Attempt Success

    • trigger_pct:14.25%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.52% 20.03%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.47% 49.52%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.47%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.38% 77.57%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no2PT14
devouring_plague Shadow Orb 16.1 48.3 3.0 3.0 119529.9
halo Mana 10.8 418563.9 38755.9 38756.0 7.2
mind_blast Mana 39.2 340995.7 8709.8 8709.8 12.5
mind_flay Mana 86.7 247664.4 2856.6 2856.6 27.4
shadow_word_death Mana 14.6 109713.2 7507.4 7507.6 14.6
shadow_word_insanity Mana 25.1 178623.1 7123.0 7123.0 23.5
shadow_word_pain Mana 80.8 1026721.8 12700.4 12700.3 10.3
vampiric_touch Mana 59.2 512370.4 8655.2 8655.2 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 160766.85 (5.77%) 5155.96 119860.35 42.71%
Shadow Orbs from Mind Blast Shadow Orb 39.15 39.15 (84.14%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.38 7.38 (15.86%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.05 0.00 (-nan%) 0.00 2208713.09 100.00%
Vampiric Touch Mana Mana 499.03 2166406.31 (77.73%) 4341.19 471109.69 17.86%
mp5_regen Mana 1803.34 459815.26 (16.50%) 254.98 81187.08 15.01%
Resource RPS-Gain RPS-Loss
Mana 6180.12 6285.82
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 252336.24 112260.00 300000.00
Shadow Orb 1.26 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.2%
shadowfiend-Mana Cap 15.2%
lightwell-Mana Cap 15.2%

Procs

Count Interval
Shadowy Recall Extra Tick 357.0 1.3sec
Shadowy Apparition Procced 95.5 4.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no2PT14 Damage Per Second
Count 49992
Mean 109978.68
Minimum 102897.34
Maximum 118640.39
Spread ( max - min ) 15743.04
Range [ ( max - min ) / 2 * 100% ] 7.16%
Standard Deviation 2104.1424
5th Percentile 106716.24
95th Percentile 113534.91
( 95th Percentile - 5th Percentile ) 6818.67
Mean Distribution
Standard Deviation 9.4108
95.00% Confidence Intervall ( 109960.24 - 109997.13 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1406
0.1 Scale Factor Error with Delta=300 37794
0.05 Scale Factor Error with Delta=300 151179
0.01 Scale Factor Error with Delta=300 3779496
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 109978.68
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47925429.04
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 313.47
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.24 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.61 shadow_word_death,if=active_enemies<=5
F 44.94 mind_blast,if=active_enemies<=6&cooldown_react
G 45.60 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.64 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.08 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.80 halo,if=talent.halo.enabled
M 11.85 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.65 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.28 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.27 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 35.24 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWWFHGHMTFLTHIGHFGTWWWFHHMTIGQFTHHIGFTLIGWWWFHHMTQFIGTHHGFTCGIGFHHLTQFTIGIGHHFMTWWWIFGHHTQFTIGHHFGLMTBWWFHHTIGTFTHHGQFMIGTWWWWFHHLTIGFTHHIGQFMTIGCGWFHHTFTIGIGHHLFMTWWIGFHHTFTIGHGHFMTWWLFHHIGTQFTIGHHTFIGMTWWWWWFHHTIGTFLTHHGTFMIGGBCWFHHTIFGTEDEGHFHLTEEGWFHMHEETQFTIEEGFGHHDEEW9FTHGHEDEFLTIGTEEFHHGM

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no4PT14 : 113079 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113079.1 113079.1 18.53 / 0.02% 3501 / 3.1% 17.4 6285.8 6181.4 Mana 0.24% 41.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:309753|239224|144990|141708|122587|94547|85813|49176&chds=0,619506&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++309753++devouring_plague,9482C9,0,0,15|t++239224++halo,9482C9,1,0,15|t++144990++shadow_word_insanity,9482C9,2,0,15|t++141708++vampiric_touch,9482C9,3,0,15|t++122587++shadow_word_pain,9482C9,4,0,15|t++94547++shadow_word_death,9482C9,5,0,15|t++85813++mind_blast,9482C9,6,0,15|t++49176++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,15,10,9,9,6,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague|shadowfiend: melee|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_swi_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:576775666431357343431yvusrsqonopqrrrtrrqppooooonoonmkjigecbccdeefegfgggghhhikmmnnmkjihigggfghhikkhggfefefghiijihggfeedfghikklkmmmmmmnnnopoponlkkjijhgfeeffgefefgfeeedeghhiiiiijijkjjilmnonomllllmmkkmnmnnmkjiijhikjkllmnnlkkjjjiikllmlihhgfefdddeegghgiijkjklmnorqrssrqqpopnlkihiihffdeeddcbbcdddeffffhhhhgihijjkjkkkkjkkjihjkkljjjiihjhhhghijklmlmlllllmnoopqpnmllkmlkklmnoqppqqqqrssuuutuuutsrqoponnmmmmnmnmmmnmmlmmmmlmlkkkkjkjjjiijjkkllmmnopppprsstttuuttutttsssssssssrrqqppppppponmmmlmllkkllmnnpppqqsuvvvwwwwwwwvvuutttsrrrqqqqrrsssssssrrrqpponoppoonnmmmmmmlll&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6312,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113079|max=179155&chxp=1,1,63,100&chtt=priest_90_pi_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,16,40,24,112,128,168,256,424,552,824,888,1336,1656,2032,1976,2456,2736,3280,3168,3304,2944,2808,2984,2528,2536,2200,1720,1416,1160,984,864,632,440,424,296,216,192,104,72,40,16,0,0,24,0,0,0,0,8&chds=0,3304&chbh=5&chxt=x&chxl=0:|min=106046|avg=113079|max=122687&chxp=0,1,42,100&chtt=priest_90_pi_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.6,20.8,15.2,11.0,6.4,4.1,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 138.0s|shadow_word_pain 93.7s|vampiric_touch 68.5s|mind_blast 49.7s|shadow_word_insanity 29.0s|devouring_plague 18.7s|shadow_word_death 16.9s|halo 12.6s|shadowfiend 2.4s|waiting 1.1s&chtt=priest_90_pi_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no4PT14 113079
devouring_plague 4882 (12814) 4.3% (11.3%) 16.1 28.72sec 358827 309753 112479 232628 136627 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.10 16.10 0.00 0.00 1.1585 0.0000 2200164.59 2200164.59 0.00 309753.11 309753.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.87 79.90% 112479.38 102399 137090 112511.47 106106 120071 1447331 1447331 0.00
crit 3.24 20.10% 232627.90 210941 282405 225136.16 0 282405 752834 752834 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1892 1.7% 37.9 10.92sec 22497 0 18584 38486 22534 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.93 37.87 0.00 0.00 0.0000 0.0000 853407.55 853407.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.35 80.15% 18583.60 17006 22766 18586.56 17321 19795 564099 564099 0.00
crit 7.52 19.85% 38486.42 35032 46897 38453.47 0 44680 289309 289309 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6040 5.3% 16.1 28.72sec 169208 0 0 0 0 0.0% 0.0% 0.0% 0.0% 121.3 18534 38384 22465 19.8% 0.0% 19.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.10 16.10 121.30 121.30 0.0000 0.7379 2724872.15 2724872.15 0.00 30444.82 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.10 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.3 80.20% 18534.39 17006 22766 18537.13 17769 19761 1803000 1803000 0.00
crit 24.0 19.80% 38384.32 35032 46897 38384.64 35874 42069 921872 921872 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6665) 0.0% (5.9%) 10.8 43.40sec 278278 239224 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.1633 0.0000 0.00 0.00 0.00 239224.18 239224.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.67 80.29% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.13 19.71% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6665 5.9% 10.8 43.40sec 278278 0 115164 238126 139136 19.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 21.59 0.00 0.00 0.0000 0.0000 3003698.75 3003698.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 80.50% 115164.00 104363 139821 115174.28 107964 123215 2001422 2001422 0.00
crit 4.21 19.50% 238125.98 214987 288030 235663.61 0 288030 1002276 1002276 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.40sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.79 225.04 0.00 0.00 0.0000 0.0000 0.00 44050457.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.20 76.96% 0.00 0 0 0.00 0 0 0 27207163 100.00
crit 51.84 23.04% 0.00 0 0 0.00 0 0 0 16843294 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9459 8.4% 39.2 11.52sec 108887 85813 89858 185957 108887 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.17 39.17 0.00 0.00 1.2689 0.0000 4265524.08 4265524.08 0.00 85813.35 85813.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.42 80.20% 89858.49 82079 110390 89879.83 86719 93568 2823088 2823088 0.00
crit 7.76 19.80% 185957.14 169082 227403 185928.66 0 210779 1442436 1442436 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11472 (15074) 10.1% (13.3%) 86.7 5.06sec 78310 49176 0 0 0 0.0% 0.0% 0.0% 0.0% 176.3 24116 50039 29286 19.9% 0.0% 27.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.65 86.65 176.34 176.34 1.5925 0.6963 5164214.26 5164214.26 0.00 49175.73 49175.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 86.65 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.2 80.05% 24115.63 21797 29181 24121.72 23400 24947 3404291 3404291 0.00
crit 35.2 19.95% 50038.94 44901 60113 50052.55 47538 52960 1759923 1759923 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3601 3.2% 55.3 7.78sec 29314 0 24134 50041 29327 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.31 55.29 0.00 0.00 0.0000 0.0000 1621396.81 1621396.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.20 79.95% 24134.24 21797 29181 24139.14 22939 25714 1066821 1066821 0.00
crit 11.08 20.05% 50040.99 44901 60113 50043.70 44901 57126 554575 554575 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.13sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3549 3.1% 14.6 4.95sec 109651 94547 90116 186909 109652 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1598 0.0000 1601060.67 1601060.67 0.00 94547.10 94547.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.65 79.82% 90116.29 79678 107383 90195.61 83534 97615 1050266 1050266 0.00
crit 2.95 20.18% 186909.42 164137 221210 179675.84 0 221210 550795 550795 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9303 8.2% 25.1 16.05sec 167521 144990 138392 286522 167523 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.08 25.08 0.00 0.00 1.1554 0.0000 4201949.03 4201949.03 0.00 144989.79 144989.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.15 80.33% 138391.53 122772 173880 138421.38 129684 148824 2788649 2788649 0.00
crit 4.93 19.67% 286522.39 252910 358194 285106.36 0 358194 1413300 1413300 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 19551 (25486) 17.3% (22.5%) 80.8 5.56sec 142070 122587 0 0 0 0.0% 0.0% 0.0% 0.0% 463.9 14390 29778 18993 29.9% 0.0% 181.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.85 80.85 463.88 463.88 1.1589 1.7656 8810691.49 8810691.49 0.00 12584.64 122586.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 80.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 325.1 70.08% 14390.08 12783 17966 14393.39 14067 14790 4678384 4678384 0.00
crit 138.8 29.92% 29777.78 26333 37009 29785.32 28877 30853 4132308 4132308 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5935 5.3% 145.0 3.08sec 18449 0 14004 28954 18465 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 145.03 144.89 0.00 0.00 0.0000 0.0000 2675549.66 2675549.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.65 70.16% 14003.96 12783 17110 14006.92 13363 14444 1423517 1423517 0.00
crit 43.24 29.84% 28953.78 26333 35247 28958.81 27628 30549 1252033 1252033 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2246 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5534 4.9% 118.8 3.77sec 21006 0 17779 35753 21369 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.79 116.78 0.00 0.00 0.0000 0.0000 2495322.93 2495322.93 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.46 80.03% 17779.28 15875 22484 17783.09 17345 18305 1661594 1661594 0.00
crit 23.32 19.97% 35752.63 31750 44968 35765.24 33387 38997 833729 833729 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16491 (21521) 14.6% (19.0%) 59.2 7.52sec 163881 141708 0 0 0 0.0% 0.0% 0.0% 0.0% 380.1 16129 33402 19563 19.9% 0.0% 180.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.21 59.21 380.10 380.10 1.1565 2.1417 7435766.96 7435766.96 0.00 10994.99 141708.44
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 304.5 80.12% 16128.56 14287 20366 16131.72 15679 16662 4911593 4911593 0.00
crit 75.6 19.88% 33401.54 29431 41955 33407.42 31990 34969 2524173 2524173 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5030 4.5% 118.8 3.71sec 19086 0 15749 32636 19102 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.82 118.72 0.00 0.00 0.0000 0.0000 2267718.17 2267718.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 95.15 80.15% 15749.20 14287 19397 15751.98 15231 16442 1498492 1498492 0.00
crit 23.57 19.85% 32635.80 29431 39957 32640.09 30421 35398 769226 769226 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46391 / 3673
melee 46391 3.2% 31.2 12.61sec 52512 51766 45762 92394 52511 20.3% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0144 0.0000 1637449.35 1637449.35 0.00 51765.60 51765.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.38 55.74% 45762.19 36329 55931 45776.43 41421 52753 795462 795462 0.00
crit 6.34 20.32% 92394.46 72658 111863 92234.26 0 111863 585380 585380 0.00
glance 7.46 23.94% 34376.86 27247 41949 34385.70 0 41949 256607 256607 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.49sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1378 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.36%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.60%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.2sec 20.1sec 44.62% 45.14%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.62%

    Trigger Attempt Success

    • trigger_pct:1.76%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.34% 42.34%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.34%

    Trigger Attempt Success

    • trigger_pct:14.31%
power_infusion 4.3 0.0 121.5sec 121.1sec 18.53% 20.04%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.46% 49.53%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.57%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no4PT14
devouring_plague Shadow Orb 16.1 48.3 3.0 3.0 119609.2
halo Mana 10.8 418389.0 38762.1 38761.7 7.2
mind_blast Mana 39.2 341161.6 8709.0 8708.9 12.5
mind_flay Mana 86.6 247518.0 2856.6 2856.5 27.4
shadow_word_death Mana 14.6 109618.6 7507.1 7507.4 14.6
shadow_word_insanity Mana 25.1 178664.2 7122.8 7122.9 23.5
shadow_word_pain Mana 80.8 1026810.0 12700.3 12700.3 11.2
vampiric_touch Mana 59.2 512482.2 8655.3 8655.2 18.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 160679.93 (5.76%) 5152.88 119963.11 42.75%
Shadow Orbs from Mind Blast Shadow Orb 39.17 39.17 (84.16%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.37 7.37 (15.84%) 1.00 0.00 0.00%
Devouring Plague Health Health 159.17 0.00 (-nan%) 0.00 2210268.39 100.00%
Vampiric Touch Mana Mana 498.81 2166848.85 (77.73%) 4344.00 469882.83 17.82%
mp5_regen Mana 1803.34 460013.39 (16.50%) 255.09 80988.95 14.97%
Resource RPS-Gain RPS-Loss
Mana 6181.35 6285.80
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 252897.01 118620.00 300000.00
Shadow Orb 1.23 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 15.2%
shadowfiend-Mana Cap 15.2%
lightwell-Mana Cap 15.2%

Procs

Count Interval
Shadowy Recall Extra Tick 356.8 1.3sec
Shadowy Apparition Procced 118.8 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no4PT14 Damage Per Second
Count 49992
Mean 113079.14
Minimum 106045.53
Maximum 122687.47
Spread ( max - min ) 16641.93
Range [ ( max - min ) / 2 * 100% ] 7.36%
Standard Deviation 2113.6188
5th Percentile 109685.08
95th Percentile 116686.91
( 95th Percentile - 5th Percentile ) 7001.83
Mean Distribution
Standard Deviation 9.4531
95.00% Confidence Intervall ( 113060.61 - 113097.66 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1342
0.1 Scale Factor Error with Delta=300 38136
0.05 Scale Factor Error with Delta=300 152544
0.01 Scale Factor Error with Delta=300 3813616
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113079.14
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49321337.10
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 313.49
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 44.93 mind_blast,if=active_enemies<=6&cooldown_react
G 45.61 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.66 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.08 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.79 halo,if=talent.halo.enabled
M 11.88 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.64 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.28 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 46.25 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 35.24 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDGGLFHHTFTGGHHTFTWWWWWFHGHMTFLTHTHGFGTWWWFHHTIGTQFMTHHIGQFTIGLWWWWFHHTIGFMTHGHTFTICGGWFHHTLTFTIGIGHFHMTWWWIFGHHTQFTIGHHFGLTBWWFHHMIGTQFTHHIGFIGTWWWWFHHLMTIGFTHHIGTFTIGCGWFHHMTQFTIGHHGFLTWWIGFHHTQFMTIGGHHFTWWLFHGHTQFMTHGHFIGTWWWWFHHTIGTFLMTHGHFTIGGBCWFHHTIFGMTEEHGHFTLEDEGWFHHTEETFMTIEEGFGHHTEDE9FTHGHGEEFLMTEEHFHIG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no2PT14 : 113168 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113167.8 113167.8 20.10 / 0.02% 3748 / 3.3% 19.3 5658.0 5586.4 Mana 0.26% 44.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:313268|244408|136566|133908|105404|92052|79700|45333&chds=0,626537&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++313268++devouring_plague,9482C9,0,0,15|t++244408++halo,9482C9,1,0,15|t++136566++shadow_word_pain,9482C9,2,0,15|t++133908++vampiric_touch,9482C9,3,0,15|t++105404++shadow_word_death,9482C9,4,0,15|t++92052++mind_blast,9482C9,5,0,15|t++79700++mind_spike,4A79D3,6,0,15|t++45333++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,15,12,10,7,6,6,5,5,4,4,4,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58777776664245735457632110zyxxwyyz010zywvttsrrrsstsrrrrplklkllmmmllllkjjkjjkmopppppoooonmmmmmnnnmkjiihhhiiklmnmlllljjkllmmnnoonnmlklmnnnoponmmmmlkkjijjkklllllllkkkklmoopqponopopooopqrsssrqqpppqqpppppppooonnmmmnoppqqqqqqqppooooppqpnmlkjiihgfgghijjjjjjijlllmnoqrrrqqponllkkllllllkkjiiiiijklmnmllmmmlllmnnoppppppooooonnoppqpoooonnnnnooqrsttuuvuuvvwwxyyyxvussssrrrrstuvuvuutsuvvxwxwxyyyxwwuutttuuuvwwwwwwwvvvuuuvvwvuuvvuvututuuvwwxxyyyz110022455556666655555556666554433221220yyyywwuutttsttuvvwvvxzzzz00233445555443344444555544332221110z0zyyzzyyxxxxxwwwwwv&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7200,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113168|max=157184&chxp=1,1,72,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:32,16,24,72,184,168,176,336,424,664,952,1072,1336,1944,2216,2440,2824,2840,2776,3112,3120,3152,3216,2832,2312,2216,1784,1688,1416,1208,920,664,568,304,368,240,128,72,48,40,0,40,32,8,0,0,0,0,0,8&chds=0,3216&chbh=5&chxt=x&chxl=0:|min=105684|avg=113168|max=123912&chxp=0,1,41,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.4,17.1,16.5,15.6,12.3,4.8,3.9,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 100.9s|shadow_word_pain 77.3s|mind_spike 74.4s|vampiric_touch 70.4s|mind_blast 55.4s|devouring_plague 21.7s|shadow_word_death 17.5s|halo 12.8s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_tof_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no2PT14 113168
devouring_plague 5747 (15052) 5.1% (13.3%) 18.2 25.64sec 373874 313268 117557 243593 142661 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 0.00 0.00 1.1935 0.0000 2589973.44 2589973.44 0.00 313268.27 313268.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.54 80.08% 117556.73 102399 157653 117584.16 109958 127096 1709117 1709117 0.00
crit 3.62 19.92% 243593.30 210941 324765 238726.06 0 324765 880856 880856 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2221 2.0% 42.5 9.95sec 23594 0 19486 40364 23626 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.46 42.40 0.00 0.00 0.0000 0.0000 1001843.36 1001843.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.00 80.17% 19485.56 17006 26181 19485.21 18034 21226 662431 662431 0.00
crit 8.41 19.83% 40364.31 35032 53932 40354.99 0 52722 339413 339413 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7084 6.3% 18.2 25.64sec 176029 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.7 19411 40212 23547 19.9% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 135.72 135.72 0.0000 0.7582 3195766.82 3195766.82 0.00 31056.41 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.7 80.11% 19410.67 17006 26181 19410.01 18535 20322 2110522 2110522 0.00
crit 27.0 19.89% 40211.70 35032 53932 40208.36 36986 45149 1085245 1085245 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6932) 0.0% (6.1%) 10.9 42.99sec 287588 244408 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1767 0.0000 0.00 0.00 0.00 244408.31 244408.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.70 80.06% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.17 19.94% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6932 6.1% 10.9 42.99sec 287588 0 118498 245203 143792 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.73 0.00 0.00 0.0000 0.0000 3124760.25 3124760.25 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 80.04% 118497.69 104363 160794 118507.37 110584 128455 2060956 2060956 0.00
crit 4.34 19.96% 245202.80 214987 331235 243094.73 0 318528 1063804 1063804 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.99sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 228.75 0.00 0.00 0.0000 0.0000 0.00 46002862.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.22 77.04% 0.00 0 0 0.00 0 0 0 28457884 100.00
crit 52.53 22.96% 0.00 0 0 0.00 0 0 0 17544978 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11304 10.0% 45.4 9.88sec 112201 92052 92567 191709 112201 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.42 45.42 0.00 0.00 1.2189 0.0000 5096276.86 5096276.86 0.00 92052.04 92052.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.43 80.20% 92567.09 82079 126948 92578.64 88585 96491 3371816 3371816 0.00
crit 9.00 19.80% 191708.94 169082 261513 191739.08 169082 241145 1724460 1724460 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 7736 (10161) 6.8% (9.0%) 63.8 6.79sec 71751 45333 0 0 0 0.0% 0.0% 0.0% 0.0% 117.2 24464 50713 29721 20.0% 0.0% 19.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.75 63.75 117.19 117.19 1.5828 0.7325 3483159.90 3483159.90 0.00 45332.89 45332.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.7 79.97% 24464.06 21797 33558 24470.31 23564 25848 2292784 2292784 0.00
crit 23.5 20.03% 50712.98 44901 69130 50721.43 46190 56630 1190376 1190376 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2424 2.1% 36.7 11.38sec 29748 0 24490 50827 29758 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.68 36.67 0.00 0.00 0.0000 0.0000 1091201.02 1091201.02 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.33 80.00% 24489.60 21797 33558 24494.71 22727 26798 718374 718374 0.00
crit 7.34 20.00% 50826.81 44901 69130 50781.05 0 61608 372827 372827 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13141 11.6% 63.1 6.88sec 93920 79700 77445 160494 93919 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.10 63.10 0.00 0.00 1.1784 0.0000 5926389.70 5926389.70 0.00 79699.70 79699.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.58 80.16% 77445.20 68964 106992 77444.54 73294 82480 3917445 3917445 0.00
crit 12.52 19.84% 160494.45 142066 220403 160513.52 143824 197409 2008944 2008944 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4079 3.6% 14.6 4.95sec 125989 105404 103543 214827 125988 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.60 14.60 0.00 0.00 1.1953 0.0000 1839714.11 1839714.11 0.00 105403.58 105403.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.66 79.83% 103543.06 79678 123491 103632.86 95501 112887 1206992 1206992 0.00
crit 2.95 20.17% 214826.85 164137 254391 206831.42 0 254391 632722 632722 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 17932 (23415) 15.9% (20.7%) 65.4 6.88sec 161459 136566 0 0 0 0.0% 0.0% 0.0% 0.0% 452.9 14724 30495 17850 19.8% 0.0% 194.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.38 65.38 452.89 452.89 1.1823 1.9334 8084134.89 8084134.89 0.00 11077.73 136565.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 363.1 80.18% 14723.97 12783 20660 14724.60 14295 15160 5346557 5346557 0.00
crit 89.8 19.82% 30495.18 26333 42560 30496.19 29103 32285 2737578 2737578 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5483 4.8% 141.7 3.15sec 17449 0 14399 29853 17465 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.67 141.54 0.00 0.00 0.0000 0.0000 2471982.41 2471982.41 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 113.47 80.16% 14399.43 12783 19677 14401.51 13893 15088 1633863 1633863 0.00
crit 28.08 19.84% 29852.79 26333 40534 29858.92 27843 32583 838119 838119 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2244 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4520 4.0% 94.4 4.73sec 21592 0 18284 36773 21967 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.39 92.78 0.00 0.00 0.0000 0.0000 2038049.04 2038049.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.30 80.08% 18283.81 15875 25856 18286.01 17568 19076 1358422 1358422 0.00
crit 18.48 19.92% 36773.24 31750 51713 36777.83 33309 41350 679627 679627 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16012 (20907) 14.2% (18.5%) 59.4 7.49sec 158699 133908 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 16534 34254 20061 19.9% 0.0% 178.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.39 59.39 359.85 359.85 1.1851 2.2356 7218959.91 7218959.91 0.00 10773.81 133907.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.2 80.10% 16534.16 14287 23421 16534.47 15976 17052 4765514 4765514 0.00
crit 71.6 19.90% 34254.12 29431 48248 34255.04 32579 36878 2453446 2453446 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4895 4.3% 112.6 3.91sec 19599 0 16179 33552 19615 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.59 112.50 0.00 0.00 0.0000 0.0000 2206671.01 2206671.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.24 80.22% 16178.57 14287 22306 16180.54 15424 17083 1459997 1459997 0.00
crit 22.25 19.78% 33551.92 29431 45950 33557.22 30404 37243 746674 746674 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46183 / 3657
melee 46183 3.2% 31.2 12.61sec 52290 51480 45615 92291 52290 20.1% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0157 0.0000 1630068.29 1630068.29 0.00 51480.18 51480.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.70% 45614.90 36329 55931 45638.59 40741 51187 792099 792099 0.00
crit 6.28 20.14% 92290.73 72658 111863 92183.39 0 111863 579479 579479 0.00
glance 7.53 24.15% 34328.17 27247 41949 34319.90 0 41949 258490 258490 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.46sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.40%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.61%
glyph_mind_spike 36.0 27.1 12.2sec 6.9sec 49.41% 71.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.41%
  • glyph_mind_spike_2:17.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.47% 43.69%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.47%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.2sec 48.2sec 42.16% 42.16%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.16%

    Trigger Attempt Success

    • trigger_pct:14.39%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.46% 49.49%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 42.8 28.0 10.2sec 6.2sec 43.20% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.71%
  • surge_of_darkness_2:10.50%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.4 135.0 17.3sec 0.7sec 21.04% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.48%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no2PT14
devouring_plague Shadow Orb 18.2 54.5 3.0 3.0 124623.7
halo Mana 10.9 440050.3 40500.0 40500.1 7.1
mind_blast Mana 45.4 408788.6 9000.0 9000.0 12.5
mind_flay Mana 63.8 191256.0 3000.0 2999.9 23.9
shadow_word_death Mana 14.6 113901.2 7800.0 7800.3 16.2
shadow_word_pain Mana 65.4 863018.1 13200.0 13200.1 12.2
vampiric_touch Mana 59.4 534538.1 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 162928.80 (6.47%) 5226.45 117636.48 41.93%
Shadow Orbs from Mind Blast Shadow Orb 45.42 45.42 (86.03%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.38 7.38 (13.97%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.12 0.00 (-nan%) 0.00 2473536.30 100.00%
Vampiric Touch Mana Mana 472.35 1922779.63 (76.32%) 4070.70 573798.77 22.98%
mp5_regen Mana 1803.34 433536.58 (17.21%) 240.41 107465.76 19.86%
Resource RPS-Gain RPS-Loss
Mana 5586.40 5658.04
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 267691.12 132000.00 300000.00
Shadow Orb 1.33 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.0%
shadowfiend-Mana Cap 20.0%
lightwell-Mana Cap 20.0%

Procs

Count Interval
Shadowy Recall Extra Tick 333.1 1.3sec
Shadowy Apparition Procced 94.4 4.7sec
FDCL Mind Spike proc 70.8 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 113167.76
Minimum 105684.28
Maximum 123911.86
Spread ( max - min ) 18227.58
Range [ ( max - min ) / 2 * 100% ] 8.05%
Standard Deviation 2293.1292
5th Percentile 109505.14
95th Percentile 117002.10
( 95th Percentile - 5th Percentile ) 7496.96
Mean Distribution
Standard Deviation 10.2560
95.00% Confidence Intervall ( 113147.66 - 113187.86 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1577
0.1 Scale Factor Error with Delta=300 44889
0.05 Scale Factor Error with Delta=300 179556
0.01 Scale Factor Error with Delta=300 4488908
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113167.76
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49368882.70
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 333.44
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.66 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.60 shadow_word_death,if=active_enemies<=5
F 47.77 mind_blast,if=active_enemies<=6&cooldown_react
G 44.67 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.74 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 16.99 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 13.49 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.67 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.49 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 46.11 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.69 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.71 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTQFRTRGGHHJFRTWWWJFHGHJMRTFTLTGHFHGJRTFMWHHJRFJGRTFHHGTLQFMRWGRWHFHRTQQFTRHRGHGFJMRTGFWHHLTGFJRTHHFMGTGJRFWHHTFRTTRGHFGHLMJRFBWWHGFHRTRJFMHHGRTFGRWWWWHFHLTJRFGMHRHTFGTGRGFHHRTJFMRGHHGFLJRTWWFWHHRTQFGMTTHFHGJRTFGWHHLRFMTTFGHGHRTQFTWWWWHTFGHMTTFHLGHRRTFGGBRHFHMTFGHEEGHRFMTEELRFGHHEDEGFTHEEFGHRTED9EFGHHJREEFGLMRTHEEFGHTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no4PT14 : 116424 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
116423.9 116423.9 20.36 / 0.02% 3821 / 3.3% 19.9 5658.3 5586.2 Mana 0.26% 44.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:313589|244357|148524|133984|105645|92181|79767|45295&chds=0,627179&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++313589++devouring_plague,9482C9,0,0,15|t++244357++halo,9482C9,1,0,15|t++148524++shadow_word_pain,9482C9,2,0,15|t++133984++vampiric_touch,9482C9,3,0,15|t++105645++shadow_word_death,9482C9,4,0,15|t++92181++mind_blast,9482C9,5,0,15|t++79767++mind_spike,4A79D3,6,0,15|t++45295++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,12,10,7,6,6,5,5,5,4,4,3,2,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57777776665245845567642211zzyyxyz0121zyxvutssrsssussssspmlllllmmnmmmmljkkjjknoqqqqpppoonmmnnnnnnmljjiiiiijklnonmmllkkkmmmnnoooonmmlmnnoopppnnnnmmlkkjjkkllmmmmmmllkklnopqqqpoppppppopqrttsrrqqpqqrqppppqqppoonnnnoppqqrrqqqqpppppopqqqomllkjihggghiijjkkkkjklmmmopqrrrrqponmllllmmmmllkkjiiiijklmnmmmmnmmllnnoopqqqqppoopoonopqqppppponnnoopqrstuuvvvvvvwwxyzzxvuttsssrrrstuvvvvuutuvwxxxxyyyyxxwvvuutuvvwwxxxxxwwwvvvvvwwvuvvwvvuuuuuvvwwxyyzy0111122455667666665555666666655443222220zyyyxxvuuttttuuvwwwvxz00z00234445556543344444556554443322221000zz00zywwwwvvvuvvu&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.7285,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=116424|max=159807&chxp=1,1,73,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,24,8,48,56,120,176,304,408,592,624,808,1280,1240,1544,1816,2168,2224,2936,2816,2896,3016,2912,2720,2504,2544,2504,2176,2000,1744,1256,1096,664,696,512,360,336,232,200,80,80,72,56,32,48,32,16,0,8&chds=0,3016&chbh=5&chxt=x&chxl=0:|min=108460|avg=116424|max=125679&chxp=0,1,46,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:22.4,17.1,16.5,15.6,12.3,4.8,3.9,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 100.9s|shadow_word_pain 77.3s|mind_spike 74.4s|vampiric_touch 70.4s|mind_blast 55.4s|devouring_plague 21.7s|shadow_word_death 17.4s|halo 12.8s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_tof_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no4PT14 116424
devouring_plague 5759 (15065) 4.9% (13.0%) 18.2 25.65sec 374279 313589 117561 243734 142996 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 0.00 0.00 1.1936 0.0000 2595620.67 2595620.67 0.00 313589.34 313589.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.49 79.84% 117561.17 102399 157653 117573.77 108499 125758 1703840 1703840 0.00
crit 3.66 20.16% 243734.16 210941 324765 238751.83 0 324765 891781 891781 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2224 1.9% 42.5 9.94sec 23597 0 19481 40359 23631 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.52 42.46 0.00 0.00 0.0000 0.0000 1003251.37 1003251.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 34.02 80.12% 19481.31 17006 26181 19481.50 18083 21423 662702 662702 0.00
crit 8.44 19.88% 40358.85 35032 53932 40354.66 0 53932 340549 340549 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7082 6.1% 18.2 25.65sec 176016 0 0 0 0 0.0% 0.0% 0.0% 0.0% 135.7 19413 40225 23537 19.8% 0.0% 22.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.15 18.15 135.75 135.75 0.0000 0.7582 3195041.09 3195041.09 0.00 31042.12 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.8 80.18% 19412.95 17006 26181 19412.66 18281 20719 2113020 2113020 0.00
crit 26.9 19.82% 40224.80 35032 53932 40226.67 36846 44680 1082021 1082021 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6931) 0.0% (6.0%) 10.9 43.00sec 287544 244357 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 10.86 0.00 0.00 1.1768 0.0000 0.00 0.00 0.00 244356.95 244356.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.71 80.12% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.16 19.88% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6931 6.0% 10.9 43.00sec 287544 0 118596 245146 143773 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.86 21.73 0.00 0.00 0.0000 0.0000 3124103.55 3124103.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.41 80.11% 118596.00 104363 160794 118601.71 110401 128577 2064350 2064350 0.00
crit 4.32 19.89% 245146.35 214987 331235 242837.24 0 318528 1059753 1059753 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.00sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.86 228.87 0.00 0.00 0.0000 0.0000 0.00 46072947.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.21 76.99% 0.00 0 0 0.00 0 0 0 28467362 100.00
crit 52.66 23.01% 0.00 0 0 0.00 0 0 0 17605585 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11323 9.7% 45.4 9.88sec 112317 92181 92581 191779 112319 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.43 45.43 0.00 0.00 1.2184 0.0000 5103053.15 5103053.15 0.00 92181.09 92181.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.39 80.10% 92580.58 82079 126948 92593.64 88222 97774 3369444 3369444 0.00
crit 9.04 19.90% 191779.47 169082 261513 191747.11 0 222123 1733609 1733609 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 7733 (10149) 6.6% (8.7%) 63.7 6.79sec 71716 45295 0 0 0 0.0% 0.0% 0.0% 0.0% 117.2 24462 50720 29723 20.0% 0.0% 19.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.73 63.73 117.15 117.15 1.5833 0.7325 3482116.29 3482116.29 0.00 45295.28 45295.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.73 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.7 79.96% 24461.99 21797 33558 24467.70 23372 25717 2291539 2291539 0.00
crit 23.5 20.04% 50720.36 44901 69130 50732.51 46525 55782 1190577 1190577 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 2416 2.1% 36.6 11.40sec 29760 0 24484 50773 29771 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.56 36.55 0.00 0.00 0.0000 0.0000 1088086.77 1088086.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.20 79.89% 24483.63 21797 33558 24487.88 22932 26637 714891 714891 0.00
crit 7.35 20.11% 50772.69 44901 69130 50732.02 0 69130 373196 373196 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13165 11.3% 63.1 6.88sec 94011 79767 77460 160515 94012 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.13 63.13 0.00 0.00 1.1786 0.0000 5934805.86 5934805.86 0.00 79766.75 79766.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.55 80.07% 77460.22 68964 106992 77462.49 73005 82699 3915505 3915505 0.00
crit 12.58 19.93% 160515.12 142066 220403 160535.43 143322 190969 2019301 2019301 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4085 3.5% 14.6 4.95sec 126265 105645 103533 214651 126264 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.59 14.59 0.00 0.00 1.1952 0.0000 1842550.95 1842550.95 0.00 105644.80 105644.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.61 79.54% 103532.75 79678 123491 103629.82 95797 113407 1201757 1201757 0.00
crit 2.99 20.46% 214651.26 164137 254391 206251.33 0 254391 640794 640794 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19507 (25469) 16.8% (21.9%) 65.4 6.88sec 175594 148524 0 0 0 0.0% 0.0% 0.0% 0.0% 452.9 14725 30462 19420 29.8% 0.0% 194.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.39 65.39 452.86 452.86 1.1823 1.9333 8794438.86 8794438.86 0.00 12050.06 148524.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.39 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 317.8 70.17% 14725.32 12783 20660 14726.33 14318 15162 4679156 4679156 0.00
crit 135.1 29.83% 30461.94 26333 42560 30464.32 29174 31717 4115283 4115283 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5962 5.1% 141.6 3.15sec 18980 0 14403 29794 18996 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.58 141.46 0.00 0.00 0.0000 0.0000 2687222.65 2687222.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.24 70.16% 14403.20 12783 19677 14404.47 13841 14980 1429408 1429408 0.00
crit 42.22 29.84% 29793.99 26333 40534 29798.07 28196 31962 1257815 1257815 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 181.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2244 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5651 4.9% 117.9 3.80sec 21608 0 18288 36792 21973 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.91 115.95 0.00 0.00 0.0000 0.0000 2547772.70 2547772.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.86 80.09% 18287.67 15875 25856 18289.47 17605 18987 1698191 1698191 0.00
crit 23.09 19.91% 36792.31 31750 51713 36799.78 33807 40375 849581 849581 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16014 (20921) 13.8% (18.0%) 59.4 7.49sec 158768 133984 0 0 0 0.0% 0.0% 0.0% 0.0% 359.9 16540 34260 20061 19.9% 0.0% 178.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.40 59.40 359.87 359.87 1.1850 2.2357 7219337.65 7219337.65 0.00 10779.16 133984.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.4 80.13% 16539.65 14287 23421 16539.96 15992 17224 4769256 4769256 0.00
crit 71.5 19.87% 34259.69 29431 48248 34259.82 32319 35991 2450081 2450081 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4907 4.2% 112.7 3.90sec 19619 0 16185 33536 19635 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.74 112.64 0.00 0.00 0.0000 0.0000 2211805.82 2211805.82 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.24 80.12% 16185.13 14287 22306 16187.29 15520 16941 1460627 1460627 0.00
crit 22.40 19.88% 33535.91 29431 45950 33548.49 30550 38043 751179 751179 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46285 / 3665
melee 46285 3.1% 31.2 12.61sec 52399 51585 45645 92213 52399 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.17 31.17 0.00 0.00 1.0158 0.0000 1633432.17 1633432.17 0.00 51584.78 51584.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.37 55.71% 45645.29 36329 55931 45663.05 40695 51632 792656 792656 0.00
crit 6.34 20.33% 92213.05 72658 111863 92167.66 0 111863 584428 584428 0.00
glance 7.47 23.96% 34320.36 27247 41949 34314.15 0 41949 256348 256348 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.47sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.40%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.45%
glyph_mind_spike 36.0 27.2 12.2sec 6.9sec 49.38% 70.97%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.32%
  • glyph_mind_spike_2:18.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.6sec 20.7sec 43.54% 43.77%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.54%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.2sec 48.2sec 42.16% 42.16%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.16%

    Trigger Attempt Success

    • trigger_pct:14.49%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.4 0.0 10.3sec 10.3sec 9.45% 49.47%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
surge_of_darkness 42.8 28.0 10.2sec 6.2sec 43.14% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.69%
  • surge_of_darkness_2:10.46%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.3 139.4 17.4sec 0.7sec 21.14% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.47%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no4PT14
devouring_plague Shadow Orb 18.2 54.5 3.0 3.0 124758.6
halo Mana 10.9 440024.4 40500.0 40500.1 7.1
mind_blast Mana 45.4 408909.6 9000.0 9000.0 12.5
mind_flay Mana 63.7 191182.6 3000.0 3000.0 23.9
shadow_word_death Mana 14.6 113827.6 7800.0 7800.3 16.2
shadow_word_pain Mana 65.4 863111.0 13200.0 13200.0 13.3
vampiric_touch Mana 59.4 534614.4 9000.0 8999.9 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.17 162952.75 (6.47%) 5227.43 117601.01 41.92%
Shadow Orbs from Mind Blast Shadow Orb 45.43 45.43 (86.03%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.38 7.38 (13.97%) 1.00 0.00 0.00%
Devouring Plague Health Health 178.20 0.00 (-nan%) 0.00 2474642.78 100.00%
Vampiric Touch Mana Mana 472.51 1922951.33 (76.33%) 4069.66 574172.83 22.99%
mp5_regen Mana 1803.34 433235.76 (17.20%) 240.24 107766.58 19.92%
Resource RPS-Gain RPS-Loss
Mana 5586.17 5658.30
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 267474.56 126600.00 300000.00
Shadow Orb 1.35 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 20.1%
shadowfiend-Mana Cap 20.1%
lightwell-Mana Cap 20.1%

Procs

Count Interval
Shadowy Recall Extra Tick 333.1 1.3sec
Shadowy Apparition Procced 117.9 3.8sec
FDCL Mind Spike proc 70.8 6.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 116423.88
Minimum 108460.37
Maximum 125679.06
Spread ( max - min ) 17218.68
Range [ ( max - min ) / 2 * 100% ] 7.39%
Standard Deviation 2322.8417
5th Percentile 112657.71
95th Percentile 120300.25
( 95th Percentile - 5th Percentile ) 7642.53
Mean Distribution
Standard Deviation 10.3889
95.00% Confidence Intervall ( 116403.52 - 116444.24 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1529
0.1 Scale Factor Error with Delta=300 46059
0.05 Scale Factor Error with Delta=300 184239
0.01 Scale Factor Error with Delta=300 4605988
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 116423.88
Distribution Chart

Damage

Sample Data
Count 49992
Mean 50829207.36
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 333.38
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.66 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.59 shadow_word_death,if=active_enemies<=5
F 47.76 mind_blast,if=active_enemies<=6&cooldown_react
G 44.63 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.74 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 17.03 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.86 halo,if=talent.halo.enabled
M 13.50 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.66 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.44 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 46.10 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 43.67 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.75 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTRTRQFTGGHHFJMRTWWWFWHHGJRRFTLRTHFGHMGRTFWWWHHFRTGTFHHGTLFMRWGRHHFJRTTFRHGGHTQFMTGJRFHHLTGQFTRTGHHFMRRTGRFWRHHTQFRTRTRGFHGHJLDFRBRWHGFHJRTQFMTHHGQFTGRJRWWFHHLRTRQFMTGTHFGHRTGRFGHHTFMRTLGHHFGRTRRFRHHTGQFGJMRTHFHJRTRGFGLRHHFMRTRGFHGHJRTFTWRWWWFHHMGRTFLTHHGJFRTGTBGRFHHTFGMHEEGHFJLJEDERFGHHGEEFMRTEEFHGHRGEDE9FHLHJREEFGMGTEEFHHRTR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no2PT14 : 110252 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
110252.4 110252.4 17.19 / 0.02% 3219 / 2.9% 16.3 6179.3 6100.8 Mana 0.28% 39.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:315060|242673|133472|115788|105639|88773|46809&chds=0,630120&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++315060++devouring_plague,9482C9,0,0,15|t++242673++halo,9482C9,1,0,15|t++133472++vampiric_touch,9482C9,2,0,15|t++115788++shadow_word_pain,9482C9,3,0,15|t++105639++shadow_word_death,9482C9,4,0,15|t++88773++mind_blast,9482C9,5,0,15|t++46809++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,16,12,10,10,7,6,6,5,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|mindbender: melee|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:xz134322321z012z00121yxusqrponmopqrstsrqonnnmnomnnmlkjjigffggijlmnooooooopooqsqrponljihgffffghhhigeeeeeeefghhihgfeedfeijklnoqqrrrqpqqrsrsrrnmkkihffdcccdefffgffgfffffikjkkjjihggghhgghijkkkkllllmmlmnnmmmmmlljkhgihhiiiijiiiijiiijkjkkhhffedeeeddefgiikklnnopppqssrssrqpommjiheeeeeeeddcccbbbdeefggfggggghiikkmnpppqqrrssqpqqrrqqoonmklkjiiijklmnooooppppqssttsqponllkjjjjjkllmmnnnpqqrrtuvvvvvutstsrqppppppqqqqqpppppqqqqpopppoonnnopqrttvwyyz13333567876664343200zyyyxyyyyxxxxxxxwwwutsttrsqpppqqrssuvwxx033334466665533310zzyxxxwxxxxxxxxxxxxwwvuuuustsqoppoonnnnmml&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6560,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=110252|max=168061&chxp=1,1,66,100&chtt=priest_90_tof_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,40,40,72,104,112,312,296,608,544,784,880,1160,1352,1544,2088,2320,2656,2552,2376,3016,3392,2752,3040,2680,2544,2216,1880,1664,1704,1192,808,936,552,504,280,264,168,120,152,56,64,64,16,16,24,16,16,0,8&chds=0,3392&chbh=5&chxt=x&chxl=0:|min=103969|avg=110252|max=118459&chxp=0,1,43,100&chtt=priest_90_tof_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:34.3,20.9,15.5,11.4,4.4,3.8,2.9,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 154.7s|shadow_word_pain 94.3s|vampiric_touch 70.0s|mind_blast 51.5s|devouring_plague 19.7s|shadow_word_death 17.3s|halo 12.9s|mindbender 8.3s|waiting 1.3s&chtt=priest_90_tof_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no2PT14 110252
devouring_plague 5261 (13754) 4.8% (12.5%) 16.6 28.10sec 374906 315060 118237 244982 143325 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.55 16.55 0.00 0.00 1.1900 0.0000 2372198.73 2372198.73 0.00 315060.16 315060.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.27 80.21% 118236.85 102399 157653 118260.16 108786 127818 1569588 1569588 0.00
crit 3.28 19.79% 244981.53 210941 324765 238047.56 0 324765 802611 802611 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2025 1.8% 38.5 10.85sec 23703 0 19568 40532 23740 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.54 38.49 0.00 0.00 0.0000 0.0000 913614.08 913614.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.83 80.10% 19567.92 17006 26181 19569.48 18124 21761 603221 603221 0.00
crit 7.66 19.90% 40531.83 35032 53932 40503.13 0 51512 310393 310393 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6468 5.9% 16.6 28.10sec 176381 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.4 19513 40431 23653 19.8% 0.0% 20.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.55 16.55 123.42 123.42 0.0000 0.7547 2919297.07 2919297.07 0.00 31340.42 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.0 80.21% 19512.91 17006 26181 19513.72 18501 20906 1931680 1931680 0.00
crit 24.4 19.79% 40431.50 35032 53932 40436.21 36699 46516 987618 987618 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6939) 0.0% (6.3%) 10.9 43.00sec 287645 242673 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1854 0.0000 0.00 0.00 0.00 242672.75 242672.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.73 80.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.14 19.66% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6939 6.3% 10.9 43.00sec 287645 0 118484 245667 143820 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.74 0.00 0.00 0.0000 0.0000 3127081.08 3127081.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.41 80.08% 118483.93 104363 160794 118497.73 109232 130758 2062913 2062913 0.00
crit 4.33 19.92% 245667.36 214987 331235 243547.59 0 331235 1064168 1064168 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.00sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 227.31 0.00 0.00 0.0000 0.0000 0.00 45748864.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 174.95 76.97% 0.00 0 0 0.00 0 0 0 28251982 100.00
crit 52.35 23.03% 0.00 0 0 0.00 0 0 0 17496883 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10131 9.2% 40.6 11.09sec 112728 88773 92866 192470 112728 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.56 40.56 0.00 0.00 1.2699 0.0000 4572249.75 4572249.75 0.00 88772.93 88772.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.47 80.06% 92866.27 82079 126948 92885.14 89055 97909 3015547 3015547 0.00
crit 8.09 19.94% 192469.91 169082 261513 192490.98 0 249617 1556702 1556702 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12264 (16099) 11.1% (14.6%) 94.7 4.64sec 76479 46809 0 0 0 0.0% 0.0% 0.0% 0.0% 186.0 24439 50666 29674 20.0% 0.0% 30.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.71 94.71 185.95 185.95 1.6339 0.7354 5517901.96 5517901.96 0.00 46808.59 46808.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.8 80.04% 24439.30 21797 33558 24443.16 23720 25447 3637475 3637475 0.00
crit 37.1 19.96% 50665.76 44901 69130 50671.62 47776 54471 1880427 1880427 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3835 3.5% 58.2 7.38sec 29651 0 24458 50695 29662 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.19 58.16 0.00 0.00 0.0000 0.0000 1725258.75 1725258.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.63 80.16% 24458.35 21797 33558 24461.73 23381 25909 1140378 1140378 0.00
crit 11.54 19.84% 50695.40 44901 69130 50707.63 44901 58505 584881 584881 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.90 6.90 0.00 0.00 1.1982 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4064 3.7% 14.5 4.98sec 126220 105639 103570 214793 126218 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 0.00 0.00 1.1949 0.0000 1832524.98 1832524.98 0.00 105639.30 105639.30
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.56 79.64% 103569.98 79678 123491 103658.57 95799 113407 1197460 1197460 0.00
crit 2.96 20.36% 214792.51 164137 254391 205859.85 0 254391 635065 635065 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 18531 (24205) 16.8% (22.0%) 79.8 5.63sec 136786 115788 0 0 0 0.0% 0.0% 0.0% 0.0% 468.2 14713 30476 17848 19.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.80 79.80 468.20 468.20 1.1813 1.8742 8356474.50 8356474.50 0.00 11232.55 115788.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 375.1 80.11% 14713.28 12783 20660 14713.78 14377 15072 5518864 5518864 0.00
crit 93.1 19.89% 30476.35 26333 42560 30478.97 29177 31971 2837610 2837610 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5674 5.1% 146.5 3.05sec 17467 0 14404 29850 17481 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.49 146.37 0.00 0.00 0.0000 0.0000 2558789.42 2558789.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.21 80.08% 14404.27 12783 19677 14405.93 13924 15029 1688349 1688349 0.00
crit 29.16 19.92% 29849.76 26333 40534 29852.40 27614 34072 870440 870440 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4613 4.2% 96.4 4.63sec 21576 0 18277 36788 21945 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.44 94.82 0.00 0.00 0.0000 0.0000 2080873.19 2080873.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 76.04 80.19% 18277.36 15875 25856 18278.72 17452 19049 1389744 1389744 0.00
crit 18.79 19.81% 36787.58 31750 51713 36790.13 33484 41929 691129 691129 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15864 (20720) 14.4% (18.8%) 59.0 7.54sec 158445 133472 0 0 0 0.0% 0.0% 0.0% 0.0% 357.1 16513 34217 20027 19.8% 0.0% 177.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.96 58.96 357.13 357.13 1.1871 2.2356 7152059.98 7152059.98 0.00 10756.78 133471.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.3 80.15% 16512.74 14287 23421 16513.26 15958 17169 4726813 4726813 0.00
crit 70.9 19.85% 34217.41 29431 48248 34217.03 32286 36287 2425247 2425247 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4856 4.4% 111.8 3.93sec 19586 0 16177 33521 19601 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.77 111.68 0.00 0.00 0.0000 0.0000 2189092.58 2189092.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.64 80.26% 16177.41 14287 22306 16179.52 15523 16983 1450088 1450088 0.00
crit 22.05 19.74% 33520.87 29431 45950 33526.01 30414 37345 739005 739005 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37586 / 9727
melee 37586 8.8% 105.2 4.17sec 41650 39082 36425 73341 41649 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.17 105.17 0.00 0.00 1.0657 0.0000 4380481.03 4380481.03 0.00 39082.47 39082.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.79 55.90% 36424.51 29063 44745 36434.21 34620 38286 2141437 2141437 0.00
crit 21.09 20.05% 73340.88 58126 89490 73351.95 66399 79675 1546848 1546848 0.00
glance 25.29 24.05% 27367.61 21797 33559 27377.14 25360 29747 692196 692196 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.1914 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.37%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:15.59%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 9.0 36.7sec 20.7sec 43.53% 43.82%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.53%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.31% 42.31%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.31%

    Trigger Attempt Success

    • trigger_pct:14.41%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.41% 49.52%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.41%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.4 135.9 17.3sec 0.7sec 21.07% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no2PT14
devouring_plague Shadow Orb 16.6 49.7 3.0 3.0 124968.0
halo Mana 10.9 440290.1 40500.0 40500.1 7.1
mind_blast Mana 40.6 365040.0 9000.0 9000.0 12.5
mind_flay Mana 94.7 284123.0 3000.0 3000.0 25.5
shadow_word_death Mana 14.5 113248.5 7800.0 7800.3 16.2
shadow_word_pain Mana 79.8 1053328.3 13200.0 13199.9 10.4
vampiric_touch Mana 59.0 530593.9 9000.0 8999.9 17.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.18 320374.43 (11.64%) 3046.10 140393.81 30.47%
Shadow Orbs from Mind Blast Shadow Orb 40.56 40.56 (84.70%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.30%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.91 0.00 (-nan%) 0.00 2248368.80 100.00%
Vampiric Touch Mana Mana 468.81 1985855.29 (72.18%) 4235.94 491965.19 19.85%
mp5_regen Mana 1803.34 444988.56 (16.17%) 246.76 96013.78 17.75%
Resource RPS-Gain RPS-Loss
Mana 6100.80 6179.31
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 264591.48 130152.38 300000.00
Shadow Orb 1.24 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.9%
shadowfiend-Mana Cap 17.9%
lightwell-Mana Cap 17.9%

Procs

Count Interval
Shadowy Recall Extra Tick 354.7 1.3sec
Shadowy Apparition Procced 96.4 4.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no2PT14 Damage Per Second
Count 49992
Mean 110252.44
Minimum 103968.93
Maximum 118459.35
Spread ( max - min ) 14490.42
Range [ ( max - min ) / 2 * 100% ] 6.57%
Standard Deviation 1961.1950
5th Percentile 107024.87
95th Percentile 113462.75
( 95th Percentile - 5th Percentile ) 6437.87
Mean Distribution
Standard Deviation 8.7714
95.00% Confidence Intervall ( 110235.25 - 110269.63 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1215
0.1 Scale Factor Error with Delta=300 32834
0.05 Scale Factor Error with Delta=300 131336
0.01 Scale Factor Error with Delta=300 3283410
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 110252.44
Distribution Chart

Damage

Sample Data
Count 49992
Mean 45317416.07
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 294.18
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.90 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.52 shadow_word_death,if=active_enemies<=5
F 44.81 mind_blast,if=active_enemies<=6&cooldown_react
G 43.31 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.56 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 12.33 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.82 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.62 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.73 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.49 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTQFTGGHHFTWWWWFHHGMTFLTHHGFTGTAWWFHHTFGMTHHGQFTLTWWWGFHHTFTHHGFGMTAGWFHHLTGTFTHHTGFMTWGWWFHHTFTHGHFGLTWAWFHHGMTQFTHHTGFTGTWWWWFHHLMTFTGTHHGTFTGWAFGHHMTFTHGHGFLTWWWWFHHMTGFTHHGTFTWGAFHHLMTFTHGGHFTWWWWFHHMTGTFTLHHGFTGGAFHHMTQFTEEGGFHHDEELWWFTHEDEGHFHTPEEGHFMTHEEG9AFHHTEDEFGLTGHEEFHMTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no4PT14 : 113477 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
113477.2 113477.2 17.19 / 0.02% 3232 / 2.8% 16.8 6179.8 6100.8 Mana 0.28% 39.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:315053|242089|133507|125951|105657|88665|46806&chds=0,630106&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++315053++devouring_plague,9482C9,0,0,15|t++242089++halo,9482C9,1,0,15|t++133507++vampiric_touch,9482C9,2,0,15|t++125951++shadow_word_pain,9482C9,3,0,15|t++105657++shadow_word_death,9482C9,4,0,15|t++88665++mind_blast,9482C9,5,0,15|t++46806++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,15,12,10,9,7,6,6,6,5,5,4,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|mindbender: melee|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:wy023222221z012z00121yxusqrqoonopqrstsrqponnmnomnnmmkkjjgffghiklmoooopooppooqsqrponlkihgffffghhiigeeeeeeefhhiihgfeeefejjkmnoqqrrrqppqrsrsrrnmkkihffedccdffgfggggfffffikjkkjjihhghhhgghijkkkkllllmmlmnnmmmmmlljkhhihiiijjkjijjjiijjkkkkihgfeeeeeeeefhiikllonopppqssrssrqqommjiheeeffffdddcccccdeefggfghggghijklmnoopqqrrrsqppqrrqqoonmlmkkjiijklmooooppppqrssttsqponllkkjjjjkllmmnnnpqqrrtuvvvvvutstsrqqpppqpqqqqqpppppqqqqpopppoponnopqstuvwyy013333557876665343210zyyyxyyyyxxxxxwxwwwussssrsqpppqqrrsuvwwx023324456654532310zyyxwwwxxxxxxxxxxxxwwwvvvustsrqsssrrsssrsr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6583,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=113477|max=172383&chxp=1,1,66,100&chtt=priest_90_tof_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,24,48,24,32,96,224,288,328,432,600,816,1200,1328,1584,1768,2128,2552,2616,2768,2904,2992,2936,2832,2600,2768,2624,2152,1720,1528,1472,1096,776,688,560,488,336,184,152,144,32,48,48,0,8,8,0,0,0,16&chds=0,2992&chbh=5&chxt=x&chxl=0:|min=106914|avg=113477|max=121721&chxp=0,1,44,100&chtt=priest_90_tof_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:34.3,20.9,15.5,11.4,4.4,3.8,2.9,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 154.7s|shadow_word_pain 94.3s|vampiric_touch 70.0s|mind_blast 51.5s|devouring_plague 19.7s|shadow_word_death 17.3s|halo 12.9s|mindbender 8.3s|waiting 1.3s&chtt=priest_90_tof_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no4PT14 113477
devouring_plague 5264 (13747) 4.6% (12.1%) 16.5 28.10sec 374878 315053 118213 245128 143501 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 0.00 0.00 1.1899 0.0000 2374095.54 2374095.54 0.00 315053.12 315053.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.25 80.08% 118212.69 102399 157653 118236.56 108338 128098 1566106 1566106 0.00
crit 3.30 19.92% 245127.73 210941 324765 238547.46 0 324765 807989 807989 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2021 1.8% 38.5 10.86sec 23701 0 19570 40516 23740 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.49 38.42 0.00 0.00 0.0000 0.0000 912171.87 912171.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.77 80.09% 19569.77 17006 26181 19570.79 17916 21424 602241 602241 0.00
crit 7.65 19.91% 40515.74 35032 53932 40530.41 35032 53932 309931 309931 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6461 5.7% 16.5 28.10sec 176245 0 0 0 0 0.0% 0.0% 0.0% 0.0% 123.2 19512 40402 23659 19.9% 0.0% 20.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.54 16.54 123.24 123.24 0.0000 0.7547 2915868.28 2915868.28 0.00 31349.71 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.8 80.15% 19512.38 17006 26181 19513.16 18419 20666 1927417 1927417 0.00
crit 24.5 19.85% 40402.12 35032 53932 40403.24 35383 44826 988451 988451 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6927) 0.0% (6.1%) 10.9 43.01sec 286956 242089 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 10.87 0.00 0.00 1.1854 0.0000 0.00 0.00 0.00 242088.62 242088.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.74 80.40% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.13 19.60% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6927 6.1% 10.9 43.01sec 286956 0 118535 245319 143476 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.87 21.75 0.00 0.00 0.0000 0.0000 3120280.28 3120280.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.47 80.33% 118534.91 104363 160794 118543.90 110382 129045 2070700 2070700 0.00
crit 4.28 19.67% 245319.21 214987 331235 242861.42 0 331235 1049580 1049580 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 43.01sec 0 0 0 0 0 22.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.87 227.37 0.00 0.00 0.0000 0.0000 0.00 45718318.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.27 77.08% 0.00 0 0 0.00 0 0 0 28306411 100.00
crit 52.10 22.92% 0.00 0 0 0.00 0 0 0 17411908 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 10118 8.9% 40.5 11.10sec 112648 88665 92901 192330 112648 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.53 40.53 0.00 0.00 1.2705 0.0000 4565694.91 4565694.91 0.00 88664.60 88664.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 32.48 80.14% 92901.14 82079 126948 92920.08 88554 96980 3017515 3017515 0.00
crit 8.05 19.86% 192330.08 169082 261513 192371.95 0 228302 1548180 1548180 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12265 (16095) 10.8% (14.2%) 94.7 4.64sec 76491 46806 0 0 0 0.0% 0.0% 0.0% 0.0% 185.9 24439 50673 29683 20.0% 0.0% 30.3%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.68 94.68 185.92 185.92 1.6342 0.7355 5518665.48 5518665.48 0.00 46806.33 46806.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.8 80.01% 24438.63 21797 33558 24442.14 23633 25419 3635402 3635402 0.00
crit 37.2 19.99% 50673.26 44901 69130 50685.39 47852 54569 1883263 1883263 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3830 3.4% 58.1 7.39sec 29676 0 24452 50683 29687 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.07 58.05 0.00 0.00 0.0000 0.0000 1723350.84 1723350.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.47 80.04% 24452.05 21797 33558 24456.06 23186 25959 1136176 1136176 0.00
crit 11.59 19.96% 50683.21 44901 69130 50690.97 44901 61608 587175 587175 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1983 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4065 3.6% 14.5 4.98sec 126250 105657 103568 214673 126246 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 0.00 0.00 1.1950 0.0000 1832934.29 1832934.29 0.00 105656.81 105656.81
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.59% 103567.87 79678 123491 103662.62 94541 115195 1196675 1196675 0.00
crit 2.96 20.41% 214673.05 164137 254391 206600.35 0 254391 636259 636259 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 20161 (26335) 17.8% (23.2%) 79.8 5.63sec 148768 125951 0 0 0 0.0% 0.0% 0.0% 0.0% 468.3 14714 30437 19413 29.9% 0.0% 194.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.83 79.83 468.31 468.31 1.1812 1.8739 9091336.21 9091336.21 0.00 12219.53 125950.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 328.3 70.11% 14713.88 12783 20660 14714.54 14280 15190 4831254 4831254 0.00
crit 140.0 29.89% 30436.68 26333 42560 30437.57 29116 31747 4260083 4260083 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy2
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6174 5.4% 146.7 3.04sec 18983 0 14403 29806 18998 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.67 146.55 0.00 0.00 0.0000 0.0000 2784163.26 2784163.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 102.83 70.17% 14403.46 12783 19677 14405.42 13849 14992 1481144 1481144 0.00
crit 43.72 29.83% 29806.02 26333 40534 29810.11 27984 31978 1303019 1303019 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5724 5.0% 119.6 3.74sec 21592 0 18283 36765 21960 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.56 117.56 0.00 0.00 0.0000 0.0000 2581550.69 2581550.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.17 80.10% 18282.97 15875 25856 18285.46 17717 18932 1721658 1721658 0.00
crit 23.39 19.90% 36765.07 31750 51713 36773.61 33911 40610 859893 859893 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 15866 (20729) 14.0% (18.3%) 59.0 7.54sec 158454 133507 0 0 0 0.0% 0.0% 0.0% 0.0% 357.2 16519 34218 20024 19.8% 0.0% 177.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.97 58.97 357.18 357.18 1.1869 2.2353 7152417.30 7152417.30 0.00 10760.29 133506.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 286.4 80.19% 16518.76 14287 23421 16519.17 15962 17228 4731579 4731579 0.00
crit 70.7 19.81% 34217.82 29431 48248 34219.66 32538 36214 2420839 2420839 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4863 4.3% 111.7 3.93sec 19624 0 16185 33539 19638 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 111.68 111.60 0.00 0.00 0.0000 0.0000 2191703.84 2191703.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.40 80.10% 16184.89 14287 22306 16186.48 15495 17239 1446884 1446884 0.00
crit 22.21 19.90% 33539.02 29431 45950 33543.75 30619 37156 744820 744820 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 37634 / 9738
melee 37634 8.6% 105.2 4.17sec 41698 39127 36415 73361 41698 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.16 105.16 0.00 0.00 1.0657 0.0000 4384968.34 4384968.34 0.00 39127.05 39127.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.75 55.86% 36414.73 29063 44745 36425.62 34475 38545 2139279 2139279 0.00
crit 21.21 20.17% 73361.16 58126 89490 73371.02 67619 80283 1555672 1555672 0.00
glance 25.21 23.97% 27373.82 21797 33559 27379.92 25280 29436 690017 690017 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.30sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.38 23.38 0.00 0.00 1.1917 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.38 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.36%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.9sec 107.9sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:15.80%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.7sec 20.7sec 43.47% 43.75%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.47%

    Trigger Attempt Success

    • trigger_pct:1.75%
light_of_the_cosmos 9.7 0.0 48.0sec 48.0sec 42.30% 42.30%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.30%

    Trigger Attempt Success

    • trigger_pct:14.35%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.41% 49.52%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.41%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.3 140.1 17.6sec 0.7sec 21.18% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-raid_movement 1.0 0.0 0.0sec 0.0sec 4.35% 4.35%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:4.35%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.3sec 19.3sec 85.39% 83.92%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
mindbender-stunned 1.0 0.0 0.0sec 0.0sec 1.74% 1.74%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:1.74%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no4PT14
devouring_plague Shadow Orb 16.5 49.6 3.0 3.0 124960.0
halo Mana 10.9 440387.3 40500.0 40500.1 7.1
mind_blast Mana 40.5 364769.3 9000.0 8999.9 12.5
mind_flay Mana 94.7 284034.7 3000.0 3000.0 25.5
shadow_word_death Mana 14.5 113247.3 7800.0 7800.3 16.2
shadow_word_pain Mana 79.8 1053689.5 13200.0 13199.8 11.3
vampiric_touch Mana 59.0 530730.7 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 105.16 320445.92 (11.65%) 3047.19 140259.23 30.44%
Shadow Orbs from Mind Blast Shadow Orb 40.53 40.53 (84.68%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.32%) 1.00 0.00 0.00%
Devouring Plague Health Health 161.67 0.00 (-nan%) 0.00 2245000.47 100.00%
Vampiric Touch Mana Mana 468.79 1985789.64 (72.18%) 4236.02 492118.68 19.86%
mp5_regen Mana 1803.34 444976.47 (16.17%) 246.75 96025.87 17.75%
Resource RPS-Gain RPS-Loss
Mana 6100.79 6179.83
Shadow Orb 0.11 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 264352.01 137652.38 300000.00
Shadow Orb 1.23 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.9%
shadowfiend-Mana Cap 17.9%
lightwell-Mana Cap 17.9%

Procs

Count Interval
Shadowy Recall Extra Tick 354.6 1.3sec
Shadowy Apparition Procced 119.6 3.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no4PT14 Damage Per Second
Count 49992
Mean 113477.19
Minimum 106913.63
Maximum 121721.04
Spread ( max - min ) 14807.41
Range [ ( max - min ) / 2 * 100% ] 6.52%
Standard Deviation 1961.2256
5th Percentile 110316.26
95th Percentile 116780.07
( 95th Percentile - 5th Percentile ) 6463.81
Mean Distribution
Standard Deviation 8.7716
95.00% Confidence Intervall ( 113459.99 - 113494.38 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1147
0.1 Scale Factor Error with Delta=300 32835
0.05 Scale Factor Error with Delta=300 131340
0.01 Scale Factor Error with Delta=300 3283513
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 113477.19
Distribution Chart

Damage

Sample Data
Count 49992
Mean 46764232.78
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 294.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.23 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.52 shadow_word_death,if=active_enemies<=5
F 44.81 mind_blast,if=active_enemies<=6&cooldown_react
G 43.31 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.57 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.87 halo,if=talent.halo.enabled
M 12.32 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.84 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.62 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.76 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.52 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTGGHHFTWWWWWFGHHMTFLTHHGFGTAWWFHHMTGFTHHTGFLTWGWWFHHMTQFTHHGGQFTGAWFHHLMGTFTHHTGFTGWWWWFHHMTQQFTGHHLTFGTWAWFGHHMTFTHHGQFTGTWWLWFHHMTFGTHGHFTGWAFGHHTLFMTGHHFGTWWWWFHHTGQFTHHGFLMTGWWAFHHTQFTGHGHFMTWWWWWFHHLTGTFTHTHGFMTGGWWFAHHTQQFTGLEDEGFHHTWEEWFGMHHEETFTEDEGFGHHEEL9FHAMHEEGFGTHEDEFHTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no2PT14 : 109668 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
109668.2 109668.2 18.76 / 0.02% 3545 / 3.2% 16.2 6537.7 6401.1 Mana 0.23% 41.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:312406|242345|147866|133963|106997|105550|87142|47192&chds=0,624812&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++312406++devouring_plague,9482C9,0,0,15|t++242345++halo,9482C9,1,0,15|t++147866++shadow_word_insanity,9482C9,2,0,15|t++133963++vampiric_touch,9482C9,3,0,15|t++106997++shadow_word_pain,9482C9,4,0,15|t++105550++shadow_word_death,9482C9,5,0,15|t++87142++mind_blast,9482C9,6,0,15|t++47192++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,10,9,9,7,6,5,5,5,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|devouring_plague|vampiric_touch_mastery|shadowy_apparition|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:4556545767635583535641zzyxywtsrstuvwxvutsrqpoppooonmlkihddccddefggiiiiijkjjknooqponmmkliiihijllmmjjihhhhijllmnmlkigfgffgiijkkkkkjihijjjlmlmmljiihghggfffgghgggggffgghkllmlllklllmnmmnprrsqppooooppnnppoqponlmlmklmmnoopqrpponnnnmmonoomlkjighfeeeefghhjjjihijkjkooopppoonlljjihiijiiiggffffffhijjjjjjjjjjjijklmmnmnmmmlmnnmmopprpponnmommmmnoopqrqqqqqqqstuuwwussqqqqqpppqrstststsrstuvuwvvwwvuutrsrrqrsstttutuutttttuvvvvuttttstsssrsstuuvvvwwxzyzy11344455545443333333433221100z0zz0ywwwwvvtsrrrrrssuuvvuwyzzyz011112211110z00001122222111111122100zyyzyxxvvvwwwvvutr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6821,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=109668|max=160784&chxp=1,1,68,100&chtt=priest_90_tof_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,0,0,0,8,16,72,96,112,120,312,440,568,984,1032,1576,1848,2504,2800,3008,3208,3304,3432,3440,2984,3040,2688,2144,2232,1928,1552,1144,672,704,576,488,400,136,128,88,104,24,24,32,8,0,8&chds=0,3440&chbh=5&chxt=x&chxl=0:|min=100193|avg=109668|max=118346&chxp=0,1,52,100&chtt=priest_90_tof_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.9,21.4,15.6,11.4,6.6,4.3,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 130.2s|shadow_word_pain 96.5s|vampiric_touch 70.4s|mind_blast 51.2s|shadow_word_insanity 29.9s|devouring_plague 19.4s|shadow_word_death 17.3s|halo 12.8s|shadowfiend 2.4s|waiting 1.0s&chtt=priest_90_tof_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no2PT14 109668
devouring_plague 5151 (13426) 4.7% (12.3%) 16.2 28.78sec 373586 312406 118114 244758 143246 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 0.00 0.00 1.1959 0.0000 2322563.31 2322563.31 0.00 312405.94 312405.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.00 80.16% 118113.98 102399 157653 118135.76 109409 126767 1535054 1535054 0.00
crit 3.22 19.84% 244757.94 210941 324765 237305.74 0 324765 787509 787509 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1977 1.8% 37.7 11.11sec 23692 0 19545 40524 23730 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.59 0.00 0.00 0.0000 0.0000 892112.22 892112.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.09 80.05% 19545.19 17006 26181 19543.95 18106 21197 588184 588184 0.00
crit 7.50 19.95% 40524.33 35032 53932 40508.00 0 51512 303928 303928 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6299 5.8% 16.2 28.78sec 175318 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.2 19486 40383 23640 19.9% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.21 16.21 120.24 120.24 0.0000 0.7584 2842563.34 2842563.34 0.00 31169.48 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.3 80.12% 19485.51 17006 26181 19484.67 18319 20727 1877164 1877164 0.00
crit 23.9 19.88% 40383.47 35032 53932 40376.30 36101 45024 965399 965399 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6897) 0.0% (6.3%) 10.8 43.20sec 287113 242345 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 10.83 0.00 0.00 1.1848 0.0000 0.00 0.00 0.00 242344.80 242344.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.67 80.10% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.90% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6897 6.3% 10.8 43.20sec 287113 0 118570 245620 143555 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.83 21.65 0.00 0.00 0.0000 0.0000 3108072.08 3108072.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.39 80.33% 118570.30 104363 160794 118576.95 109518 128218 2062262 2062262 0.00
crit 4.26 19.67% 245620.38 214987 331235 243334.14 0 331235 1045810 1045810 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.20sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.83 227.33 0.00 0.00 0.0000 0.0000 0.00 45762452.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.04 77.00% 0.00 0 0 0.00 0 0 0 28280985 100.00
crit 52.29 23.00% 0.00 0 0 0.00 0 0 0 17481468 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9894 9.0% 39.6 11.37sec 112764 87142 92983 192547 112765 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.59 39.59 0.00 0.00 1.2940 0.0000 4464733.84 4464733.84 0.00 87142.26 87142.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.73 80.13% 92982.94 82079 126948 92996.01 88728 97437 2950094 2950094 0.00
crit 7.87 19.87% 192547.33 169082 261513 192477.93 0 249617 1514639 1514639 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10394 (13652) 9.5% (12.4%) 79.9 5.48sec 76853 47192 0 0 0 0.0% 0.0% 0.0% 0.0% 158.2 24361 50512 29566 19.9% 0.0% 25.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.94 79.94 158.20 158.20 1.6285 0.7319 4677278.28 4677278.28 0.00 47192.42 47192.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 80.10% 24361.00 21797 33558 24364.00 23515 25304 3086854 3086854 0.00
crit 31.5 19.90% 50511.74 44901 69130 50517.63 47249 54372 1590425 1590425 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3258 3.0% 49.6 8.59sec 29568 0 24385 50540 29581 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.59 49.57 0.00 0.00 0.0000 0.0000 1466325.88 1466325.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.72 80.13% 24385.04 21797 33558 24387.87 23000 26060 968608 968608 0.00
crit 9.85 19.87% 50540.20 44901 69130 50539.84 0 60113 497718 497718 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4059 3.7% 14.5 4.99sec 126144 105550 103536 214538 126142 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.51 14.51 0.00 0.00 1.1952 0.0000 1830126.73 1830126.73 0.00 105549.73 105549.73
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.63% 103535.86 79678 123491 103628.06 94369 113512 1196187 1196187 0.00
crit 2.95 20.37% 214538.25 164137 254391 206221.75 0 254391 633940 633940 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9799 9.0% 25.4 17.07sec 174534 147866 143894 298425 174533 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.36 25.36 0.00 0.00 1.1804 0.0000 4425326.28 4425326.28 0.00 147865.75 147865.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.33 80.17% 143893.96 122772 199962 143917.67 132253 158509 2925041 2925041 0.00
crit 5.03 19.83% 298424.95 252910 411923 297371.51 0 393026 1500286 1500286 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 17541 (22917) 16.0% (20.9%) 81.5 5.51sec 126791 106997 0 0 0 0.0% 0.0% 0.0% 0.0% 443.1 14713 30481 17846 19.9% 0.0% 180.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.48 81.48 443.09 443.09 1.1850 1.8392 7907622.57 7907622.57 0.00 11333.63 106997.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.48 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 355.0 80.13% 14713.39 12783 20660 14714.75 14343 15153 5223964 5223964 0.00
crit 88.0 19.87% 30480.86 26333 42560 30483.55 29100 32474 2683659 2683659 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5376 4.9% 138.8 3.22sec 17452 0 14404 29837 17467 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.84 138.72 0.00 0.00 0.0000 0.0000 2422968.18 2422968.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 111.19 80.16% 14404.32 12783 19677 14406.30 13910 14969 1601610 1601610 0.00
crit 27.53 19.84% 29837.14 26333 40534 29845.23 27400 32895 821358 821358 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2242 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4448 4.1% 93.0 4.80sec 21570 0 18278 36766 21939 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.99 91.43 0.00 0.00 0.0000 0.0000 2005840.69 2005840.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 73.32 80.20% 18277.82 15875 25856 18279.45 17552 19117 1340134 1340134 0.00
crit 18.11 19.80% 36765.73 31750 51713 36773.32 33204 41574 665707 665707 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16008 (20921) 14.6% (19.1%) 59.4 7.49sec 158727 133963 0 0 0 0.0% 0.0% 0.0% 0.0% 359.8 16540 34264 20057 19.8% 0.0% 178.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.42 59.42 359.84 359.84 1.1849 2.2345 7217181.31 7217181.31 0.00 10786.35 133963.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.4 80.16% 16539.81 14287 23421 16540.19 16048 17076 4770620 4770620 0.00
crit 71.4 19.84% 34263.90 29431 48248 34263.63 32402 36385 2446562 2446562 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4913 4.5% 112.8 3.90sec 19631 0 16189 33560 19646 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.84 112.75 0.00 0.00 0.0000 0.0000 2215030.98 2215030.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.31 80.10% 16188.55 14287 22306 16189.93 15528 17064 1461942 1461942 0.00
crit 22.44 19.90% 33559.52 29431 45950 33569.98 30765 37368 753089 753089 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46168 / 3656
melee 46168 3.3% 31.2 12.61sec 52276 51481 45644 92125 52275 20.1% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0155 0.0000 1629732.43 1629732.43 0.00 51480.95 51480.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.44 55.96% 45644.37 36329 55931 45658.34 41639 51207 796244 796244 0.00
crit 6.27 20.10% 92125.25 72658 111863 92015.12 0 111863 577270 577270 0.00
glance 7.47 23.95% 34322.48 27247 41949 34323.26 0 41949 256218 256218 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.50sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1998 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.46%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.54%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.54% 43.80%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.54%

    Trigger Attempt Success

    • trigger_pct:1.79%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.20% 42.20%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.20%

    Trigger Attempt Success

    • trigger_pct:14.40%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.40% 49.50%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.3 135.9 17.2sec 0.7sec 21.18% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.37% 77.48%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no2PT14
devouring_plague Shadow Orb 16.2 48.6 3.0 3.0 124527.5
halo Mana 10.8 438423.8 40500.0 40500.1 7.1
mind_blast Mana 39.6 356345.3 9000.0 9000.1 12.5
mind_flay Mana 79.9 239817.6 3000.0 3000.0 25.6
shadow_word_death Mana 14.5 113168.6 7800.0 7800.3 16.2
shadow_word_insanity Mana 25.4 190160.4 7500.0 7499.9 23.3
shadow_word_pain Mana 81.5 1075493.8 13200.0 13199.9 9.6
vampiric_touch Mana 59.4 534818.9 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 184703.28 (6.40%) 5924.60 95877.84 34.17%
Shadow Orbs from Mind Blast Shadow Orb 39.59 39.59 (84.38%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.62%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.83 0.00 (-nan%) 0.00 2191791.42 100.00%
Vampiric Touch Mana Mana 472.58 2214750.34 (76.72%) 4686.46 282511.10 11.31%
mp5_regen Mana 1803.34 487175.81 (16.88%) 270.15 53826.53 9.95%
Resource RPS-Gain RPS-Loss
Mana 6401.08 6537.67
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 238397.84 100800.00 300000.00
Shadow Orb 1.28 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
shadowfiend-Mana Cap 10.1%
lightwell-Mana Cap 10.1%

Procs

Count Interval
Shadowy Recall Extra Tick 338.6 1.3sec
Shadowy Apparition Procced 93.0 4.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no2PT14 Damage Per Second
Count 49992
Mean 109668.25
Minimum 100192.60
Maximum 118346.45
Spread ( max - min ) 18153.85
Range [ ( max - min ) / 2 * 100% ] 8.28%
Standard Deviation 2139.5697
5th Percentile 106285.81
95th Percentile 113375.55
( 95th Percentile - 5th Percentile ) 7089.74
Mean Distribution
Standard Deviation 9.5692
95.00% Confidence Intervall ( 109649.49 - 109687.00 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1462
0.1 Scale Factor Error with Delta=300 39078
0.05 Scale Factor Error with Delta=300 156313
0.01 Scale Factor Error with Delta=300 3907838
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 109668.25
Distribution Chart

Damage

Sample Data
Count 49992
Mean 47797745.68
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 309.08
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.37 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.51 shadow_word_death,if=active_enemies<=5
F 44.88 mind_blast,if=active_enemies<=6&cooldown_react
G 45.46 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.75 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.35 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.83 halo,if=talent.halo.enabled
M 11.85 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.56 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.45 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 45.07 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.02 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTIGIGHHFTWWWIGFHHMTFLTHGGHFTWWWFHHGTQQFMTHHIGQFTIGLWWWWFHHTIGFMTHGHTQFTIGGWFHHTLTFTHGHGFMTWWWWFHHGTQFTHHGLFIGTBWWFHHMIGTQFTHHGTFIGTWWLWFHHMTIGFTHHIGQFTIGGWFHHMTLFTIGHHIGFTWWWIFGHHMTFTIGHHFGLTWWWFHHTIGTFMTHHIGQFTIGTWWWWFHHLTFGTHGHFMTGBGFHHTQFTIGEDEGFHHLWEEWFMTHHEEGFTIEDEFGHHGEE9FHMTHIEEFGLIGHTEDEFHTW

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no4PT14 : 112777 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
112777.3 112777.3 18.96 / 0.02% 3561 / 3.2% 16.7 6537.5 6400.3 Mana 0.22% 41.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:311957|242531|147941|133889|116280|105578|87168|47173&chds=0,623913&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++311957++devouring_plague,9482C9,0,0,15|t++242531++halo,9482C9,1,0,15|t++147941++shadow_word_insanity,9482C9,2,0,15|t++133889++vampiric_touch,9482C9,3,0,15|t++116280++shadow_word_pain,9482C9,4,0,15|t++105578++shadow_word_death,9482C9,5,0,15|t++87168++mind_blast,9482C9,6,0,15|t++47173++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,10,9,9,6,6,5,5,5,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|shadow_word_insanity|halo_damage|devouring_plague_tick|shadow_word_pain_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:35555446675345835456410zyxywttrstvwwxwvussrqpppoppommkjieedddeefhgiijjijkkjknooqpoonmlljjiijklmmmjkjihiiijllmnmlkigfhfggjjkklkkkkjhijjklmlmmmjjihgihggggghihhhhhggggikmlmmllllmmnnmnnprrsqppppoopponpppqppnmmlmklmmnopqqrpponnnnmmoooomlkkihhgfeefggiijjjjhijkkloopqqpponlmjjiijjjjiigggfffffhijjjjjkjkjjkjkklmnnmnnmnmmonmmopprqpoonnomnmnnopqrrrrqqqrrstvvwwvtsqqqqqpppqrstststsrsuuvuwvvwwvuutrtrrrrsstttutuuutuutuvvwvutttttttssssttuuvvvwwxzyzy01244555546544333333443321100z0zz0ywwwwvvtsrrrrsssuuvvuwyzzy00122222212100000011222211111111121zzyxxyxwwwwwwwwwwwvt&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6874,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=112777|max=164073&chxp=1,1,69,100&chtt=priest_90_tof_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,40,32,24,72,136,168,176,296,408,520,608,904,1232,1400,1584,1600,2056,2248,2488,2816,2688,2904,2848,2704,2520,2512,2152,2440,1728,1624,1408,904,1040,752,800,520,360,344,296,224,56,128,96,48,24,8,16,16,16&chds=0,2904&chbh=5&chxt=x&chxl=0:|min=105703|avg=112777|max=120829&chxp=0,1,47,100&chtt=priest_90_tof_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:28.9,21.4,15.6,11.4,6.6,4.3,3.8,2.8,0.5,0.2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 130.2s|shadow_word_pain 96.6s|vampiric_touch 70.4s|mind_blast 51.2s|shadow_word_insanity 29.8s|devouring_plague 19.4s|shadow_word_death 17.3s|halo 12.8s|shadowfiend 2.4s|waiting 1.0s&chtt=priest_90_tof_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no4PT14 112777
devouring_plague 5154 (13413) 4.6% (11.9%) 16.2 28.76sec 373038 311957 118118 244630 143226 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 0.00 0.00 1.1958 0.0000 2323033.93 2323033.93 0.00 311956.58 311956.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 13.00 80.15% 118118.22 102399 157653 118143.57 109989 127930 1535555 1535555 0.00
crit 3.22 19.85% 244629.62 210941 324765 237270.72 0 324765 787479 787479 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 1969 1.7% 37.6 11.13sec 23665 0 19541 40523 23703 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.56 37.50 0.00 0.00 0.0000 0.0000 888776.73 888776.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.06 80.16% 19541.09 17006 26181 19540.96 17900 21050 587382 587382 0.00
crit 7.44 19.84% 40523.22 35032 53932 40502.94 0 51512 301395 301395 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 6290 5.6% 16.2 28.76sec 175014 0 0 0 0 0.0% 0.0% 0.0% 0.0% 120.1 19477 40384 23637 19.9% 0.0% 20.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.22 16.22 120.09 120.09 0.0000 0.7584 2838587.12 2838587.12 0.00 31165.87 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.2 80.10% 19477.39 17006 26181 19475.58 18447 20789 1873565 1873565 0.00
crit 23.9 19.90% 40384.02 35032 53932 40377.89 36941 45022 965022 965022 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6907) 0.0% (6.1%) 10.8 43.21sec 287470 242531 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 10.82 0.00 0.00 1.1853 0.0000 0.00 0.00 0.00 242530.50 242530.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.67 80.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.89% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6907 6.1% 10.8 43.21sec 287470 0 118577 245357 143732 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.82 21.65 0.00 0.00 0.0000 0.0000 3111423.85 3111423.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.35 80.16% 118577.14 104363 160794 118590.52 108337 129177 2057507 2057507 0.00
crit 4.30 19.84% 245356.63 214987 331235 242978.99 0 331235 1053916 1053916 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 43.21sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.82 227.26 0.00 0.00 0.0000 0.0000 0.00 45722273.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.03 77.02% 0.00 0 0 0.00 0 0 0 28269687 100.00
crit 52.22 22.98% 0.00 0 0 0.00 0 0 0 17452587 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 9899 8.8% 39.6 11.37sec 112775 87168 92989 192542 112775 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.60 39.60 0.00 0.00 1.2938 0.0000 4466152.61 4466152.61 0.00 87168.25 87168.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 31.73 80.12% 92988.73 82079 126948 93001.90 87670 97726 2950626 2950626 0.00
crit 7.87 19.88% 192541.58 169082 261513 192505.17 0 235602 1515527 1515527 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10397 (13652) 9.2% (12.1%) 80.0 5.48sec 76827 47173 0 0 0 0.0% 0.0% 0.0% 0.0% 158.2 24364 50501 29568 19.9% 0.0% 25.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.96 79.96 158.23 158.23 1.6286 0.7319 4678716.58 4678716.58 0.00 47173.06 47173.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.7 80.09% 24364.34 21797 33558 24367.15 23451 25320 3087615 3087615 0.00
crit 31.5 19.91% 50501.31 44901 69130 50506.89 47177 54321 1591101 1591101 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3255 2.9% 49.5 8.59sec 29564 0 24384 50559 29576 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.54 49.52 0.00 0.00 0.0000 0.0000 1464537.11 1464537.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.70 80.17% 24384.02 21797 33558 24387.37 22801 26044 967958 967958 0.00
crit 9.82 19.83% 50559.00 44901 69130 50550.64 44901 60113 496579 496579 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4060 3.6% 14.5 4.98sec 126198 105578 103524 214732 126197 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.51 14.51 0.00 0.00 1.1953 0.0000 1831037.58 1831037.58 0.00 105577.90 105577.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.55 79.61% 103523.73 79678 123491 103612.86 93912 113664 1195799 1195799 0.00
crit 2.96 20.39% 214732.21 164137 254391 206279.60 0 254391 635239 635239 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 9781 8.7% 25.3 17.11sec 174622 147941 143899 298247 174623 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.29 25.29 0.00 0.00 1.1804 0.0000 4415606.77 4415606.77 0.00 147941.39 147941.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.25 80.10% 143898.86 122772 199962 143927.87 134253 156797 2914430 2914430 0.00
crit 5.03 19.90% 298247.34 252910 411923 296875.85 0 393026 1501177 1501177 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 19085 (24917) 16.9% (22.1%) 81.5 5.51sec 137810 116280 0 0 0 0.0% 0.0% 0.0% 0.0% 443.3 14714 30437 19409 29.9% 0.0% 180.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.50 81.50 443.26 443.26 1.1852 1.8394 8603352.09 8603352.09 0.00 12316.71 116280.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.50 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 310.9 70.14% 14714.25 12783 20660 14715.59 14286 15151 4574637 4574637 0.00
crit 132.4 29.86% 30437.11 26333 42560 30438.77 29426 31614 4028716 4028716 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5832 5.2% 138.6 3.22sec 18967 0 14403 29791 18983 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.59 138.47 0.00 0.00 0.0000 0.0000 2628634.59 2628634.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.26 70.24% 14402.94 12783 19677 14404.70 13818 15085 1400818 1400818 0.00
crit 41.21 29.76% 29790.73 26333 40534 29794.09 28012 31776 1227817 1227817 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.99sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.99 1.99 0.00 0.00 1.2241 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 1.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5577 4.9% 116.5 3.84sec 21580 0 18274 36759 21949 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.53 114.56 0.00 0.00 0.0000 0.0000 2514603.03 2514603.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.79 80.12% 18274.19 15875 25856 18276.08 17706 18895 1677340 1677340 0.00
crit 22.78 19.88% 36758.61 31750 51713 36763.33 33407 40302 837263 837263 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16017 (20913) 14.2% (18.5%) 59.4 7.49sec 158641 133889 0 0 0 0.0% 0.0% 0.0% 0.0% 359.9 16544 34262 20065 19.9% 0.0% 178.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.43 59.43 359.87 359.87 1.1849 2.2344 7220860.48 7220860.48 0.00 10780.45 133888.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.43 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 288.4 80.13% 16544.25 14287 23421 16544.82 16052 17239 4770534 4770534 0.00
crit 71.5 19.87% 34261.86 29431 48248 34262.47 32322 36371 2450326 2450326 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 4895 4.3% 112.5 3.91sec 19609 0 16188 33556 19625 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.54 112.44 0.00 0.00 0.0000 0.0000 2206774.01 2206774.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.19 80.21% 16188.23 14287 22306 16190.36 15510 16918 1460015 1460015 0.00
crit 22.25 19.79% 33555.80 29431 45950 33564.46 30784 37645 746759 746759 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 46219 / 3660
melee 46219 3.2% 31.2 12.61sec 52316 51532 45631 92123 52315 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.18 31.18 0.00 0.00 1.0152 0.0000 1631403.00 1631403.00 0.00 51532.09 51532.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.36 55.67% 45630.76 36329 55931 45649.02 41183 52424 792168 792168 0.00
crit 6.31 20.24% 92123.36 72658 111863 91992.89 0 111863 581566 581566 0.00
glance 7.51 24.08% 34309.26 27247 41949 34294.42 0 41949 257668 257668 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.48sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.92 5.92 0.00 0.00 1.1997 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.00% 11.45%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.14% 20.14%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.14%

    Trigger Attempt Success

    • trigger_pct:15.65%
jade_serpent_potion 1.0 0.0 421.9sec 0.0sec 10.13% 10.13%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.13%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.53% 43.78%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.53%

    Trigger Attempt Success

    • trigger_pct:1.79%
light_of_the_cosmos 9.7 0.0 48.1sec 48.1sec 42.20% 42.20%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.20%

    Trigger Attempt Success

    • trigger_pct:14.43%
raid_movement 15.5 0.0 30.0sec 30.0sec 17.13% 17.13%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:17.13%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.3 0.0 10.4sec 10.4sec 9.40% 49.51%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.40%

Trigger Attempt Success

  • trigger_pct:100.00%
stunned 8.0 0.0 60.0sec 0.0sec 3.55% 3.55%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:3.55%
twist_of_fate 1.2 140.0 17.4sec 0.7sec 21.27% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:21.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-raid_movement 1.0 0.0 0.0sec 0.0sec 14.26% 14.26%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:14.26%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.5sec 74.5sec 83.38% 77.46%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
shadowfiend-stunned 1.0 0.0 0.0sec 0.0sec 5.70% 5.70%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_stunned
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • stunned_1:5.70%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no4PT14
devouring_plague Shadow Orb 16.2 48.7 3.0 3.0 124346.4
halo Mana 10.8 438352.6 40500.0 40500.1 7.1
mind_blast Mana 39.6 356415.8 9000.0 8999.9 12.5
mind_flay Mana 80.0 239886.7 3000.0 3000.0 25.6
shadow_word_death Mana 14.5 113176.1 7800.0 7800.3 16.2
shadow_word_insanity Mana 25.3 189649.2 7500.0 7500.0 23.3
shadow_word_pain Mana 81.5 1075846.5 13200.0 13200.0 10.4
vampiric_touch Mana 59.4 534846.2 9000.0 9000.0 17.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 31.18 184777.63 (6.40%) 5925.49 95874.05 34.16%
Shadow Orbs from Mind Blast Shadow Orb 39.60 39.60 (84.39%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.33 7.33 (15.61%) 1.00 0.00 0.00%
Devouring Plague Health Health 157.58 0.00 (-nan%) 0.00 2188311.99 100.00%
Vampiric Touch Mana Mana 472.31 2214297.55 (76.72%) 4688.18 282249.17 11.31%
mp5_regen Mana 1803.34 487217.42 (16.88%) 270.17 53784.91 9.94%
Resource RPS-Gain RPS-Loss
Mana 6400.33 6537.55
Shadow Orb 0.10 0.11
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 238120.36 72600.00 300000.00
Shadow Orb 1.27 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.1%
shadowfiend-Mana Cap 10.1%
lightwell-Mana Cap 10.1%

Procs

Count Interval
Shadowy Recall Extra Tick 337.9 1.3sec
Shadowy Apparition Procced 116.5 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no4PT14 Damage Per Second
Count 49992
Mean 112777.30
Minimum 105703.11
Maximum 120828.96
Spread ( max - min ) 15125.85
Range [ ( max - min ) / 2 * 100% ] 6.71%
Standard Deviation 2162.5627
5th Percentile 109340.68
95th Percentile 116461.84
( 95th Percentile - 5th Percentile ) 7121.16
Mean Distribution
Standard Deviation 9.6720
95.00% Confidence Intervall ( 112758.34 - 112796.25 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1412
0.1 Scale Factor Error with Delta=300 39922
0.05 Scale Factor Error with Delta=300 159691
0.01 Scale Factor Error with Delta=300 3992281
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 112777.30
Distribution Chart

Damage

Sample Data
Count 49992
Mean 49192096.48
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 309.02
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 1.99 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.37 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.51 shadow_word_death,if=active_enemies<=5
F 44.88 mind_blast,if=active_enemies<=6&cooldown_react
G 45.46 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 59.76 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 25.29 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.82 halo,if=talent.halo.enabled
M 11.85 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 0.55 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.41 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 45.08 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 36.04 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DGGLFHHTFTIGIGHHFTWWWWIFGHHMTFLTHGGFHTWWWFHHIGMTFTHTHGFIGLWWWWFHHMTIFGTHHGFTGGWFHHTLTFMTHGGFHTWWWWFHTHGTFMTHIGHLFIGTBWWFHHTIGFMTHHGFTIGWWWFHHLTFIGMIGHHTFTGIGFHHTFIGIGHHDFLTWWWWFHGHTQFTHIGFHIGMTWWWFHHLTIGQFTHHGQFMTIGWWWWFHHTFIGTHHGLFMTGBGFHHTQFTIEDEGGFHHTEEWWFLMHEEGHFHTIEDEFGHTEEG9FHMHIEEGFTLIGHEDEFHTIG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 352 - 551 ( 451.0 )

Performance:
Total Events Processed: 2636374088
Max Event Queue: 353
Sim Seconds: 22548004
CPU Seconds: 6783.0600
Speed Up: 3324

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Standard Deviation 54.7522
5th Percentile 367.54
95th Percentile 536.35
( 95th Percentile - 5th Percentile ) 168.81
Mean Distribution
Standard Deviation 0.2449
95.00% Confidence Intervall ( 450.48 - 451.44 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 566
0.1% Error 56626
0.1 Scale Factor Error with Delta=300 25
0.05 Scale Factor Error with Delta=300 102
0.01 Scale Factor Error with Delta=300 2559
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague 2944 3053911 6772 2.98 112346 232677 22.4 22.4 19.9% 0.0% 0.0% 0.0% 20.59sec 3053911 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_mastery 124467 1200382 2662 7.08 18595 38494 53.3 53.2 19.9% 0.0% 0.0% 0.0% 8.01sec 1200382 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_tick ticks -2944 3839103 8531 22.73 18576 38455 22.4 170.5 19.8% 0.0% 0.0% 0.0% 20.59sec 3839103 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo 120644 0 0 1.43 0 0 10.8 10.8 19.6% 0.0% 0.0% 0.0% 43.25sec 0 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_damage 120696 3004434 6662 2.87 115154 238258 10.8 21.6 19.7% 0.0% 0.0% 0.0% 43.25sec 3004434 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_heal 120696 0 0 30.40 0 0 10.8 228.5 23.0% 0.0% 0.0% 0.0% 43.25sec 44724011 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_blast 8092 6352714 14087 7.74 89952 186312 58.2 58.2 19.9% 0.0% 0.0% 0.0% 7.69sec 6352714 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay ticks -15407 2932105 6516 13.35 24098 49985 55.5 100.1 20.0% 0.0% 0.0% 0.0% 7.75sec 2932105 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay_mastery 124468 919994 2040 4.18 24118 50029 31.4 31.4 20.1% 0.0% 0.0% 0.0% 13.19sec 919994 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_spike 73510 5594289 12405 8.13 75448 156309 61.1 61.1 19.9% 0.0% 0.0% 0.0% 7.08sec 5594289 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_death 32379 1595259 3537 1.94 90037 186799 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.96sec 1595259 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain ticks -589 7811031 17358 59.90 14331 29667 62.8 449.3 19.9% 0.0% 0.0% 0.0% 7.17sec 7811031 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain_mastery 124464 2378405 5274 18.68 13979 28943 140.5 140.4 19.8% 0.0% 0.0% 0.0% 3.18sec 2378405 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowy_apparition 87532 1976033 4382 12.32 17766 35728 94.2 92.6 19.9% 0.0% 0.0% 0.0% 4.74sec 1976033 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch ticks -34914 6979485 15510 47.65 16105 33352 59.0 357.4 19.9% 0.0% 0.0% 0.0% 7.54sec 6979485 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch_mastery 124465 2128126 4719 14.87 15708 32547 111.8 111.8 19.8% 0.0% 0.0% 0.0% 3.93sec 2128126 450.96sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend melee 0 1630949 46175 52.92 45643 92157 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.62sec 1630949 35.32sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.48sec 0 35.32sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague 2944 3055599 6776 2.98 112377 232712 22.4 22.4 20.0% 0.0% 0.0% 0.0% 20.59sec 3055599 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_mastery 124467 1202979 2668 7.10 18597 38477 53.4 53.4 19.9% 0.0% 0.0% 0.0% 7.99sec 1202979 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_tick ticks -2944 3841451 8537 22.74 18580 38473 22.4 170.5 19.8% 0.0% 0.0% 0.0% 20.59sec 3841451 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.9% 0.0% 0.0% 0.0% 43.21sec 0 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_damage 120696 3008474 6671 2.87 115118 238266 10.8 21.6 19.8% 0.0% 0.0% 0.0% 43.21sec 3008474 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_heal 120696 0 0 30.41 0 0 10.8 228.5 23.0% 0.0% 0.0% 0.0% 43.21sec 44703749 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_blast 8092 6346143 14073 7.75 89953 186171 58.2 58.2 19.8% 0.0% 0.0% 0.0% 7.69sec 6346143 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay ticks -15407 2940567 6535 13.39 24094 49989 55.7 100.4 20.0% 0.0% 0.0% 0.0% 7.73sec 2940567 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay_mastery 124468 920720 2042 4.18 24115 49992 31.4 31.4 20.1% 0.0% 0.0% 0.0% 13.17sec 920720 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_spike 73510 5563705 12337 8.10 75430 156232 60.9 60.9 19.8% 0.0% 0.0% 0.0% 7.11sec 5563705 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_death 32379 1592839 3532 1.94 90073 186766 14.6 14.6 20.0% 0.0% 0.0% 0.0% 4.96sec 1592839 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain ticks -589 8491259 18869 59.91 14328 29629 62.8 449.3 29.9% 0.0% 0.0% 0.0% 7.17sec 8491259 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain_mastery 124464 2584350 5731 18.67 13975 28903 140.4 140.3 29.8% 0.0% 0.0% 0.0% 3.18sec 2584350 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowy_apparition 87532 2463838 5464 15.37 17764 35706 117.5 115.6 19.8% 0.0% 0.0% 0.0% 3.81sec 2463838 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch ticks -34914 6978168 15507 47.65 16104 33354 59.0 357.4 19.8% 0.0% 0.0% 0.0% 7.54sec 6978168 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch_mastery 124465 2125335 4713 14.85 15706 32539 111.7 111.6 19.8% 0.0% 0.0% 0.0% 3.93sec 2125335 450.96sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend melee 0 1628885 46114 52.91 45641 92160 31.1 31.1 20.2% 0.0% 24.3% 0.0% 12.62sec 1628885 35.32sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.32sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague 2944 2858163 6338 2.79 112426 232911 21.0 21.0 19.8% 0.0% 0.0% 0.0% 22.05sec 2858163 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_mastery 124467 1120611 2485 6.60 18610 38540 49.7 49.6 19.9% 0.0% 0.0% 0.0% 8.57sec 1120611 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_tick ticks -2944 3578952 7953 21.18 18586 38469 21.0 158.9 19.8% 0.0% 0.0% 0.0% 22.05sec 3578952 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 42.96sec 0 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_damage 120696 3032735 6725 2.89 115086 238213 10.9 21.7 19.9% 0.0% 0.0% 0.0% 42.96sec 3032735 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_heal 120696 0 0 30.44 0 0 10.9 228.8 22.9% 0.0% 0.0% 0.0% 42.96sec 44723879 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_blast 8092 5885228 13050 7.18 89954 186310 53.9 53.9 19.9% 0.0% 0.0% 0.0% 8.31sec 5885228 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay ticks -15407 4909478 10910 22.45 24017 49788 88.9 168.3 20.0% 0.0% 0.0% 0.0% 4.93sec 4909478 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay_mastery 124468 1534838 3403 7.00 24036 49811 52.6 52.6 20.0% 0.0% 0.0% 0.0% 8.13sec 1534838 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.85sec 0 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_death 32379 1588948 3523 1.93 90057 186689 14.5 14.5 20.3% 0.0% 0.0% 0.0% 4.99sec 1588948 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain ticks -589 8003216 17785 61.46 14319 29645 73.7 460.9 19.9% 0.0% 0.0% 0.0% 6.10sec 8003216 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain_mastery 124464 2438284 5407 19.14 13978 28936 144.0 143.9 19.9% 0.0% 0.0% 0.0% 3.10sec 2438284 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadowy_apparition 87532 1999685 4434 12.47 17757 35716 95.4 93.7 19.9% 0.0% 0.0% 0.0% 4.68sec 1999685 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch ticks -34914 6928370 15396 47.34 16091 33324 58.7 355.0 19.9% 0.0% 0.0% 0.0% 7.58sec 6928370 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch_mastery 124465 2115395 4691 14.78 15708 32529 111.2 111.1 19.8% 0.0% 0.0% 0.0% 3.95sec 2115395 450.96sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender melee 0 4382186 37566 54.12 36431 73342 105.2 105.2 20.0% 0.0% 24.1% 0.0% 4.17sec 4382186 116.65sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.65sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague 2944 2859237 6340 2.79 112506 232739 21.0 21.0 19.9% 0.0% 0.0% 0.0% 22.09sec 2859237 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_mastery 124467 1118362 2480 6.59 18617 38519 49.6 49.5 19.9% 0.0% 0.0% 0.0% 8.59sec 1118362 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_tick ticks -2944 3576528 7948 21.15 18594 38495 21.0 158.6 19.9% 0.0% 0.0% 0.0% 22.09sec 3576528 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo 120644 0 0 1.44 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 42.96sec 0 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_damage 120696 3032202 6724 2.89 115091 238129 10.9 21.7 20.0% 0.0% 0.0% 0.0% 42.96sec 3032202 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_heal 120696 0 0 30.44 0 0 10.9 228.8 22.9% 0.0% 0.0% 0.0% 42.96sec 44715956 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_blast 8092 5880133 13039 7.17 89955 186297 53.9 53.9 20.0% 0.0% 0.0% 0.0% 8.32sec 5880133 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay ticks -15407 4907657 10906 22.44 24016 49793 88.9 168.3 20.0% 0.0% 0.0% 0.0% 4.93sec 4907657 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay_mastery 124468 1533797 3401 6.99 24038 49846 52.6 52.6 19.9% 0.0% 0.0% 0.0% 8.13sec 1533797 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.85sec 0 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_death 32379 1588639 3523 1.93 90085 186603 14.5 14.5 20.2% 0.0% 0.0% 0.0% 4.99sec 1588639 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain ticks -589 8703852 19342 61.48 14318 29604 73.8 461.1 29.8% 0.0% 0.0% 0.0% 6.09sec 8703852 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain_mastery 124464 2659390 5897 19.20 13976 28898 144.4 144.3 29.9% 0.0% 0.0% 0.0% 3.09sec 2659390 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadowy_apparition 87532 2489952 5521 15.53 17757 35713 118.7 116.7 19.9% 0.0% 0.0% 0.0% 3.77sec 2489952 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch ticks -34914 6930968 15402 47.35 16093 33331 58.7 355.1 19.9% 0.0% 0.0% 0.0% 7.58sec 6930968 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch_mastery 124465 2114191 4688 14.77 15709 32529 111.1 111.0 19.8% 0.0% 0.0% 0.0% 3.95sec 2114191 450.96sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender melee 0 4387325 37610 54.12 36433 73346 105.2 105.2 20.1% 0.0% 23.9% 0.0% 4.17sec 4387325 116.65sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.29sec 0 116.65sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague 2944 2823150 6260 2.75 112422 232573 20.7 20.7 20.0% 0.0% 0.0% 0.0% 22.38sec 2823150 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_mastery 124467 1102742 2445 6.50 18597 38524 49.0 48.9 19.9% 0.0% 0.0% 0.0% 8.70sec 1102742 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_tick ticks -2944 3525218 7834 20.88 18572 38450 20.7 156.6 19.8% 0.0% 0.0% 0.0% 22.38sec 3525218 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo 120644 0 0 1.43 0 0 10.7 10.7 19.8% 0.0% 0.0% 0.0% 43.55sec 0 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_damage 120696 2989936 6630 2.85 115109 238353 10.7 21.4 19.8% 0.0% 0.0% 0.0% 43.55sec 2989936 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_heal 120696 0 0 30.29 0 0 10.7 227.7 22.9% 0.0% 0.0% 0.0% 43.55sec 44516194 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_blast 8092 5792052 12844 7.06 89973 186319 53.1 53.1 19.9% 0.0% 0.0% 0.0% 8.45sec 5792052 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay ticks -15407 4136234 9192 18.98 23949 49642 75.2 142.3 19.9% 0.0% 0.0% 0.0% 5.80sec 4136234 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay_mastery 124468 1292174 2865 5.91 23968 49681 44.4 44.4 19.9% 0.0% 0.0% 0.0% 9.53sec 1292174 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_death 32379 1588774 3523 1.93 90062 186768 14.5 14.5 20.3% 0.0% 0.0% 0.0% 4.99sec 1588774 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_insanity 129249 4167955 9242 3.27 139888 290179 24.6 24.6 19.8% 0.0% 0.0% 0.0% 17.56sec 4167955 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain ticks -589 7579934 16844 58.20 14318 29643 75.0 436.5 19.9% 0.0% 0.0% 0.0% 6.00sec 7579934 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain_mastery 124464 2309531 5121 18.13 13980 28930 136.4 136.3 19.8% 0.0% 0.0% 0.0% 3.27sec 2309531 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowy_apparition 87532 1935201 4291 12.07 17757 35682 92.3 90.7 20.0% 0.0% 0.0% 0.0% 4.84sec 1935201 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch ticks -34914 7003956 15564 47.80 16109 33361 59.2 358.5 19.9% 0.0% 0.0% 0.0% 7.52sec 7003956 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch_mastery 124465 2134521 4733 14.91 15711 32559 112.1 112.0 19.8% 0.0% 0.0% 0.0% 3.92sec 2134521 450.96sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend melee 0 1631287 46177 52.94 45625 92198 31.2 31.2 20.2% 0.0% 23.9% 0.0% 12.61sec 1631287 35.33sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.33sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague 2944 2818386 6250 2.75 112393 232622 20.7 20.7 19.9% 0.0% 0.0% 0.0% 22.40sec 2818386 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_mastery 124467 1101220 2442 6.50 18602 38497 48.9 48.9 19.8% 0.0% 0.0% 0.0% 8.70sec 1101220 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_tick ticks -2944 3521666 7826 20.85 18569 38444 20.7 156.4 19.9% 0.0% 0.0% 0.0% 22.40sec 3521666 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo 120644 0 0 1.43 0 0 10.7 10.7 19.7% 0.0% 0.0% 0.0% 43.55sec 0 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_damage 120696 2985354 6620 2.85 115170 238300 10.7 21.4 19.5% 0.0% 0.0% 0.0% 43.55sec 2985354 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_heal 120696 0 0 30.31 0 0 10.7 227.8 22.9% 0.0% 0.0% 0.0% 43.55sec 44565060 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_blast 8092 5789996 12839 7.05 89980 186413 53.0 53.0 20.0% 0.0% 0.0% 0.0% 8.45sec 5789996 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay ticks -15407 4135442 9190 18.98 23953 49652 75.3 142.3 19.9% 0.0% 0.0% 0.0% 5.80sec 4135442 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay_mastery 124468 1295868 2874 5.93 23972 49666 44.6 44.6 19.9% 0.0% 0.0% 0.0% 9.50sec 1295868 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_death 32379 1588721 3523 1.93 90027 186708 14.5 14.5 20.2% 0.0% 0.0% 0.0% 4.99sec 1588721 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_insanity 129249 4183235 9276 3.28 139820 289785 24.6 24.6 20.1% 0.0% 0.0% 0.0% 17.50sec 4183235 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain ticks -589 8238728 18308 58.19 14314 29597 74.9 436.4 29.9% 0.0% 0.0% 0.0% 6.00sec 8238728 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain_mastery 124464 2514938 5577 18.16 13977 28892 136.6 136.5 29.8% 0.0% 0.0% 0.0% 3.27sec 2514938 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.90sec 0 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowy_apparition 87532 2427299 5383 15.16 17753 35692 115.9 113.9 19.8% 0.0% 0.0% 0.0% 3.86sec 2427299 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch ticks -34914 7000520 15557 47.79 16111 33349 59.2 358.4 19.8% 0.0% 0.0% 0.0% 7.52sec 7000520 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch_mastery 124465 2134906 4734 14.91 15711 32540 112.1 112.0 19.9% 0.0% 0.0% 0.0% 3.92sec 2134906 450.96sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend melee 0 1632336 46205 52.93 45646 92148 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.61sec 1632336 35.33sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.33sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague 2944 2504453 5554 2.44 112507 233100 18.4 18.4 19.8% 0.0% 0.0% 0.0% 25.40sec 2504453 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_mastery 124467 985802 2186 5.81 18615 38530 43.7 43.6 20.0% 0.0% 0.0% 0.0% 9.70sec 985802 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_tick ticks -2944 3146386 6992 18.64 18571 38430 18.4 139.8 19.8% 0.0% 0.0% 0.0% 25.40sec 3146386 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo 120644 0 0 1.46 0 0 10.9 10.9 19.9% 0.0% 0.0% 0.0% 42.71sec 0 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_damage 120696 3049581 6762 2.91 115076 238129 10.9 21.9 19.8% 0.0% 0.0% 0.0% 42.71sec 3049581 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_heal 120696 0 0 30.65 0 0 10.9 230.4 23.0% 0.0% 0.0% 0.0% 42.71sec 45053516 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_blast 8092 5010988 11112 6.12 89955 186286 46.0 46.0 19.8% 0.0% 0.0% 0.0% 9.77sec 5010988 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay ticks -15407 3725751 8279 16.92 24165 50110 66.9 126.9 20.1% 0.0% 0.0% 0.0% 6.51sec 3725751 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay_mastery 124468 1169358 2593 5.29 24183 50141 39.8 39.8 20.2% 0.0% 0.0% 0.0% 10.64sec 1169358 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_spike 73510 6116885 13564 8.88 75550 156569 66.7 66.7 19.9% 0.0% 0.0% 0.0% 6.54sec 6116885 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_death 32379 1616020 3584 1.96 90126 186973 14.7 14.7 20.5% 0.0% 0.0% 0.0% 4.92sec 1616020 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain ticks -589 8254469 18343 63.07 14384 29790 65.7 473.0 19.9% 0.0% 0.0% 0.0% 6.85sec 8254469 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain_mastery 124464 2509370 5565 19.65 13999 29004 147.8 147.7 19.9% 0.0% 0.0% 0.0% 3.02sec 2509370 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowy_apparition 87532 2039496 4523 12.70 17791 35779 97.1 95.5 19.8% 0.0% 0.0% 0.0% 4.60sec 2039496 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch ticks -34914 7436691 16526 50.69 16129 33411 59.2 380.2 19.9% 0.0% 0.0% 0.0% 7.52sec 7436691 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch_mastery 124465 2268901 5031 15.79 15747 32638 118.8 118.7 19.9% 0.0% 0.0% 0.0% 3.71sec 2268901 450.96sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend melee 0 1637106 46348 52.98 45733 92427 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.61sec 1637106 35.32sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.48sec 0 35.32sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague 2944 2505169 5555 2.44 112528 232906 18.3 18.3 19.9% 0.0% 0.0% 0.0% 25.42sec 2505169 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_mastery 124467 985727 2186 5.81 18615 38552 43.7 43.7 19.9% 0.0% 0.0% 0.0% 9.70sec 985727 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_tick ticks -2944 3142374 6983 18.62 18572 38430 18.3 139.6 19.8% 0.0% 0.0% 0.0% 25.42sec 3142374 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo 120644 0 0 1.46 0 0 10.9 10.9 19.6% 0.0% 0.0% 0.0% 42.70sec 0 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_damage 120696 3057436 6780 2.91 115100 238188 10.9 21.9 20.0% 0.0% 0.0% 0.0% 42.70sec 3057436 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_heal 120696 0 0 30.66 0 0 10.9 230.4 22.9% 0.0% 0.0% 0.0% 42.70sec 45064256 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_blast 8092 5013944 11118 6.11 89943 186366 45.9 45.9 19.9% 0.0% 0.0% 0.0% 9.78sec 5013944 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay ticks -15407 3726851 8282 16.92 24161 50127 66.9 126.9 20.0% 0.0% 0.0% 0.0% 6.51sec 3726851 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay_mastery 124468 1165965 2586 5.28 24191 50167 39.7 39.7 20.0% 0.0% 0.0% 0.0% 10.69sec 1165965 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_spike 73510 6110304 13550 8.87 75566 156476 66.7 66.7 19.9% 0.0% 0.0% 0.0% 6.54sec 6110304 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_death 32379 1611929 3574 1.96 90073 187051 14.7 14.7 20.2% 0.0% 0.0% 0.0% 4.92sec 1611929 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain ticks -589 8976228 19947 63.07 14381 29750 65.8 473.0 29.9% 0.0% 0.0% 0.0% 6.84sec 8976228 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain_mastery 124464 2727281 6048 19.65 13997 28953 147.8 147.7 29.9% 0.0% 0.0% 0.0% 3.02sec 2727281 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowy_apparition 87532 2527115 5604 15.74 17785 35780 120.4 118.3 19.8% 0.0% 0.0% 0.0% 3.72sec 2527115 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch ticks -34914 7437689 16528 50.69 16130 33414 59.2 380.2 19.9% 0.0% 0.0% 0.0% 7.52sec 7437689 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch_mastery 124465 2273164 5041 15.82 15747 32630 119.0 118.9 19.9% 0.0% 0.0% 0.0% 3.70sec 2273164 450.96sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend melee 0 1638136 46376 52.98 45744 92377 31.2 31.2 20.4% 0.0% 24.0% 0.0% 12.60sec 1638136 35.32sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.47sec 0 35.32sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague 2944 2209425 4899 2.15 112433 232626 16.2 16.2 20.0% 0.0% 0.0% 0.0% 28.52sec 2209425 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_mastery 124467 851485 1888 5.03 18547 38403 37.9 37.8 19.9% 0.0% 0.0% 0.0% 10.93sec 851485 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_tick ticks -2944 2717079 6038 16.12 18534 38358 16.2 120.9 19.8% 0.0% 0.0% 0.0% 28.52sec 2717079 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo 120644 0 0 1.47 0 0 11.0 11.0 19.8% 0.0% 0.0% 0.0% 42.33sec 0 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_damage 120696 3078635 6827 2.94 115072 237997 11.0 22.1 19.8% 0.0% 0.0% 0.0% 42.33sec 3078635 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_heal 120696 0 0 31.00 0 0 11.0 233.0 22.9% 0.0% 0.0% 0.0% 42.33sec 45535903 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_blast 8092 4297170 9529 5.24 89854 186013 39.4 39.4 20.0% 0.0% 0.0% 0.0% 11.44sec 4297170 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay ticks -15407 5984752 13299 27.26 24096 49952 100.2 204.5 20.0% 0.0% 0.0% 0.0% 4.39sec 5984752 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay_mastery 124468 1871379 4150 8.50 24107 49994 63.9 63.9 20.0% 0.0% 0.0% 0.0% 6.77sec 1871379 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.71sec 0 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_death 32379 1601068 3550 1.94 90137 186872 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.94sec 1601068 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain ticks -589 8506269 18903 65.03 14373 29773 80.1 487.7 19.9% 0.0% 0.0% 0.0% 5.61sec 8506269 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain_mastery 124464 2587913 5739 20.27 13999 28992 152.5 152.4 19.9% 0.0% 0.0% 0.0% 2.93sec 2587913 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadowy_apparition 87532 2071039 4593 12.89 17787 35765 98.6 96.9 19.9% 0.0% 0.0% 0.0% 4.53sec 2071039 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch ticks -34914 7352963 16340 50.12 16133 33410 58.8 375.9 19.8% 0.0% 0.0% 0.0% 7.57sec 7352963 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch_mastery 124465 2247957 4985 15.64 15755 32637 117.7 117.6 19.9% 0.0% 0.0% 0.0% 3.74sec 2247957 450.96sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender melee 0 4399576 37638 54.09 36488 73494 105.4 105.4 20.1% 0.0% 24.1% 0.0% 4.17sec 4399576 116.89sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.27sec 0 116.89sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague 2944 2204119 4888 2.15 112422 232858 16.2 16.2 19.7% 0.0% 0.0% 0.0% 28.54sec 2204119 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_mastery 124467 849376 1883 5.03 18548 38416 37.8 37.8 19.8% 0.0% 0.0% 0.0% 10.95sec 849376 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_tick ticks -2944 2717273 6038 16.12 18536 38357 16.2 120.9 19.9% 0.0% 0.0% 0.0% 28.54sec 2717273 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo 120644 0 0 1.47 0 0 11.0 11.0 20.0% 0.0% 0.0% 0.0% 42.34sec 0 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_damage 120696 3076170 6821 2.94 115111 237890 11.0 22.1 19.7% 0.0% 0.0% 0.0% 42.34sec 3076170 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_heal 120696 0 0 31.00 0 0 11.0 233.0 22.9% 0.0% 0.0% 0.0% 42.34sec 45527059 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_blast 8092 4291485 9516 5.24 89835 186033 39.4 39.4 19.9% 0.0% 0.0% 0.0% 11.45sec 4291485 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay ticks -15407 5984347 13299 27.26 24094 49938 100.2 204.4 20.0% 0.0% 0.0% 0.0% 4.39sec 5984347 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay_mastery 124468 1867249 4141 8.48 24108 49994 63.8 63.7 20.0% 0.0% 0.0% 0.0% 6.79sec 1867249 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.71sec 0 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.09sec 0 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_death 32379 1604126 3557 1.94 90167 186780 14.6 14.6 20.3% 0.0% 0.0% 0.0% 4.94sec 1604126 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain ticks -589 9247179 20549 65.03 14368 29722 80.0 487.7 29.9% 0.0% 0.0% 0.0% 5.61sec 9247179 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain_mastery 124464 2814883 6242 20.30 13992 28946 152.7 152.6 29.8% 0.0% 0.0% 0.0% 2.93sec 2814883 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadowy_apparition 87532 2552200 5659 15.90 17778 35754 121.6 119.5 19.9% 0.0% 0.0% 0.0% 3.69sec 2552200 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch ticks -34914 7358535 16352 50.13 16131 33416 58.8 376.0 19.9% 0.0% 0.0% 0.0% 7.57sec 7358535 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch_mastery 124465 2244129 4976 15.62 15755 32648 117.5 117.4 19.9% 0.0% 0.0% 0.0% 3.75sec 2244129 450.96sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender melee 0 4399858 37641 54.09 36480 73475 105.4 105.4 20.1% 0.0% 23.9% 0.0% 4.17sec 4399858 116.89sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.27sec 0 116.89sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague 2944 2193440 4864 2.14 112433 232827 16.1 16.1 19.8% 0.0% 0.0% 0.0% 28.73sec 2193440 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_mastery 124467 853371 1892 5.03 18586 38457 37.9 37.8 20.0% 0.0% 0.0% 0.0% 10.93sec 853371 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_tick ticks -2944 2723098 6051 16.16 18532 38369 16.1 121.2 19.8% 0.0% 0.0% 0.0% 28.73sec 2723098 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.6% 0.0% 0.0% 0.0% 43.40sec 0 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_damage 120696 3015815 6688 2.87 115213 238107 10.8 21.6 19.9% 0.0% 0.0% 0.0% 43.40sec 3015815 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_heal 120696 0 0 29.96 0 0 10.8 225.1 22.9% 0.0% 0.0% 0.0% 43.40sec 44049111 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_blast 8092 4269612 9468 5.21 89851 185983 39.2 39.2 20.0% 0.0% 0.0% 0.0% 11.52sec 4269612 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay ticks -15407 5168950 11487 23.51 24114 50019 86.7 176.4 20.1% 0.0% 0.0% 0.0% 5.06sec 5168950 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay_mastery 124468 1620735 3594 7.35 24136 50031 55.3 55.3 20.0% 0.0% 0.0% 0.0% 7.77sec 1620735 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.13sec 0 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_death 32379 1601003 3550 1.94 90090 186924 14.6 14.6 20.1% 0.0% 0.0% 0.0% 4.95sec 1601003 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_insanity 129249 4204117 9323 3.34 138418 286383 25.1 25.1 19.8% 0.0% 0.0% 0.0% 16.06sec 4204117 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain ticks -589 8102849 18006 61.85 14392 29826 80.8 463.9 19.9% 0.0% 0.0% 0.0% 5.56sec 8102849 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain_mastery 124464 2460320 5456 19.29 14002 29010 145.1 145.0 19.8% 0.0% 0.0% 0.0% 3.08sec 2460320 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowy_apparition 87532 2007752 4452 12.50 17787 35774 95.5 93.9 20.0% 0.0% 0.0% 0.0% 4.68sec 2007752 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch ticks -34914 7434172 16520 50.68 16123 33404 59.2 380.1 19.9% 0.0% 0.0% 0.0% 7.52sec 7434172 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch_mastery 124465 2270196 5034 15.82 15748 32619 119.0 118.9 19.8% 0.0% 0.0% 0.0% 3.70sec 2270196 450.96sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend melee 0 1633088 46240 52.97 45721 92401 31.2 31.2 20.1% 0.0% 24.1% 0.0% 12.61sec 1633088 35.32sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.51sec 0 35.32sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague 2944 2200165 4879 2.14 112479 232628 16.1 16.1 20.1% 0.0% 0.0% 0.0% 28.72sec 2200165 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_mastery 124467 853408 1892 5.04 18584 38486 37.9 37.9 19.8% 0.0% 0.0% 0.0% 10.92sec 853408 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_tick ticks -2944 2724872 6055 16.17 18534 38384 16.1 121.3 19.8% 0.0% 0.0% 0.0% 28.72sec 2724872 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.7% 0.0% 0.0% 0.0% 43.40sec 0 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_damage 120696 3003699 6661 2.87 115164 238126 10.8 21.6 19.5% 0.0% 0.0% 0.0% 43.40sec 3003699 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_heal 120696 0 0 29.94 0 0 10.8 225.0 23.0% 0.0% 0.0% 0.0% 43.40sec 44050457 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_blast 8092 4265524 9459 5.21 89858 185957 39.2 39.2 19.8% 0.0% 0.0% 0.0% 11.52sec 4265524 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay ticks -15407 5164214 11476 23.51 24116 50039 86.7 176.3 19.9% 0.0% 0.0% 0.0% 5.06sec 5164214 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay_mastery 124468 1621397 3595 7.36 24134 50041 55.3 55.3 20.0% 0.0% 0.0% 0.0% 7.78sec 1621397 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.13sec 0 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_death 32379 1601061 3550 1.94 90116 186909 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.95sec 1601061 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_insanity 129249 4201949 9318 3.34 138392 286522 25.1 25.1 19.7% 0.0% 0.0% 0.0% 16.05sec 4201949 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain ticks -589 8810691 19579 61.85 14390 29778 80.8 463.9 29.9% 0.0% 0.0% 0.0% 5.56sec 8810691 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain_mastery 124464 2675550 5933 19.28 14004 28954 145.0 144.9 29.8% 0.0% 0.0% 0.0% 3.08sec 2675550 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.03sec 0 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowy_apparition 87532 2495323 5533 15.54 17779 35753 118.8 116.8 20.0% 0.0% 0.0% 0.0% 3.77sec 2495323 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch ticks -34914 7435767 16524 50.68 16129 33402 59.2 380.1 19.9% 0.0% 0.0% 0.0% 7.52sec 7435767 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch_mastery 124465 2267718 5029 15.80 15749 32636 118.8 118.7 19.9% 0.0% 0.0% 0.0% 3.71sec 2267718 450.96sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend melee 0 1637449 46363 52.97 45762 92394 31.2 31.2 20.3% 0.0% 23.9% 0.0% 12.61sec 1637449 35.32sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.49sec 0 35.32sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague 2944 2589973 5743 2.42 117557 243593 18.2 18.2 19.9% 0.0% 0.0% 0.0% 25.64sec 2589973 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_mastery 124467 1001843 2222 5.64 19486 40364 42.5 42.4 19.8% 0.0% 0.0% 0.0% 9.95sec 1001843 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_tick ticks -2944 3195767 7102 18.10 19411 40212 18.2 135.7 19.9% 0.0% 0.0% 0.0% 25.64sec 3195767 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 19.9% 0.0% 0.0% 0.0% 42.99sec 0 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_damage 120696 3124760 6929 2.89 118498 245203 10.9 21.7 20.0% 0.0% 0.0% 0.0% 42.99sec 3124760 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_heal 120696 0 0 30.44 0 0 10.9 228.8 23.0% 0.0% 0.0% 0.0% 42.99sec 46002863 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_blast 8092 5096277 11301 6.04 92567 191709 45.4 45.4 19.8% 0.0% 0.0% 0.0% 9.88sec 5096277 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay ticks -15407 3483160 7740 15.63 24464 50713 63.8 117.2 20.0% 0.0% 0.0% 0.0% 6.79sec 3483160 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay_mastery 124468 1091201 2420 4.88 24490 50827 36.7 36.7 20.0% 0.0% 0.0% 0.0% 11.38sec 1091201 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_spike 73510 5926390 13142 8.40 77445 160494 63.1 63.1 19.8% 0.0% 0.0% 0.0% 6.88sec 5926390 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_death 32379 1839714 4080 1.94 103543 214827 14.6 14.6 20.2% 0.0% 0.0% 0.0% 4.95sec 1839714 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain ticks -589 8084135 17965 60.39 14724 30495 65.4 452.9 19.8% 0.0% 0.0% 0.0% 6.88sec 8084135 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain_mastery 124464 2471982 5482 18.83 14399 29853 141.7 141.5 19.8% 0.0% 0.0% 0.0% 3.15sec 2471982 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowy_apparition 87532 2038049 4519 12.34 18284 36773 94.4 92.8 19.9% 0.0% 0.0% 0.0% 4.73sec 2038049 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch ticks -34914 7218960 16042 47.98 16534 34254 59.4 359.8 19.9% 0.0% 0.0% 0.0% 7.49sec 7218960 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch_mastery 124465 2206671 4893 14.97 16179 33552 112.6 112.5 19.8% 0.0% 0.0% 0.0% 3.91sec 2206671 450.96sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend melee 0 1630068 46151 52.96 45615 92291 31.2 31.2 20.1% 0.0% 24.2% 0.0% 12.61sec 1630068 35.32sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.46sec 0 35.32sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague 2944 2595621 5756 2.42 117561 243734 18.2 18.2 20.2% 0.0% 0.0% 0.0% 25.65sec 2595621 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_mastery 124467 1003251 2225 5.65 19481 40359 42.5 42.5 19.9% 0.0% 0.0% 0.0% 9.94sec 1003251 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_tick ticks -2944 3195041 7100 18.10 19413 40225 18.2 135.7 19.8% 0.0% 0.0% 0.0% 25.65sec 3195041 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 19.9% 0.0% 0.0% 0.0% 43.00sec 0 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_damage 120696 3124104 6928 2.89 118596 245146 10.9 21.7 19.9% 0.0% 0.0% 0.0% 43.00sec 3124104 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_heal 120696 0 0 30.45 0 0 10.9 228.9 23.0% 0.0% 0.0% 0.0% 43.00sec 46072947 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_blast 8092 5103053 11316 6.05 92581 191779 45.4 45.4 19.9% 0.0% 0.0% 0.0% 9.88sec 5103053 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay ticks -15407 3482116 7738 15.62 24462 50720 63.7 117.2 20.0% 0.0% 0.0% 0.0% 6.79sec 3482116 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay_mastery 124468 1088087 2413 4.86 24484 50773 36.6 36.5 20.1% 0.0% 0.0% 0.0% 11.40sec 1088087 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_spike 73510 5934806 13160 8.40 77460 160515 63.1 63.1 19.9% 0.0% 0.0% 0.0% 6.88sec 5934806 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_death 32379 1842551 4086 1.94 103533 214651 14.6 14.6 20.5% 0.0% 0.0% 0.0% 4.95sec 1842551 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain ticks -589 8794439 19543 60.38 14725 30462 65.4 452.9 29.8% 0.0% 0.0% 0.0% 6.88sec 8794439 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain_mastery 124464 2687223 5959 18.82 14403 29794 141.6 141.5 29.8% 0.0% 0.0% 0.0% 3.15sec 2687223 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 181.02sec 0 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowy_apparition 87532 2547773 5650 15.43 18288 36792 117.9 116.0 19.9% 0.0% 0.0% 0.0% 3.80sec 2547773 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch ticks -34914 7219338 16043 47.98 16540 34260 59.4 359.9 19.9% 0.0% 0.0% 0.0% 7.49sec 7219338 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch_mastery 124465 2211806 4905 14.99 16185 33536 112.7 112.6 19.9% 0.0% 0.0% 0.0% 3.90sec 2211806 450.96sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend melee 0 1633432 46243 52.95 45645 92213 31.2 31.2 20.3% 0.0% 24.0% 0.0% 12.61sec 1633432 35.32sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.47sec 0 35.32sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague 2944 2372199 5260 2.20 118237 244982 16.6 16.6 19.8% 0.0% 0.0% 0.0% 28.10sec 2372199 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_mastery 124467 913614 2026 5.12 19568 40532 38.5 38.5 19.9% 0.0% 0.0% 0.0% 10.85sec 913614 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_tick ticks -2944 2919297 6487 16.46 19513 40431 16.6 123.4 19.8% 0.0% 0.0% 0.0% 28.10sec 2919297 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 43.00sec 0 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_damage 120696 3127081 6934 2.89 118484 245667 10.9 21.7 19.9% 0.0% 0.0% 0.0% 43.00sec 3127081 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_heal 120696 0 0 30.24 0 0 10.9 227.3 23.0% 0.0% 0.0% 0.0% 43.00sec 45748865 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_blast 8092 4572250 10139 5.40 92866 192470 40.6 40.6 19.9% 0.0% 0.0% 0.0% 11.09sec 4572250 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay ticks -15407 5517902 12262 24.79 24439 50666 94.7 186.0 20.0% 0.0% 0.0% 0.0% 4.64sec 5517902 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay_mastery 124468 1725259 3826 7.74 24458 50695 58.2 58.2 19.8% 0.0% 0.0% 0.0% 7.38sec 1725259 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_death 32379 1832525 4064 1.93 103570 214793 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.98sec 1832525 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain ticks -589 8356474 18570 62.43 14713 30476 79.8 468.2 19.9% 0.0% 0.0% 0.0% 5.63sec 8356474 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain_mastery 124464 2558789 5674 19.47 14404 29850 146.5 146.4 19.9% 0.0% 0.0% 0.0% 3.05sec 2558789 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadowy_apparition 87532 2080873 4614 12.62 18277 36788 96.4 94.8 19.8% 0.0% 0.0% 0.0% 4.63sec 2080873 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch ticks -34914 7152060 15893 47.62 16513 34217 59.0 357.1 19.8% 0.0% 0.0% 0.0% 7.54sec 7152060 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch_mastery 124465 2189093 4854 14.86 16177 33521 111.8 111.7 19.7% 0.0% 0.0% 0.0% 3.93sec 2189093 450.96sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender melee 0 4380481 37568 54.12 36425 73341 105.2 105.2 20.1% 0.0% 24.0% 0.0% 4.17sec 4380481 116.60sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.30sec 0 116.60sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague 2944 2374096 5265 2.20 118213 245128 16.5 16.5 19.9% 0.0% 0.0% 0.0% 28.10sec 2374096 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_mastery 124467 912172 2023 5.11 19570 40516 38.5 38.4 19.9% 0.0% 0.0% 0.0% 10.86sec 912172 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_tick ticks -2944 2915868 6480 16.43 19512 40402 16.5 123.2 19.9% 0.0% 0.0% 0.0% 28.10sec 2915868 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo 120644 0 0 1.45 0 0 10.9 10.9 19.6% 0.0% 0.0% 0.0% 43.01sec 0 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_damage 120696 3120280 6919 2.89 118535 245319 10.9 21.7 19.7% 0.0% 0.0% 0.0% 43.01sec 3120280 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_heal 120696 0 0 30.25 0 0 10.9 227.4 22.9% 0.0% 0.0% 0.0% 43.01sec 45718318 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_blast 8092 4565695 10124 5.39 92901 192330 40.5 40.5 19.9% 0.0% 0.0% 0.0% 11.10sec 4565695 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay ticks -15407 5518665 12264 24.79 24439 50673 94.7 185.9 20.0% 0.0% 0.0% 0.0% 4.64sec 5518665 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay_mastery 124468 1723351 3822 7.72 24452 50683 58.1 58.1 20.0% 0.0% 0.0% 0.0% 7.39sec 1723351 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.87sec 0 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_death 32379 1832934 4065 1.93 103568 214673 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.98sec 1832934 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain ticks -589 9091336 20203 62.44 14714 30437 79.8 468.3 29.9% 0.0% 0.0% 0.0% 5.63sec 9091336 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain_mastery 124464 2784163 6174 19.50 14403 29806 146.7 146.5 29.8% 0.0% 0.0% 0.0% 3.04sec 2784163 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadowy_apparition 87532 2581551 5725 15.64 18283 36765 119.6 117.6 19.9% 0.0% 0.0% 0.0% 3.74sec 2581551 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch ticks -34914 7152417 15894 47.62 16519 34218 59.0 357.2 19.8% 0.0% 0.0% 0.0% 7.54sec 7152417 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch_mastery 124465 2191704 4860 14.85 16185 33539 111.7 111.6 19.9% 0.0% 0.0% 0.0% 3.93sec 2191704 450.96sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender melee 0 4384968 37610 54.12 36415 73361 105.2 105.2 20.2% 0.0% 24.0% 0.0% 4.17sec 4384968 116.59sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.30sec 0 116.59sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague 2944 2322563 5150 2.16 118114 244758 16.2 16.2 19.8% 0.0% 0.0% 0.0% 28.78sec 2322563 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_mastery 124467 892112 1978 5.00 19545 40524 37.7 37.6 20.0% 0.0% 0.0% 0.0% 11.11sec 892112 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_tick ticks -2944 2842563 6317 16.03 19486 40383 16.2 120.2 19.9% 0.0% 0.0% 0.0% 28.78sec 2842563 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.9% 0.0% 0.0% 0.0% 43.20sec 0 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_damage 120696 3108072 6892 2.88 118570 245620 10.8 21.7 19.7% 0.0% 0.0% 0.0% 43.20sec 3108072 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_heal 120696 0 0 30.25 0 0 10.8 227.3 23.0% 0.0% 0.0% 0.0% 43.20sec 45762453 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_blast 8092 4464734 9901 5.27 92983 192547 39.6 39.6 19.9% 0.0% 0.0% 0.0% 11.37sec 4464734 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay ticks -15407 4677278 10394 21.09 24361 50512 79.9 158.2 19.9% 0.0% 0.0% 0.0% 5.48sec 4677278 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay_mastery 124468 1466326 3252 6.60 24385 50540 49.6 49.6 19.9% 0.0% 0.0% 0.0% 8.59sec 1466326 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_death 32379 1830127 4058 1.93 103536 214538 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.99sec 1830127 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_insanity 129249 4425326 9813 3.37 143894 298425 25.4 25.4 19.8% 0.0% 0.0% 0.0% 17.07sec 4425326 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain ticks -589 7907623 17572 59.08 14713 30481 81.5 443.1 19.9% 0.0% 0.0% 0.0% 5.51sec 7907623 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain_mastery 124464 2422968 5373 18.46 14404 29837 138.8 138.7 19.8% 0.0% 0.0% 0.0% 3.22sec 2422968 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowy_apparition 87532 2005841 4448 12.16 18278 36766 93.0 91.4 19.8% 0.0% 0.0% 0.0% 4.80sec 2005841 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch ticks -34914 7217181 16038 47.98 16540 34264 59.4 359.8 19.8% 0.0% 0.0% 0.0% 7.49sec 7217181 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch_mastery 124465 2215031 4912 15.00 16189 33560 112.8 112.7 19.9% 0.0% 0.0% 0.0% 3.90sec 2215031 450.96sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend melee 0 1629732 46142 52.96 45644 92125 31.2 31.2 20.1% 0.0% 23.9% 0.0% 12.61sec 1629732 35.32sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.50sec 0 35.32sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague 2944 2323034 5151 2.16 118118 244630 16.2 16.2 19.8% 0.0% 0.0% 0.0% 28.76sec 2323034 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_mastery 124467 888777 1971 4.99 19541 40523 37.6 37.5 19.8% 0.0% 0.0% 0.0% 11.13sec 888777 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_tick ticks -2944 2838587 6308 16.01 19477 40384 16.2 120.1 19.9% 0.0% 0.0% 0.0% 28.76sec 2838587 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.9% 0.0% 0.0% 0.0% 43.21sec 0 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_damage 120696 3111424 6900 2.88 118577 245357 10.8 21.6 19.8% 0.0% 0.0% 0.0% 43.21sec 3111424 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_heal 120696 0 0 30.24 0 0 10.8 227.3 23.0% 0.0% 0.0% 0.0% 43.21sec 45722273 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_blast 8092 4466153 9904 5.27 92989 192542 39.6 39.6 19.9% 0.0% 0.0% 0.0% 11.37sec 4466153 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay ticks -15407 4678717 10397 21.10 24364 50501 80.0 158.2 19.9% 0.0% 0.0% 0.0% 5.48sec 4678717 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay_mastery 124468 1464537 3248 6.59 24384 50559 49.5 49.5 19.8% 0.0% 0.0% 0.0% 8.59sec 1464537 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_death 32379 1831038 4060 1.93 103524 214732 14.5 14.5 20.4% 0.0% 0.0% 0.0% 4.98sec 1831038 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_insanity 129249 4415607 9792 3.36 143899 298247 25.3 25.3 19.9% 0.0% 0.0% 0.0% 17.11sec 4415607 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain ticks -589 8603352 19119 59.10 14714 30437 81.5 443.3 29.9% 0.0% 0.0% 0.0% 5.51sec 8603352 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain_mastery 124464 2628635 5829 18.42 14403 29791 138.6 138.5 29.8% 0.0% 0.0% 0.0% 3.22sec 2628635 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowfiend 34433 0 0 0.26 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.99sec 0 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowy_apparition 87532 2514603 5576 15.24 18274 36759 116.5 114.6 19.9% 0.0% 0.0% 0.0% 3.84sec 2514603 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch ticks -34914 7220860 16046 47.98 16544 34262 59.4 359.9 19.9% 0.0% 0.0% 0.0% 7.49sec 7220860 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch_mastery 124465 2206774 4894 14.96 16188 33556 112.5 112.4 19.8% 0.0% 0.0% 0.0% 3.91sec 2206774 450.96sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend melee 0 1631403 46189 52.97 45631 92123 31.2 31.2 20.2% 0.0% 24.1% 0.0% 12.61sec 1631403 35.32sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.06 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.48sec 0 35.32sec

enemy1 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy1 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy1 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.67% 7.67%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.67%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.31% 8.31%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.83% 10.83%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.83%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.07% 11.07%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.17% 11.17%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.86% 10.86%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.99% 10.99%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.33% 11.33%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.45% 10.45%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.45%

Trigger Attempt Success

  • trigger_pct:100.00%
invulnerable 4.3 0.0 120.0sec 0.0sec 0.00% 0.00%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_invulnerable
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1582351.73
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data enemy1 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy1 Damage Taken Per Second
Count 49992
Mean 1583891.45
Distribution Chart

HPS

Sample Data enemy1 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy1 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 855248434 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy1"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

enemy2 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://9.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy2 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy2 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.97% 11.97%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.07% 10.07%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.08% 10.08%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.98% 9.98%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 9.95% 9.95%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:9.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.17% 10.17%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.08% 10.08%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.08%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.02% 10.02%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.45% 9.45%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 443691.18
Combat End Resource Mean Min Max
Health 21267.74 0.00 4195713.57
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.96
Minimum 351.76
Maximum 551.10
Spread ( max - min ) 199.33
Range [ ( max - min ) / 2 * 100% ] 22.10%
Distribution Chart

DPS

Sample Data enemy2 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy2 Damage Taken Per Second
Count 49992
Mean 453410.35
Distribution Chart

HPS

Sample Data enemy2 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy2 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 239837015 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy2"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.