close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 movement,players_only=1,first=45,cooldown=85,duration=7,last=360

priest_90_di_fdcl_no2PT14 : 99984 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
99983.9 99983.9 19.09 / 0.02% 3657 / 3.7% 21.3 4503.6 4313.1 Mana 0.64% 39.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:337494|137730|121799|121439|96632|96608|81402|49533&chds=0,674989&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++337494++devouring_plague,9482C9,0,0,15|t++137730++vampiric_touch,9482C9,1,0,15|t++121799++halo,9482C9,2,0,15|t++121439++shadow_word_pain,9482C9,3,0,15|t++96632++mind_blast,9482C9,4,0,15|t++96608++shadow_word_death,9482C9,5,0,15|t++81402++mind_spike,4A79D3,6,0,15|t++49533++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,10,10,9,8,7,5,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|shadowy_apparition|vampiric_touch_mastery&chtt=priest_90_di_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:67644220zzyxyxxvwvusrpmmmllkkkkkjiiiihgfedddccbbbbbbbaaZYYYYYZZabbbccbbbbaaabbbbbbbaaaaZZZaaaabbaaaaZaaaabbcccddddccdddeeeeeddcbbaaaZZZZZZZZYYYYYYZZaaabbbbbbbbbbbcccccccccbbccddefffggggffffffgggffeeddcbbbbbbbbbbbaaaaaaaaaaabbbbbbbbbbcccccccccccccccccccdddddcccccbbbbbbbbaaaZZZZZZaaaaaaaZZZaaaaaaaZZZZZZZZZZZZaaaaaaaaabbbbbccccdddddddddeefffggggffffffffffghhiiijjkllllllllllkkjjiihhgffeeeeedddeeeeefffffeeeffffffgggggffffggggggggggggggghhhiiijjjjkkkkkkllllllllllkkkkkjjjjjjiiiihhhhhhhhhhhhhhhiiiijjjkkkkkkkkkkkkkkkkkkkkkjjjjiiiiiiiihhhhhhggggggggggg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5109,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=99984|max=195700&chxp=1,1,51,100&chtt=priest_90_di_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,8,16,48,96,80,176,304,480,528,816,808,1216,1392,1544,1848,2240,2552,2816,2912,3064,3088,2840,2832,2720,2512,2192,2088,1640,1256,1240,920,760,592,576,432,336,256,208,184,120,56,64,24,16,16,32,16,0,8&chds=0,3088&chbh=5&chxt=x&chxl=0:|min=92976|avg=99984|max=108970&chxp=0,1,44,100&chtt=priest_90_di_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.3,14.2,10.0,9.7,8.1,5.5,4.0,2.9,0.5,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 199.4s|mind_blast 63.8s|shadow_word_pain 45.1s|mind_spike 43.6s|vampiric_touch 36.7s|devouring_plague 25.0s|shadow_word_death 18.0s|halo 13.1s|shadowfiend 2.4s|waiting 2.9s&chtt=priest_90_di_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no2PT14 99984
devouring_plague 6682 (18733) 6.7% (18.7%) 21.1 22.23sec 400553 337494 117840 244052 142896 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.05 21.05 0.00 0.00 1.1869 0.0000 3008258.00 3008258.00 0.00 337494.33 337494.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.87 80.15% 117840.49 107519 143944 117870.85 110625 124411 1988397 1988397 0.00
crit 4.18 19.85% 244052.03 221488 296525 241373.45 0 296525 1019861 1019861 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2878 2.9% 54.4 8.27sec 23826 0 19664 40718 23856 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.37 54.31 0.00 0.00 0.0000 0.0000 1295511.94 1295511.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.49 80.09% 19664.40 17856 23904 19669.49 18557 20836 855288 855288 0.00
crit 10.81 19.91% 40718.25 36784 49242 40718.38 0 47166 440224 440224 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9173 9.2% 21.1 22.23sec 196122 0 0 0 0 0.0% 0.0% 0.0% 0.0% 173.8 19587 40551 23751 19.9% 0.0% 29.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.05 21.05 173.84 173.84 0.0000 0.7528 4128863.43 4128863.43 0.00 31552.48 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.05 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.3 80.14% 19587.04 17856 28832 19592.11 18760 20485 2728552 2728552 0.00
crit 34.5 19.86% 40551.18 36784 59393 40560.84 38131 43549 1400312 1400312 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3548) 0.0% (3.5%) 11.1 41.79sec 143255 121799 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 1.1762 0.0000 0.00 0.00 0.00 121798.85 121798.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.96 80.42% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 19.58% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3548 3.5% 11.1 41.79sec 143255 0 118194 244607 143255 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 0.0000 0.0000 1596782.97 1596782.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.17% 118193.64 109581 139821 118216.08 109581 126426 1056255 1056255 0.00
crit 2.21 19.83% 244606.60 225736 288030 222452.50 0 288030 540528 540528 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.79sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.15 235.57 0.00 0.00 0.0000 0.0000 0.00 46305278.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.26 76.95% 0.00 0 0 0.00 0 0 0 28580032 100.00
crit 54.31 23.05% 0.00 0 0 0.00 0 0 0 17725247 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13683 13.7% 53.8 8.41sec 114626 96632 94530 195760 114626 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.76 53.76 0.00 0.00 1.1862 0.0000 6162135.92 6162135.92 0.00 96632.16 96632.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.09 80.15% 94530.27 86183 115909 94554.87 91617 97699 4072996 4072996 0.00
crit 10.67 19.85% 195759.64 177536 238773 195852.37 177536 221980 2089140 2089140 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16697 (21921) 16.7% (21.9%) 112.5 3.94sec 87764 49533 0 0 0 0.0% 0.0% 0.0% 0.0% 246.8 25110 52011 30480 20.0% 0.0% 40.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.53 112.53 246.80 246.80 1.7718 0.7418 7522375.03 7522375.03 0.00 49532.83 49532.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.5 80.04% 25110.26 22887 30640 25116.69 24478 25910 4960075 4960075 0.00
crit 49.3 19.96% 52011.06 47146 63119 52026.47 49754 54738 2562300 2562300 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5224 5.2% 77.2 5.67sec 30471 0 25113 52067 30488 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.24 77.19 0.00 0.00 0.0000 0.0000 2353480.59 2353480.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.80 80.06% 25112.77 22887 30640 25119.28 23960 26411 1551978 1551978 0.00
crit 15.39 19.94% 52066.51 47146 63119 52076.81 48254 57136 801503 801503 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7887 7.9% 37.0 11.71sec 95996 81402 79193 163987 95997 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.1793 0.0000 3551503.14 3551503.14 0.00 81402.35 81402.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.66 80.18% 79193.02 72412 97688 79209.20 74695 85000 2349250 2349250 0.00
crit 7.33 19.82% 163987.18 149169 201238 163685.67 0 201238 1202253 1202253 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3854 3.9% 15.1 4.86sec 115393 96608 94599 196473 115393 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.06 15.06 0.00 0.00 1.1945 0.0000 1737784.52 1737784.52 0.00 96607.99 96607.99
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.99 79.59% 94599.08 83662 112752 94681.98 85135 105205 1133842 1133842 0.00
crit 3.07 20.41% 196473.12 172343 232270 189034.91 0 232270 603943 603943 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9275 (12162) 9.3% (12.2%) 38.0 11.86sec 144139 121439 0 0 0 0.0% 0.0% 0.0% 0.0% 233.9 14707 30467 17842 19.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.96 37.96 233.85 233.85 1.1869 1.8998 4172335.38 4172335.38 0.00 11181.38 121438.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 187.3 80.11% 14707.01 13422 17966 14710.08 14216 15267 2755222 2755222 0.00
crit 46.5 19.89% 30467.43 27649 37009 30472.22 29040 32305 1417113 1417113 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2888 2.9% 73.2 6.06sec 17756 0 14662 30365 17769 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.16 73.11 0.00 0.00 0.0000 0.0000 1299084.30 1299084.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.64 80.21% 14661.58 13422 17966 14664.52 14135 15335 859821 859821 0.00
crit 14.47 19.79% 30364.97 27649 37009 30365.64 28064 34759 439263 439263 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2231 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2762 2.8% 57.5 7.70sec 21608 0 18299 36787 21968 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.51 56.57 0.00 0.00 0.0000 0.0000 1242678.60 1242678.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.34 80.15% 18298.78 16669 22484 18300.60 17553 19121 829697 829697 0.00
crit 11.23 19.85% 36787.16 33338 44968 36796.18 33338 41555 412981 412981 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8570 (11224) 8.6% (11.2%) 30.9 14.68sec 163718 137730 0 0 0 0.0% 0.0% 0.0% 0.0% 191.6 16582 34365 20143 20.0% 0.0% 96.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.87 30.87 191.58 191.58 1.1887 2.2576 3858997.35 3858997.35 0.00 10771.10 137730.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.2 79.97% 16581.75 15001 20366 16586.85 16042 17167 2540464 2540464 0.00
crit 38.4 20.03% 34365.28 30902 41955 34375.87 32381 37140 1318533 1318533 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2654 2.7% 59.9 7.35sec 19959 0 16471 34130 19976 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.86 59.81 0.00 0.00 0.0000 0.0000 1194747.23 1194747.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.94 80.15% 16471.28 15001 20366 16474.87 15732 17343 789573 789573 0.00
crit 11.87 19.85% 34130.00 30902 41955 34140.56 30902 38318 405174 405174 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52937 / 4211
melee 52937 4.2% 33.3 11.80sec 56233 55532 48890 98811 56233 20.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.32 33.32 0.00 0.00 1.0126 0.0000 1873439.37 1873439.37 0.00 55532.35 55532.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.49 55.49% 48889.77 38145 58728 48907.90 43995 55292 903766 903766 0.00
crit 6.84 20.54% 98810.53 76291 117456 98789.44 0 117456 676161 676161 0.00
glance 7.99 23.97% 36748.68 28609 44046 36764.24 30040 44046 293513 293513 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1931 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.08%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.8 0.6 28.2sec 27.2sec 5.21% 27.22%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.21%

Trigger Attempt Success

  • trigger_pct:5.02%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:16.05%
glyph_mind_spike 27.2 9.8 16.1sec 11.7sec 34.08% 53.68%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:27.07%
  • glyph_mind_spike_2:7.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.4sec 20.6sec 43.79% 44.10%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.79%

    Trigger Attempt Success

    • trigger_pct:2.18%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.74% 41.74%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.74%

    Trigger Attempt Success

    • trigger_pct:15.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.77% 49.52%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 31.8 6.1 13.7sec 11.5sec 21.10% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:19.23%
  • surge_of_darkness_2:1.87%

Trigger Attempt Success

  • trigger_pct:15.06%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.59%

Buff details

  • buff initial source:priest_90_di_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no2PT14
devouring_plague Shadow Orb 21.1 63.2 3.0 3.0 133517.7
halo Mana 11.1 451429.2 40500.0 40499.9 3.5
mind_blast Mana 53.8 343391.0 6387.7 6387.6 17.9
mind_flay Mana 112.5 337581.1 3000.0 3000.0 29.3
shadow_word_death Mana 15.1 117469.2 7800.0 7800.2 14.8
shadow_word_pain Mana 38.0 501057.2 13200.0 13199.8 10.9
vampiric_touch Mana 30.9 277817.8 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.32 211174.85 (10.87%) 6338.57 88667.71 29.57%
Shadow Orbs from Mind Blast Shadow Orb 53.76 53.76 (87.61%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.60 7.60 (12.39%) 1.00 0.00 0.00%
Devouring Plague Health Health 228.14 0.00 (-nan%) 0.00 3168140.09 100.00%
Vampiric Touch Mana Mana 251.38 1225343.09 (63.07%) 4874.38 103539.79 7.79%
mp5_regen Mana 1801.40 506416.22 (26.06%) 281.12 34002.82 6.29%
Resource RPS-Gain RPS-Loss
Mana 4313.08 4503.57
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 214186.22 91200.00 300000.00
Shadow Orb 1.20 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
lightwell-Mana Cap 6.4%

Procs

Count Interval
Shadowy Recall Extra Tick 264.4 1.7sec
Shadowy Apparition Procced 57.5 7.7sec
Divine Insight Mind Blast CD Reset 27.2 27.2sec
FDCL Mind Spike proc 37.9 11.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 99983.92
Minimum 92975.51
Maximum 108970.33
Spread ( max - min ) 15994.82
Range [ ( max - min ) / 2 * 100% ] 8.00%
Standard Deviation 2177.3499
5th Percentile 96466.17
95th Percentile 103779.69
( 95th Percentile - 5th Percentile ) 7313.52
Mean Distribution
Standard Deviation 9.7382
95.00% Confidence Intervall ( 99964.83 - 100003.00 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 18
0.1% Error 1821
0.1 Scale Factor Error with Delta=300 40470
0.05 Scale Factor Error with Delta=300 161882
0.01 Scale Factor Error with Delta=300 4047064
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 99983.92
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43124538.38
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 293.42
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.82 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.06 shadow_word_death,if=active_enemies<=5
F 54.04 mind_blast,if=active_enemies<=6&cooldown_react
G 21.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.10 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 4.15 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.15 halo,if=talent.halo.enabled
M 16.23 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.85 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.22 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 32.85 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 63.00 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 15.99 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGFHLTQFMTHGQFTJRFTHJRRQFGMTRTRFLWFWHTQFMTRHRFGTRTFRHTFMGLTHFRRTFRFGHMRTFTHRFGTLWWRWWFHMTRTQFTHTGFTFHMRTLTFGTBHFTFGHMTRTFRTHRQFGLTWJRFMRHTQFTGTFHTJRTFMRTGHLFRTQQQFHTGQFMRTHQFRTRTFGRHLTQFMWWWWWQFHTFTFGHMTFRTLTHTFGTFHMTBFGTHTQFRTLEDEFGHRTPEEFMRTHPEEFGTPEDEFHJRRLEEFDFG9FHEDETQFRTREEFGHMTQFPEET

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_fdcl_no4PT14 : 102076 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
102075.9 102075.9 18.72 / 0.02% 3512 / 3.4% 21.7 4504.1 4314.4 Mana 0.63% 39.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:337328|137735|132091|121618|96675|96448|81455|49529&chds=0,674656&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++337328++devouring_plague,9482C9,0,0,15|t++137735++vampiric_touch,9482C9,1,0,15|t++132091++shadow_word_pain,9482C9,2,0,15|t++121618++halo,9482C9,3,0,15|t++96675++mind_blast,9482C9,4,0,15|t++96448++shadow_word_death,9482C9,5,0,15|t++81455++mind_spike,4A79D3,6,0,15|t++49529++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,14,10,9,9,8,7,5,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:68644320zzyxyxxvwvutrpnnmmlllllkkjjjihggfedddccccbcbbbaaYYYYYZaabbccccbbbbabbcbbbbbbaaaaaaaabbbbbaaaaaaabbcccdddddddddeeefeeeddcbbaaaaaaaaaZZZZZZZZZaabbbbbbbbbbcccccddddcccccddeeffggggggfffffggggffeedccbbbbcccbbbbaaaaaaabbbbbbbbcbbbcccccccccccccccccccddddddddccccccccbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaZaZZZZZZZaaaaaabbbbbbbbccccdddddddddeeefffgggggggffgggffgghiiijjkklllllllllllkkjiihhggffeeeeeeeeeefffffffffffffgggggggggggggggggggggggggghhhiijjjjkkkkkkkllllmmmmmlllkkkkkkkjjjjjiiiihhhhhiiiiiiiiiiiijjkkkkkkkkkkkkkkklllkkkkjjjjjjiiiiiihhghghiiiiiihhhih&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5176,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=102076|max=197212&chxp=1,1,52,100&chtt=priest_90_di_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,16,8,40,64,32,104,232,200,368,512,640,640,1024,1208,1440,1736,2088,2496,2552,2640,2832,2960,2696,2584,2784,2456,2392,1992,1904,1680,1424,1272,1088,704,744,560,400,400,304,248,144,104,72,88,24,24,16,16,16&chds=0,2960&chbh=5&chxt=x&chxl=0:|min=94924|avg=102076|max=109992&chxp=0,1,47,100&chtt=priest_90_di_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:44.3,14.1,10.0,9.6,8.1,5.5,4.0,2.9,0.5,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 199.7s|mind_blast 63.7s|shadow_word_pain 45.0s|mind_spike 43.4s|vampiric_touch 36.7s|devouring_plague 25.0s|shadow_word_death 18.0s|halo 13.1s|shadowfiend 2.4s|waiting 2.8s&chtt=priest_90_di_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl_no4PT14 102076
devouring_plague 6664 (18702) 6.5% (18.3%) 21.0 22.25sec 400334 337328 117815 243950 142655 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.03 21.03 0.00 0.00 1.1868 0.0000 3000640.00 3000640.00 0.00 337327.79 337327.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.89 80.31% 117815.15 107519 143944 117839.69 111603 124415 1990101 1990101 0.00
crit 4.14 19.69% 243949.96 221488 296525 241228.35 0 296525 1010539 1010539 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2875 2.8% 54.3 8.28sec 23841 0 19654 40694 23872 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.30 54.23 0.00 0.00 0.0000 0.0000 1294531.79 1294531.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.36 79.95% 19653.89 17856 23904 19659.40 18694 21014 852169 852169 0.00
crit 10.87 20.05% 40694.46 36784 49242 40699.69 0 47585 442363 442363 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9164 9.0% 21.0 22.25sec 196135 0 0 0 0 0.0% 0.0% 0.0% 0.0% 173.7 19583 40539 23748 19.9% 0.0% 29.0%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.03 21.03 173.73 173.73 0.0000 0.7527 4125541.80 4125541.80 0.00 31551.69 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 21.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 139.2 80.12% 19582.51 17856 30630 19586.34 18827 20824 2725826 2725826 0.00
crit 34.5 19.88% 40538.50 36784 60513 40543.33 37704 43873 1399716 1399716 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3541) 0.0% (3.5%) 11.1 41.80sec 143036 121618 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 11.14 0.00 0.00 1.1762 0.0000 0.00 0.00 0.00 121618.38 121618.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.27% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.73% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3541 3.5% 11.1 41.80sec 143036 0 118159 244721 143036 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 11.14 0.00 0.00 0.0000 0.0000 1593808.88 1593808.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.95 80.34% 118158.55 109581 139821 118171.86 109581 127385 1057810 1057810 0.00
crit 2.19 19.66% 244720.93 225736 288030 222728.67 0 288030 535999 535999 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.80sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.14 235.43 0.00 0.00 0.0000 0.0000 0.00 46272092.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.15 76.94% 0.00 0 0 0.00 0 0 0 28557450 100.00
crit 54.28 23.06% 0.00 0 0 0.00 0 0 0 17714643 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13681 13.4% 53.7 8.41sec 114682 96675 94521 195788 114683 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.72 53.72 0.00 0.00 1.1863 0.0000 6160982.60 6160982.60 0.00 96674.71 96674.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.03 80.09% 94521.47 86183 115909 94542.42 91627 97632 4066943 4066943 0.00
crit 10.70 19.91% 195787.98 177536 238773 195871.87 177536 238773 2094040 2094040 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16719 (21952) 16.4% (21.5%) 112.7 3.94sec 87790 49529 0 0 0 0.0% 0.0% 0.0% 0.0% 247.3 25111 52025 30466 19.9% 0.0% 40.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.66 112.66 247.25 247.25 1.7725 0.7418 7532711.42 7532711.42 0.00 49529.40 49529.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 112.66 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 198.1 80.10% 25110.50 22887 30640 25116.70 24313 25926 4973358 4973358 0.00
crit 49.2 19.90% 52024.76 47146 63119 52038.67 49776 55545 2559354 2559354 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5233 5.1% 77.4 5.66sec 30481 0 25118 52055 30497 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.36 77.32 0.00 0.00 0.0000 0.0000 2357963.37 2357963.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.88 80.03% 25118.18 22887 30640 25124.17 24125 26430 1554310 1554310 0.00
crit 15.44 19.97% 52055.17 47146 63119 52073.43 47461 58540 803653 803653 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 7856 7.7% 36.8 11.76sec 96076 81455 79187 163973 96075 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.82 36.82 0.00 0.00 1.1795 0.0000 3537577.35 3537577.35 0.00 81454.69 81454.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.49 80.08% 79187.23 72412 97688 79200.22 75266 83918 2334948 2334948 0.00
crit 7.33 19.92% 163972.99 149169 201238 163866.95 0 201238 1202629 1202629 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3850 3.8% 15.1 4.86sec 115213 96448 94625 196368 115214 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 15.07 0.00 0.00 1.1946 0.0000 1736157.35 1736157.35 0.00 96447.83 96447.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.02 79.76% 94625.16 83662 112752 94703.69 85946 104285 1137376 1137376 0.00
crit 3.05 20.24% 196368.09 172343 232270 189441.15 0 232270 598781 598781 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10076 (13218) 9.9% (12.9%) 37.9 11.87sec 156781 132091 0 0 0 0.0% 0.0% 0.0% 0.0% 233.8 14702 30405 19390 29.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.93 37.93 233.77 233.77 1.1869 1.9004 4532867.17 4532867.17 0.00 12152.99 132090.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.93 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 164.0 70.15% 14701.85 13422 17966 14704.79 14287 15247 2410874 2410874 0.00
crit 69.8 29.85% 30405.32 27649 37009 30410.95 29241 31775 2121993 2121993 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3142 3.1% 73.2 6.06sec 19313 0 14660 30306 19327 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.18 73.13 0.00 0.00 0.0000 0.0000 1413333.66 1413333.66 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.32 70.17% 14659.82 13422 17966 14662.43 14130 15290 752286 752286 0.00
crit 21.81 29.83% 30306.27 27649 37009 30315.13 28361 32763 661048 661048 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.85sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2226 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3847 3.8% 80.2 5.55sec 21588 0 18284 36774 21951 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.21 78.88 0.00 0.00 0.0000 0.0000 1731520.87 1731520.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.24 80.17% 18284.26 16669 22484 18287.48 17629 19085 1156233 1156233 0.00
crit 15.64 19.83% 36774.30 33338 44968 36781.79 34251 40388 575288 575288 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8564 (11222) 8.4% (11.0%) 30.9 14.68sec 163721 137735 0 0 0 0.0% 0.0% 0.0% 0.0% 191.6 16584 34380 20132 19.9% 0.0% 96.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.87 30.87 191.58 191.58 1.1887 2.2576 3856772.89 3856772.89 0.00 10770.39 137734.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.87 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.4 80.06% 16583.83 15001 20366 16588.57 16091 17149 2543740 2543740 0.00
crit 38.2 19.94% 34380.37 30902 41955 34388.90 32436 36556 1313033 1313033 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2657 2.6% 59.9 7.34sec 19962 0 16462 34119 19980 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.94 59.89 0.00 0.00 0.0000 0.0000 1196577.45 1196577.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.95 80.08% 16462.35 15001 20366 16465.48 15753 17247 789450 789450 0.00
crit 11.93 19.92% 34119.45 30902 41955 34127.60 30902 39252 407128 407128 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52905 / 4208
melee 52905 4.1% 33.3 11.80sec 56194 55507 48906 98760 56195 20.5% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.32 33.32 0.00 0.00 1.0124 0.0000 1872473.70 1872473.70 0.00 55507.02 55507.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.46 55.41% 48905.84 38145 58728 48918.56 43953 55350 902995 902995 0.00
crit 6.83 20.49% 98759.55 76291 117456 98826.22 0 117456 674430 674430 0.00
glance 8.03 24.09% 36750.46 28609 44046 36777.88 31184 44046 295048 295048 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.25sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1931 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.08%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.8 0.5 28.3sec 27.3sec 5.19% 27.08%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.19%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.15%
glyph_mind_spike 27.1 9.7 16.1sec 11.8sec 34.04% 53.44%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:27.07%
  • glyph_mind_spike_2:6.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.8 36.3sec 20.7sec 43.64% 43.97%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.64%

    Trigger Attempt Success

    • trigger_pct:2.16%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.75% 41.75%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.75%

    Trigger Attempt Success

    • trigger_pct:14.95%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.77% 49.49%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 31.6 6.0 13.8sec 11.5sec 20.99% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:19.15%
  • surge_of_darkness_2:1.85%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.64%

Buff details

  • buff initial source:priest_90_di_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl_no4PT14
devouring_plague Shadow Orb 21.0 63.1 3.0 3.0 133443.5
halo Mana 11.1 451280.2 40500.0 40499.9 3.5
mind_blast Mana 53.7 343762.6 6398.9 6398.9 17.9
mind_flay Mana 112.7 337986.2 3000.0 3000.0 29.3
shadow_word_death Mana 15.1 117542.9 7800.0 7800.2 14.8
shadow_word_pain Mana 37.9 500634.8 13200.0 13200.0 11.9
vampiric_touch Mana 30.9 277790.4 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.32 211218.34 (10.87%) 6338.78 88676.06 29.57%
Shadow Orbs from Mind Blast Shadow Orb 53.72 53.72 (87.59%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.61 7.61 (12.41%) 1.00 0.00 0.00%
Devouring Plague Health Health 227.95 0.00 (-nan%) 0.00 3165516.07 100.00%
Vampiric Touch Mana Mana 251.47 1225774.75 (63.07%) 4874.49 103363.97 7.78%
mp5_regen Mana 1801.40 506520.82 (26.06%) 281.18 33898.22 6.27%
Resource RPS-Gain RPS-Loss
Mana 4314.36 4504.13
Shadow Orb 0.14 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 214515.22 64800.00 300000.00
Shadow Orb 1.23 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
lightwell-Mana Cap 6.4%

Procs

Count Interval
Shadowy Recall Extra Tick 264.6 1.7sec
Shadowy Apparition Procced 80.2 5.6sec
Divine Insight Mind Blast CD Reset 27.0 27.3sec
FDCL Mind Spike proc 37.7 11.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 102075.92
Minimum 94923.89
Maximum 109991.90
Spread ( max - min ) 15068.01
Range [ ( max - min ) / 2 * 100% ] 7.38%
Standard Deviation 2135.3829
5th Percentile 98706.24
95th Percentile 105729.63
( 95th Percentile - 5th Percentile ) 7023.39
Mean Distribution
Standard Deviation 9.5505
95.00% Confidence Intervall ( 102057.20 - 102094.64 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1681
0.1 Scale Factor Error with Delta=300 38925
0.05 Scale Factor Error with Delta=300 155702
0.01 Scale Factor Error with Delta=300 3892558
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 102075.92
Distribution Chart

Damage

Sample Data
Count 49992
Mean 44070986.58
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 292.93
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.83 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.07 shadow_word_death,if=active_enemies<=5
F 54.01 mind_blast,if=active_enemies<=6&cooldown_react
G 21.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.10 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 4.08 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.14 halo,if=talent.halo.enabled
M 16.21 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.86 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.03 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 32.74 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.93 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 15.96 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTRTHRFGMTRTFTHRTQFGRTFMRTLWRWFWHTQFTHTFGMRTQFHRTFGLRTHTFMTRTFTGHFTRTFMTFHTGTLFWWWWHTFMRTFHTGRTFTHQFMRFLGTRFBHTRFMRGFHTFTHTFGLMWRWWWFHTFTHGTFMTRTFHLRTGTFRTHJRTFMRTGRHFTFTGHLJFMJRWWTFHTFTRTGHTFMTFHLRTGTFTHTFMTBGTFHQFTRTFMEEGHLFRREDERTFHQQQQQQQFEDEGTQFTHEETFMTEEFG9HJLREDEFJRRHTEEFGMTPEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no2PT14 : 101728 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
101728.3 101728.3 17.29 / 0.02% 3215 / 3.2% 19.6 4658.4 4557.0 Mana 0.55% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:337562|137713|121766|114662|96611|96437|49980&chds=0,675125&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++337562++devouring_plague,9482C9,0,0,15|t++137713++vampiric_touch,9482C9,1,0,15|t++121766++halo,9482C9,2,0,15|t++114662++shadow_word_pain,9482C9,3,0,15|t++96611++mind_blast,9482C9,4,0,15|t++96437++shadow_word_death,9482C9,5,0,15|t++49980++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,14,11,10,10,9,7,7,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|devouring_plague_tick|vampiric_touch|devouring_plague|mind_flay_mastery|shadow_word_death|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|shadowy_apparition|vampiric_touch_mastery&chtt=priest_90_di_mb_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:567786642211101z0zyxvurqonmmmmllkkjjihgfedccccbbbbbbbbbbaabcdeghijkkkkjjjjihihhgfeedcbaaaaaabbbbbaaaaaaabbccdddddeeefghijjkkkkkjiiihhhhggfedccbbaaZZaabbbcccbbccccccddddddccbbbbcddeeeefffggggghhhiihhggffeeeddcbbbaaaaZZZZZaaaaaabbbbbbbcccdeefgghhijjkkkkllllllkjiihgffeddcbbbaaaaaaaaaaaaaaaaaaaaaaaaaabbccddeefghhiiijjjjiiihhhhggffeeeeeeeeffgggggggggggggggggggggghhiijkkllmmmmllmmmlllkkjjihhgffffffffggggffffggggggggggggghhiijkllmmnoooopppqqqqqqqqppoonnmmmmmmnmmmmllllkkkkkkjjjjiiiiijkklmmnoopqqrrrssttttssrqqpponnmmllllllkkkkkjjjjjjiiiihhhgffffeeeedd&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5521,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=101728|max=184255&chxp=1,1,55,100&chtt=priest_90_di_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,8,24,56,56,72,80,216,288,384,600,704,968,1160,1688,1760,2176,2128,2536,2696,2888,2712,2968,2784,2736,2616,2576,1976,1968,1728,1360,1464,1032,864,632,488,408,360,272,168,96,56,48,48,72,24,16,8,8&chds=0,2968&chbh=5&chxt=x&chxl=0:|min=94859|avg=101728|max=109289&chxp=0,1,48,100&chtt=priest_90_di_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:52.7,13.6,10.7,8.1,5.4,4.0,2.9,1.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 237.5s|mind_blast 61.3s|shadow_word_pain 48.2s|vampiric_touch 36.6s|devouring_plague 24.2s|shadow_word_death 17.9s|halo 13.1s|mindbender 8.3s|waiting 2.5s&chtt=priest_90_di_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no2PT14 101728
devouring_plague 6456 (18110) 6.3% (17.8%) 20.3 23.09sec 400799 337562 117929 244174 142929 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.34 20.34 0.00 0.00 1.1874 0.0000 2907274.30 2907274.30 0.00 337562.41 337562.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.31 80.20% 117928.73 107519 143944 117962.69 111813 125589 1923703 1923703 0.00
crit 4.03 19.80% 244174.42 221488 296525 240912.61 0 296525 983571 983571 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2782 2.7% 52.5 8.57sec 23841 0 19675 40781 23870 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.52 52.46 0.00 0.00 0.0000 0.0000 1252107.56 1252107.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.03 80.13% 19675.12 17856 23904 19681.34 18690 20827 826954 826954 0.00
crit 10.43 19.87% 40781.31 36784 49242 40796.03 36784 46564 425153 425153 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8871 8.7% 20.3 23.09sec 196312 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.9 19602 40587 23782 19.9% 0.0% 28.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.34 20.34 167.90 167.90 0.0000 0.7528 3993087.89 3993087.89 0.00 31589.64 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.5 80.08% 19601.54 17856 30194 19606.86 18725 20530 2635570 2635570 0.00
crit 33.4 19.92% 40587.30 36784 61432 40594.24 38250 43785 1357518 1357518 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3547) 0.0% (3.5%) 11.1 41.79sec 143182 121766 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 1.1759 0.0000 0.00 0.00 0.00 121765.56 121765.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 80.09% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.91% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3547 3.5% 11.1 41.79sec 143182 0 118156 244620 143187 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 0.0000 0.0000 1596224.75 1596224.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.21% 118156.27 109581 139821 118182.39 110921 127385 1056562 1056562 0.00
crit 2.21 19.79% 244619.77 225736 288030 221736.63 0 288030 539663 539663 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.79sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.15 235.84 0.00 0.00 0.0000 0.0000 0.00 46326509.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.58 76.99% 0.00 0 0 0.00 0 0 0 28619580 100.00
crit 54.26 23.01% 0.00 0 0 0.00 0 0 0 17706930 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13144 12.9% 51.6 8.76sec 114647 96611 94493 195733 114647 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.63 51.63 0.00 0.00 1.1867 0.0000 5919091.87 5919091.87 0.00 96611.42 96611.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.35 80.09% 94492.70 86183 115909 94517.83 91703 97790 3907371 3907371 0.00
crit 10.28 19.91% 195733.28 177536 238773 195782.26 177536 220176 2011721 2011721 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20069 (26339) 19.7% (25.9%) 131.8 3.37sec 90057 49980 0 0 0 0.0% 0.0% 0.0% 0.0% 297.0 25100 52012 30449 19.9% 0.0% 48.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.79 131.79 296.97 296.97 1.8019 0.7423 9042535.41 9042535.41 0.00 49979.59 49979.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 237.9 80.12% 25100.01 22887 30640 25106.37 24574 25744 5972354 5972354 0.00
crit 59.0 19.88% 52011.76 47146 63119 52026.87 49823 54350 3070181 3070181 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6270 6.2% 92.9 4.74sec 30412 0 25105 52021 30431 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.91 92.86 0.00 0.00 0.0000 0.0000 2825718.98 2825718.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.48 80.21% 25105.32 22887 30640 25111.68 24212 26298 1869969 1869969 0.00
crit 18.37 19.79% 52020.60 47146 63119 52032.98 48090 56911 955750 955750 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1971 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3839 3.8% 15.0 4.88sec 115194 96437 94644 196436 115194 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.02 15.02 0.00 0.00 1.1945 0.0000 1730171.07 1730171.07 0.00 96436.71 96436.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.99 79.81% 94643.89 83662 112752 94726.62 86379 102554 1134550 1134550 0.00
crit 3.03 20.19% 196435.70 172343 232270 189604.90 0 232270 595621 595621 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9365 (12286) 9.2% (12.1%) 40.6 11.07sec 136112 114662 0 0 0 0.0% 0.0% 0.0% 0.0% 236.3 14702 30449 17827 19.8% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.60 40.60 236.30 236.30 1.1871 1.8795 4212456.98 4212456.98 0.00 11225.62 114662.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.4 80.15% 14701.76 13422 17966 14704.57 14292 15212 2784503 2784503 0.00
crit 46.9 19.85% 30448.95 27649 37009 30453.96 29013 32676 1427954 1427954 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2921 2.9% 74.0 5.99sec 17756 0 14655 30340 17770 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.01 73.95 0.00 0.00 0.0000 0.0000 1314041.23 1314041.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.26 80.14% 14654.68 13422 17966 14656.57 14098 15252 868497 868497 0.00
crit 14.68 19.86% 30340.09 27649 37009 30345.91 28123 33412 445544 445544 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2776 2.7% 57.8 7.65sec 21603 0 18291 36773 21968 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.83 56.87 0.00 0.00 0.0000 0.0000 1249265.98 1249265.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.55 80.10% 18290.51 16669 22484 18292.91 17479 19239 833212 833212 0.00
crit 11.31 19.90% 36773.21 33338 44968 36778.80 33338 41780 416054 416054 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8542 (11192) 8.4% (11.0%) 30.8 14.72sec 163769 137713 0 0 0 0.0% 0.0% 0.0% 0.0% 191.1 16582 34372 20123 19.9% 0.0% 95.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.78 30.78 191.15 191.15 1.1892 2.2570 3846459.47 3846459.47 0.00 10769.19 137713.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.1 80.10% 16582.42 15001 20366 16587.40 16085 17144 2538906 2538906 0.00
crit 38.0 19.90% 34371.84 30902 41955 34380.67 32592 36652 1307553 1307553 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2651 2.6% 59.8 7.35sec 19959 0 16467 34105 19976 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.82 59.77 0.00 0.00 0.0000 0.0000 1193844.14 1193844.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.88 80.11% 16467.15 15001 20366 16470.31 15736 17265 788398 788398 0.00
crit 11.89 19.89% 34104.92 30902 41955 34111.85 30902 38960 405446 405446 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40471 / 10496
melee 40471 10.3% 107.3 4.09sec 43967 41319 38411 77402 43967 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.31 107.31 0.00 0.00 1.0641 0.0000 4718297.12 4718297.12 0.00 41318.98 41318.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.93 55.84% 38410.67 30516 46982 38428.55 36490 41002 2301906 2301906 0.00
crit 21.61 20.14% 77401.82 61032 93964 77435.60 70414 85650 1672801 1672801 0.00
glance 25.77 24.02% 28851.62 22887 35237 28862.64 26415 31323 743590 743590 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 1.1905 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.97%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.8 0.7 28.2sec 26.9sec 5.88% 28.19%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.88%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.11% 20.11%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.11%

    Trigger Attempt Success

    • trigger_pct:16.13%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.5sec 20.7sec 43.60% 43.92%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.60%

    Trigger Attempt Success

    • trigger_pct:2.15%
light_of_the_cosmos 9.6 0.0 48.8sec 48.8sec 41.89% 41.89%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.89%

    Trigger Attempt Success

    • trigger_pct:14.91%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.75% 49.52%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.39% 84.09%

Buff details

  • buff initial source:priest_90_di_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no2PT14
devouring_plague Shadow Orb 20.3 61.0 3.0 3.0 133600.1
halo Mana 11.1 451500.5 40500.0 40499.9 3.5
mind_blast Mana 51.6 321527.5 6227.7 6227.7 18.4
mind_flay Mana 131.8 395359.2 3000.0 3000.0 30.0
shadow_word_death Mana 15.0 117157.2 7800.0 7800.2 14.8
shadow_word_pain Mana 40.6 535953.8 13200.0 13200.0 10.3
vampiric_touch Mana 30.8 276992.6 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.31 392830.26 (19.14%) 3660.56 77308.31 16.44%
Shadow Orbs from Mind Blast Shadow Orb 51.63 51.63 (87.19%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.58 7.58 (12.81%) 1.00 0.00 0.00%
Devouring Plague Health Health 220.36 0.00 (-nan%) 0.00 3060051.16 100.00%
Vampiric Touch Mana Mana 250.92 1173103.34 (57.15%) 4675.28 153094.42 11.54%
mp5_regen Mana 1801.40 486873.80 (23.72%) 270.28 53545.24 9.91%
Resource RPS-Gain RPS-Loss
Mana 4556.98 4658.39
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 254312.94 170352.38 300000.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 10.0%
shadowfiend-Mana Cap 10.0%
lightwell-Mana Cap 10.0%

Procs

Count Interval
Shadowy Recall Extra Tick 279.0 1.6sec
Shadowy Apparition Procced 57.8 7.7sec
Divine Insight Mind Blast CD Reset 27.2 26.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no2PT14 Damage Per Second
Count 49992
Mean 101728.27
Minimum 94859.40
Maximum 109288.80
Spread ( max - min ) 14429.40
Range [ ( max - min ) / 2 * 100% ] 7.09%
Standard Deviation 1972.5490
5th Percentile 98603.01
95th Percentile 105032.84
( 95th Percentile - 5th Percentile ) 6429.83
Mean Distribution
Standard Deviation 8.8222
95.00% Confidence Intervall ( 101710.98 - 101745.56 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1444
0.1 Scale Factor Error with Delta=300 33215
0.05 Scale Factor Error with Delta=300 132861
0.01 Scale Factor Error with Delta=300 3321538
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 101728.27
Distribution Chart

Damage

Sample Data
Count 49992
Mean 41082279.63
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 260.42
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.63 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.02 shadow_word_death,if=active_enemies<=5
F 52.03 mind_blast,if=active_enemies<=6&cooldown_react
G 21.96 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.04 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.15 halo,if=talent.halo.enabled
M 15.71 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.68 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.61 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 65.04 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 18.65 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTQFTHTGFMTFHTFGTHLWWWWFHMTFTAQQQFTHGTFMTFHTQQQFLGTQFHMTFTGHTFTFAHGDFLTWWWWWWFHTQFMTHTGFTFHLTGFMTHTAFTGTFHTQFMTHLGTFWWWWWFHTFTGFHMTATQQFTLHTFGTFHMTFGTHTFTQFMTLTGFHTWWWWAFTHTFMTGFHQFTLTFMTHGTQFTHFTGFMAHTFLTEEGFHMTPEETFTHEDEFGTFEDEHLTFTEEGT9AFDHEETFTGEDEFHTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb_no4PT14 : 103930 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103930.4 103930.4 17.48 / 0.02% 3340 / 3.2% 20.0 4658.2 4557.3 Mana 0.55% 34.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:337374|137812|124643|121997|96507|96326|50042&chds=0,674749&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++337374++devouring_plague,9482C9,0,0,15|t++137812++vampiric_touch,9482C9,1,0,15|t++124643++shadow_word_pain,9482C9,2,0,15|t++121997++halo,9482C9,3,0,15|t++96507++mind_blast,9482C9,4,0,15|t++96326++shadow_word_death,9482C9,5,0,15|t++50042++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:22,14,11,11,9,9,7,7,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|devouring_plague_tick|vampiric_touch|devouring_plague|mind_flay_mastery|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_mb_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:566776642211201z0zyxwusqpnnmmmmllkkkjihgfeddddcccccbbcccbbcdefgijkkkkkkjjjiiiihhffeedcbaaaabbbbcbbbaaabbbccddeeeeeffghhijkkkllkkjjiiiihhgffedccbbaaabbbbcccccccccdddddddddddcccccdeeeefffgghhhhhhiiiihhggffeeedcccbbaaaaaaaaaaabbbbccccccccddeffghhiijjkkkllllmmllkjihggfeedccbbbaaaaaabbbbbbbbaabbaaaaaaabccddeefgghiiijjjjjjjiihhhhggffeeeeefffgghhhhhhgggggghggggggghhhiijkllmmmmmmmmmmmlllkkjiihggffffffgggggggggggghhhhhhhhhhhiijjklmmnnoopppppqqrrqqqqpppoonnmmnnnnnnmmmmllllkkkkkkjjjiiijjkklmnnoopqqrrsssttttsssrqppoonmmmmlllllkkkkjjjjjjiiiihhhggggffffeee&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5595,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=103930|max=185770&chxp=1,1,56,100&chtt=priest_90_di_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,8,16,32,56,152,128,328,368,552,608,784,800,1232,1432,1760,2064,2448,2632,2912,2912,2936,3248,3184,2632,2752,2496,1984,1848,1472,1200,1008,776,752,616,408,408,296,216,136,136,72,64,48,24,0,24,24&chds=0,3248&chbh=5&chxt=x&chxl=0:|min=96714|avg=103930|max=111523&chxp=0,1,49,100&chtt=priest_90_di_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:52.7,13.6,10.7,8.1,5.4,4.0,2.9,1.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 237.4s|mind_blast 61.3s|shadow_word_pain 48.2s|vampiric_touch 36.6s|devouring_plague 24.2s|shadow_word_death 17.9s|halo 13.1s|mindbender 8.3s|waiting 2.5s&chtt=priest_90_di_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb_no4PT14 103930
devouring_plague 6464 (18105) 6.2% (17.4%) 20.4 23.08sec 400494 337374 117913 244198 143012 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.35 20.35 0.00 0.00 1.1871 0.0000 2910418.84 2910418.84 0.00 337374.39 337374.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.31 80.12% 117912.87 107519 143944 117949.55 111965 124513 1922645 1922645 0.00
crit 4.04 19.88% 244198.01 221488 296525 240820.06 0 296525 987773 987773 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2774 2.7% 52.4 8.59sec 23828 0 19671 40769 23860 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.39 52.32 0.00 0.00 0.0000 0.0000 1248426.36 1248426.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.93 80.14% 19671.07 17856 23904 19677.24 18725 20912 824855 824855 0.00
crit 10.39 19.86% 40769.25 36784 49242 40782.59 36784 47032 423571 423571 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8867 8.5% 20.4 23.08sec 196134 0 0 0 0 0.0% 0.0% 0.0% 0.0% 167.9 19599 40584 23769 19.9% 0.0% 28.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.35 20.35 167.93 167.93 0.0000 0.7527 3991445.36 3991445.36 0.00 31579.14 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 134.6 80.13% 19599.29 17856 28792 19605.20 18795 20604 2637405 2637405 0.00
crit 33.4 19.87% 40583.79 36784 59311 40592.79 38241 43951 1354040 1354040 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3553) 0.0% (3.4%) 11.1 41.80sec 143464 121997 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 1.1760 0.0000 0.00 0.00 0.00 121996.89 121996.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.20% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.80% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3553 3.4% 11.1 41.80sec 143464 0 118174 244453 143465 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.15 11.15 0.00 0.00 0.0000 0.0000 1599135.28 1599135.28 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 79.97% 118173.57 109581 139821 118192.00 110251 129873 1053428 1053428 0.00
crit 2.23 20.03% 244452.67 225736 288030 223351.84 0 288030 545707 545707 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.80sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.15 235.71 0.00 0.00 0.0000 0.0000 0.00 46291312.05 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 181.57 77.03% 0.00 0 0 0.00 0 0 0 28617765 100.00
crit 54.14 22.97% 0.00 0 0 0.00 0 0 0 17673547 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13134 12.6% 51.6 8.76sec 114526 96507 94501 195661 114527 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.65 51.65 0.00 0.00 1.1867 0.0000 5914844.18 5914844.18 0.00 96507.43 96507.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.42 80.20% 94501.15 86183 115909 94527.20 91301 98799 3914486 3914486 0.00
crit 10.22 19.80% 195660.88 177536 238773 195712.65 177536 223431 2000358 2000358 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20077 (26366) 19.3% (25.4%) 131.7 3.37sec 90197 50042 0 0 0 0.0% 0.0% 0.0% 0.0% 296.9 25101 51996 30463 19.9% 0.0% 48.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.71 131.71 296.95 296.95 1.8025 0.7423 9045792.63 9045792.63 0.00 50041.58 50041.58
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 131.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 237.8 80.07% 25101.39 22887 30640 25107.68 24479 25776 5967893 5967893 0.00
crit 59.2 19.93% 51996.17 47146 63119 52008.60 49684 54356 3077899 3077899 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6290 6.1% 93.1 4.73sec 30451 0 25102 52022 30468 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.06 93.01 0.00 0.00 0.0000 0.0000 2833727.91 2833727.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 74.47 80.07% 25102.17 22887 30640 25108.25 24205 26197 1869305 1869305 0.00
crit 18.54 19.93% 52022.08 47146 63119 52038.76 48543 56759 964423 964423 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.84sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1973 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3835 3.7% 15.0 4.88sec 115073 96326 94635 196067 115069 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.02 15.02 0.00 0.00 1.1947 0.0000 1728960.54 1728960.54 0.00 96326.29 96326.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.00 79.85% 94634.57 83662 112752 94711.29 87298 105684 1135391 1135391 0.00
crit 3.03 20.15% 196067.41 172343 232270 189294.85 0 232270 593570 593570 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10193 (13368) 9.8% (12.9%) 40.6 11.06sec 147969 124643 0 0 0 0.0% 0.0% 0.0% 0.0% 236.3 14699 30397 19400 29.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.64 40.64 236.33 236.33 1.1872 1.8792 4584823.25 4584823.25 0.00 12213.36 124643.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.64 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 165.5 70.05% 14698.87 13422 17966 14701.73 14232 15336 2433345 2433345 0.00
crit 70.8 29.95% 30396.85 27649 37009 30401.63 29110 32099 2151478 2151478 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3176 3.1% 73.9 6.00sec 19320 0 14653 30301 19335 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.94 73.88 0.00 0.00 0.0000 0.0000 1428459.30 1428459.30 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.77 70.08% 14652.85 13422 17966 14655.13 14063 15325 758580 758580 0.00
crit 22.11 29.92% 30301.07 27649 37009 30309.02 28301 33067 669879 669879 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3873 3.7% 80.8 5.51sec 21585 0 18285 36759 21942 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.76 79.45 0.00 0.00 0.0000 0.0000 1743181.04 1743181.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.72 80.21% 18284.68 16669 22484 18287.42 17586 19001 1165133 1165133 0.00
crit 15.73 19.79% 36758.83 33338 44968 36768.18 34128 40865 578048 578048 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8549 (11202) 8.2% (10.8%) 30.8 14.72sec 163867 137812 0 0 0 0.0% 0.0% 0.0% 0.0% 191.2 16585 34381 20134 19.9% 0.0% 95.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.78 30.78 191.19 191.19 1.1891 2.2568 3849446.07 3849446.07 0.00 10775.05 137812.40
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.1 80.06% 16584.72 15001 20366 16589.58 16123 17319 2538455 2538455 0.00
crit 38.1 19.94% 34380.96 30902 41955 34391.47 32739 36895 1310991 1310991 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2653 2.6% 59.8 7.35sec 19960 0 16469 34115 19978 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.82 59.77 0.00 0.00 0.0000 0.0000 1194074.45 1194074.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.89 80.12% 16468.99 15001 20366 16472.47 15640 17257 788673 788673 0.00
crit 11.88 19.88% 34114.92 30902 41955 34125.35 30902 38202 405401 405401 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40458 / 10494
melee 40458 10.1% 107.3 4.09sec 43946 41298 38403 77394 43946 20.1% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.33 107.33 0.00 0.00 1.0641 0.0000 4716912.39 4716912.39 0.00 41298.18 41298.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.92 55.82% 38403.46 30516 46982 38421.25 36461 40726 2300986 2300986 0.00
crit 21.58 20.11% 77394.02 61032 93964 77430.11 70059 85919 1670541 1670541 0.00
glance 25.83 24.07% 28853.62 22887 35237 28865.08 26633 31366 745385 745385 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 1.1905 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.98%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 14.8 0.6 28.2sec 27.0sec 5.90% 28.23%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.90%

Trigger Attempt Success

  • trigger_pct:5.00%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.15%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.57% 43.90%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.57%

    Trigger Attempt Success

    • trigger_pct:2.15%
light_of_the_cosmos 9.6 0.0 48.8sec 48.8sec 41.88% 41.88%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.88%

    Trigger Attempt Success

    • trigger_pct:14.88%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.75% 49.52%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.38% 84.07%

Buff details

  • buff initial source:priest_90_di_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb_no4PT14
devouring_plague Shadow Orb 20.4 61.1 3.0 3.0 133498.2
halo Mana 11.1 451435.7 40500.0 40499.9 3.5
mind_blast Mana 51.6 321235.2 6220.0 6219.9 18.4
mind_flay Mana 131.7 395118.7 3000.0 3000.0 30.1
shadow_word_death Mana 15.0 117198.4 7800.0 7800.2 14.8
shadow_word_pain Mana 40.6 536429.0 13200.0 13199.9 11.2
vampiric_touch Mana 30.8 277002.7 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.33 392711.37 (19.13%) 3658.75 77517.63 16.49%
Shadow Orbs from Mind Blast Shadow Orb 51.65 51.65 (87.19%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.59 7.59 (12.81%) 1.00 0.00 0.00%
Devouring Plague Health Health 220.25 0.00 (-nan%) 0.00 3058531.41 100.00%
Vampiric Touch Mana Mana 250.96 1173336.49 (57.15%) 4675.36 153120.95 11.54%
mp5_regen Mana 1801.40 486913.97 (23.72%) 270.30 53505.07 9.90%
Resource RPS-Gain RPS-Loss
Mana 4557.32 4658.24
Shadow Orb 0.13 0.14
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 254543.93 173052.38 300000.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.9%
shadowfiend-Mana Cap 9.9%
lightwell-Mana Cap 9.9%

Procs

Count Interval
Shadowy Recall Extra Tick 279.0 1.6sec
Shadowy Apparition Procced 80.8 5.5sec
Divine Insight Mind Blast CD Reset 27.3 27.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_mb_no4PT14 Damage Per Second
Count 49992
Mean 103930.41
Minimum 96713.78
Maximum 111523.27
Spread ( max - min ) 14809.49
Range [ ( max - min ) / 2 * 100% ] 7.12%
Standard Deviation 1993.6239
5th Percentile 100687.28
95th Percentile 107367.98
( 95th Percentile - 5th Percentile ) 6680.70
Mean Distribution
Standard Deviation 8.9165
95.00% Confidence Intervall ( 103912.93 - 103947.88 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1413
0.1 Scale Factor Error with Delta=300 33928
0.05 Scale Factor Error with Delta=300 135715
0.01 Scale Factor Error with Delta=300 3392892
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103930.41
Distribution Chart

Damage

Sample Data
Count 49992
Mean 42072735.23
Distribution Chart

DTPS

Sample Data priest_90_di_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 260.46
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.65 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.03 shadow_word_death,if=active_enemies<=5
F 52.06 mind_blast,if=active_enemies<=6&cooldown_react
G 21.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.04 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.15 halo,if=talent.halo.enabled
M 15.70 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.71 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.61 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.97 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 18.69 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTQFMTHTGFTFTHTGFMTFTLWWWWWFHTAFMTHTGFTFHTLTGFMTHFTFGTHTFMTATHQFGLTWWWWWWFHTQQQQQQQQFMTHQFGTQFTHLTFMGTQFHATFTGTHTQFMTQFHLGTWFWWWWTFHMTQFTFGHATQFMLTHTFGTFHTFMTGTHQQQQQQFFTLFMHGTWWAFWWTHFTFMTGHTFTLTFHTGTFMTHFTAFGTHTFLMTEEHGFTEDEFTFHEDEFGTPEEFHLMTPEEFAG9THPEDEFTPEEGHFMTEETF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no2PT14 : 99229 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
99229.4 99229.4 17.83 / 0.02% 3336 / 3.4% 19.2 4959.4 4556.3 Mana 0.50% 36.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:337515|145065|137697|121821|102301|96589|96503|50001&chds=0,675030&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++337515++devouring_plague,9482C9,0,0,15|t++145065++shadow_word_insanity,9482C9,1,0,15|t++137697++vampiric_touch,9482C9,2,0,15|t++121821++halo,9482C9,3,0,15|t++102301++shadow_word_pain,9482C9,4,0,15|t++96589++mind_blast,9482C9,5,0,15|t++96503++shadow_word_death,9482C9,6,0,15|t++50001++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,14,9,9,9,7,7,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|devouring_plague_tick|shadow_word_pain|vampiric_touch|shadow_word_insanity|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|halo_damage|devouring_plague_mastery|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition&chtt=priest_90_di_swi_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7865432110zzzyyxxwvtsqononmllkkkjiiihgfedcbbbaaaaaaaaZZYXYYYYZabbbccccbbbbbbccbbbbbbbaaaaaabbbbaaaaaaaaabbcddddddddddeeeeeeddcbaZZZYYYYYZYYXXXYYYYYZaaabbbbbbbbccccccccdddccccddefgggggggggffffgghggfedccbbbbbbbbaaaZZYYYYYZZZZZZZaabbbbbcccccccccccccccbbccdddddcccccccccbbbbbbaaaZaaabbaaaaaaaaaaaaZZZZYYYXXXYYYYYYYYZaaaaabbbbccccddddddedddeeffgggggggggggffffghhiijjkklllllllllllkkjiiihhgffeeeeeeeeeffffffffeeeeffffgggggggfffffggggggggggggghhhiiijjjjjkkkkklllllllllkkkkkkkjjjjjiiihhhhhhhhhhhhhhhhhhhiiijjjkkkkkkkkkkkkkllkkkkjjjjjjiiiihhhgggghghggggggggg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5120,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=99229|max=193802&chxp=1,1,51,100&chtt=priest_90_di_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,8,0,16,32,56,104,160,288,368,536,736,1064,1336,1584,1840,2304,2656,2928,3216,3512,3344,3176,3088,2896,2632,2136,2056,1744,1392,1192,1056,752,520,296,328,216,144,104,48,40,32,8,8,8,8,0,8&chds=0,3512&chbh=5&chxt=x&chxl=0:|min=91208|avg=99229|max=108005&chxp=0,1,48,100&chtt=priest_90_di_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.0,13.5,11.1,8.2,5.3,4.7,4.0,2.9,0.5,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 220.7s|mind_blast 60.8s|shadow_word_pain 50.2s|vampiric_touch 36.8s|devouring_plague 24.0s|shadow_word_insanity 21.4s|shadow_word_death 17.9s|halo 13.0s|shadowfiend 2.4s|dispersion 0.0s|waiting 2.2s&chtt=priest_90_di_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no2PT14 99229
devouring_plague 6416 (17988) 6.5% (18.1%) 20.2 23.27sec 400873 337515 117870 244080 143030 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 0.00 0.00 1.1878 0.0000 2889033.60 2889033.60 0.00 337514.80 337514.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.17 80.07% 117869.91 107519 143944 117900.67 111092 125145 1906312 1906312 0.00
crit 4.03 19.93% 244080.43 221488 296525 241296.96 0 296525 982721 982721 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2766 2.8% 52.2 8.62sec 23846 0 19676 40767 23880 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.22 52.14 0.00 0.00 0.0000 0.0000 1245143.75 1245143.75 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.75 80.07% 19676.24 17856 23904 19682.34 18577 21258 821483 821483 0.00
crit 10.39 19.93% 40767.24 36784 49242 40773.45 36784 45550 423661 423661 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8805 8.9% 20.2 23.27sec 196203 0 0 0 0 0.0% 0.0% 0.0% 0.0% 166.7 19593 40563 23771 19.9% 0.0% 27.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.20 20.20 166.72 166.72 0.0000 0.7531 3963140.28 3963140.28 0.00 31564.47 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.5 80.08% 19593.25 17856 26510 19598.19 18685 20406 2615896 2615896 0.00
crit 33.2 19.92% 40563.36 36784 54610 40572.35 38234 43415 1347245 1347245 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3532) 0.0% (3.6%) 11.1 41.97sec 143205 121821 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 11.10 0.00 0.00 1.1756 0.0000 0.00 0.00 0.00 121821.04 121821.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.88 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3532 3.6% 11.1 41.97sec 143205 0 118053 244289 143207 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 11.10 0.00 0.00 0.0000 0.0000 1589399.09 1589399.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.89 80.08% 118053.26 109581 139821 118063.68 109581 128727 1049179 1049179 0.00
crit 2.21 19.92% 244288.96 225736 288030 222742.38 0 288030 540220 540220 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.97sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.10 232.86 0.00 0.00 0.0000 0.0000 0.00 45708764.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.26 76.98% 0.00 0 0 0.00 0 0 0 28234838 100.00
crit 53.60 23.02% 0.00 0 0 0.00 0 0 0 17473926 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13045 13.2% 51.2 8.83sec 114727 96589 94498 195657 114726 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.20 51.20 0.00 0.00 1.1878 0.0000 5874136.01 5874136.01 0.00 96588.66 96588.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.96 80.00% 94498.12 86183 115909 94523.88 91756 98700 3870904 3870904 0.00
crit 10.24 20.00% 195657.07 177536 238773 195712.99 177536 226178 2003232 2003232 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18667 (24493) 18.8% (24.7%) 123.1 3.61sec 89644 50001 0 0 0 0.0% 0.0% 0.0% 0.0% 276.0 25104 52002 30464 19.9% 0.0% 45.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.09 123.09 276.02 276.02 1.7929 0.7413 8408953.89 8408953.89 0.00 50000.69 50000.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.09 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 221.0 80.07% 25103.65 22887 30640 25109.28 24526 25925 5548236 5548236 0.00
crit 55.0 19.93% 52002.19 47146 63119 52016.66 49875 54280 2860718 2860718 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5826 5.9% 86.3 5.10sec 30433 0 25102 52024 30452 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.26 86.20 0.00 0.00 0.0000 0.0000 2625048.42 2625048.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.07 80.13% 25102.32 22887 30640 25107.40 23975 26232 1733905 1733905 0.00
crit 17.13 19.87% 52024.30 47146 63119 52043.92 47551 58268 891143 891143 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3838 3.9% 15.0 4.87sec 115273 96503 94616 196229 115272 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.02 15.02 0.00 0.00 1.1946 0.0000 1730870.59 1730870.59 0.00 96502.60 96502.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.96 79.67% 94615.89 83662 112752 94695.39 87813 102482 1131888 1131888 0.00
crit 3.05 20.33% 196228.68 172343 232270 188705.89 0 232270 598982 598982 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 6859 6.9% 18.1 23.80sec 171653 145065 141650 293263 171651 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.05 18.05 0.00 0.00 1.1833 0.0000 3098882.36 3098882.36 0.00 145065.18 145065.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.48 80.21% 141650.32 128911 173880 141683.29 132897 152162 2051180 2051180 0.00
crit 3.57 19.79% 293262.72 265556 358194 286421.47 0 358194 1047702 1047702 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8709 (11418) 8.8% (11.5%) 42.2 10.64sec 121587 102301 0 0 0 0.0% 0.0% 0.0% 0.0% 219.4 14714 30486 17850 19.9% 0.0% 88.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.23 42.23 219.39 219.39 1.1885 1.8262 3916203.06 3916203.06 0.00 11388.61 102300.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.23 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.8 80.11% 14714.35 13422 17966 14717.11 14362 15143 2586230 2586230 0.00
crit 43.6 19.89% 30485.74 27649 37009 30491.09 28782 32341 1329973 1329973 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2709 2.7% 68.6 6.46sec 17760 0 14656 30350 17772 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.58 68.54 0.00 0.00 0.0000 0.0000 1218078.67 1218078.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.93 80.14% 14656.26 13422 17966 14658.42 13981 15343 805030 805030 0.00
crit 13.61 19.86% 30349.93 27649 37009 30359.75 27649 33619 413048 413048 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2233 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2601 2.6% 54.2 8.16sec 21599 0 18291 36793 21956 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.17 53.29 0.00 0.00 0.0000 0.0000 1169976.09 1169976.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.73 80.19% 18290.54 16669 22484 18292.47 17465 19142 781551 781551 0.00
crit 10.56 19.81% 36792.99 33338 44968 36796.37 0 41653 388425 388425 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8579 (11244) 8.6% (11.3%) 30.9 14.64sec 163639 137697 0 0 0 0.0% 0.0% 0.0% 0.0% 192.0 16582 34366 20118 19.9% 0.0% 96.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.94 30.94 192.03 192.03 1.1884 2.2584 3863196.15 3863196.15 0.00 10761.70 137696.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.9 80.12% 16582.47 15001 20366 16587.12 16026 17117 2551255 2551255 0.00
crit 38.2 19.88% 34365.80 30902 41955 34375.48 32414 36925 1311941 1311941 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2664 2.7% 60.1 7.31sec 19954 0 16471 34116 19970 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.12 60.07 0.00 0.00 0.0000 0.0000 1199646.57 1199646.57 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.16 80.17% 16470.78 15001 20366 16474.23 15614 17282 793242 793242 0.00
crit 11.91 19.83% 34116.28 30902 41955 34122.26 30902 37771 406405 406405 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52966 / 4211
melee 52966 4.2% 33.3 11.80sec 56276 55573 48888 98835 56277 20.6% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.30 33.30 0.00 0.00 1.0127 0.0000 1874187.94 1874187.94 0.00 55572.66 55572.66
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.46 55.42% 48888.02 38145 58728 48900.77 43153 55152 902249 902249 0.00
crit 6.87 20.63% 98835.34 76291 117456 98824.17 0 117456 678903 678903 0.00
glance 7.98 23.96% 36726.20 28609 44046 36713.93 0 44046 293036 293036 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1933 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.01%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 13.8 0.6 30.1sec 28.9sec 5.46% 26.47%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.46%

Trigger Attempt Success

  • trigger_pct:4.99%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.5sec 108.5sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:16.27%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.5sec 20.6sec 43.74% 44.09%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.74%

    Trigger Attempt Success

    • trigger_pct:2.20%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.73% 41.73%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.73%

    Trigger Attempt Success

    • trigger_pct:14.95%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.74% 49.52%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.74%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.36% 78.63%

Buff details

  • buff initial source:priest_90_di_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no2PT14
devouring_plague Shadow Orb 20.2 60.6 3.0 3.0 133624.4
halo Mana 11.1 449498.2 40500.0 40499.9 3.5
mind_blast Mana 51.2 326940.5 6385.4 6385.4 18.0
mind_flay Mana 123.1 369257.3 3000.0 3000.0 29.9
shadow_word_death Mana 15.0 117123.6 7800.0 7800.2 14.8
shadow_word_insanity Mana 18.1 135400.8 7500.0 7500.1 22.9
shadow_word_pain Mana 42.2 557399.0 13200.0 13200.0 9.2
vampiric_touch Mana 30.9 278451.4 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.01 253.44 (0.01%) 18000.00 0.00 0.00%
shadowfiend Mana 33.30 245371.01 (11.95%) 7367.68 54362.11 18.14%
Shadow Orbs from Mind Blast Shadow Orb 51.20 51.20 (87.10%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.58 7.58 (12.90%) 1.00 0.00 0.00%
Devouring Plague Health Health 218.86 0.00 (-nan%) 0.00 3039287.90 100.00%
Vampiric Touch Mana Mana 252.10 1282881.55 (62.50%) 5088.79 49501.49 3.72%
mp5_regen Mana 1801.40 523972.18 (25.53%) 290.87 16446.86 3.04%
Resource RPS-Gain RPS-Loss
Mana 4556.25 4959.36
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 118417.28 1200.00 277800.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
shadowfiend-Mana Cap 3.1%
lightwell-Mana Cap 3.1%

Procs

Count Interval
Shadowy Recall Extra Tick 267.0 1.7sec
Shadowy Apparition Procced 54.2 8.2sec
Divine Insight Mind Blast CD Reset 25.3 28.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no2PT14 Damage Per Second
Count 49992
Mean 99229.43
Minimum 91208.39
Maximum 108004.78
Spread ( max - min ) 16796.39
Range [ ( max - min ) / 2 * 100% ] 8.46%
Standard Deviation 2033.7769
5th Percentile 95970.39
95th Percentile 102641.41
( 95th Percentile - 5th Percentile ) 6671.01
Mean Distribution
Standard Deviation 9.0961
95.00% Confidence Intervall ( 99211.60 - 99247.25 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1613
0.1 Scale Factor Error with Delta=300 35309
0.05 Scale Factor Error with Delta=300 141237
0.01 Scale Factor Error with Delta=300 3530939
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 99229.43
Distribution Chart

Damage

Sample Data
Count 49992
Mean 42791708.53
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 270.40
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.64 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.02 shadow_word_death,if=active_enemies<=5
F 51.67 mind_blast,if=active_enemies<=6&cooldown_react
G 22.59 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.11 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.05 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.10 halo,if=talent.halo.enabled
M 15.56 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.50 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.24 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.28 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 19.63 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTHFGMTFTHTFIGTFMTLWWWWWFHTFTFHGDFTFHTIGLFMTHTFTIGFTHTFMTIGTHFTLWWFWWHTFMTHFIGTFTHTIGFLMTHBFTIGTQQFHTFIGMTFHTLTIGWWWFHTQFMTHIFGTQFHTLIGFMTHTFTIGTFHTIFGMHTLTFTWWWWFHTFMTHFGTFTHLTIGTFMQQQQFTHTFIGTBTFHMTIGFTEEHLFMTIEEGQFHTEDEFTIGEEFHMTEEFIG9HLTEDEFTHEEFGMQQQQQQFTEET

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi_no4PT14 : 101285 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
101284.7 101284.7 18.10 / 0.02% 3384 / 3.3% 19.6 4958.2 4557.3 Mana 0.50% 36.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:337182|145320|137763|121937|111208|96520|96340|50009&chds=0,674363&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++337182++devouring_plague,9482C9,0,0,15|t++145320++shadow_word_insanity,9482C9,1,0,15|t++137763++vampiric_touch,9482C9,2,0,15|t++121937++halo,9482C9,3,0,15|t++111208++shadow_word_pain,9482C9,4,0,15|t++96520++mind_blast,9482C9,5,0,15|t++96340++shadow_word_death,9482C9,6,0,15|t++50009++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,13,10,9,9,7,7,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|devouring_plague_tick|vampiric_touch|shadow_word_insanity|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|devouring_plague_mastery|vampiric_touch_mastery&chtt=priest_90_di_swi_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:7865432120zz0yzxxxvutrooponmmkllkjjiigffedcccaabbbbaaaaZYYZZZZabbccccccbbccccccbccccbbaaaabbbcbbbbaaaabbbcddeeeddddddeefffeeddcbaaZZZZZZZZYYYYYZZZZZaabbbcccbbcccddcccdddddcccdefgggghhhhggggggghhhgfeedccccccccbbbaZZZZZZZZaaaaaaabbbbbcccccdddcdcddddccccddddddddcddddcccbbbbbbaaaaabbbbaaaaaaabaaaaaZZYYYYYYYYYZZZZZZabbbbbcccccdddddeeeeedeeffgggggggggggggffghhiijjjklllmlllllllllkjjiiihggffeeeeeefffffggfffffffffgggggggggggggggggghhhhhhhhhhhiiijjjjkkkkklllllmmmlllllkkkkkkkkkjjjiiiihhhhiiiiiiiihhiiiijjjkkkkkkkkkkllllllllkkkjjjjjjiiihhhgggggggggggfffff&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5197,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=101285|max=194872&chxp=1,1,52,100&chtt=priest_90_di_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,0,8,72,64,104,184,400,480,560,888,1152,1584,1704,1952,2296,2600,2936,3408,3272,2984,3080,3256,2784,2560,2104,1952,1520,1400,1232,928,616,616,368,256,208,136,120,64,48,8,16,24,8,8,0,8,0,8&chds=0,3408&chbh=5&chxt=x&chxl=0:|min=94083|avg=101285|max=110740&chxp=0,1,43,100&chtt=priest_90_di_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:49.0,13.5,11.1,8.2,5.3,4.8,4.0,2.9,0.5,0.0,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 220.6s|mind_blast 60.8s|shadow_word_pain 50.2s|vampiric_touch 36.8s|devouring_plague 24.0s|shadow_word_insanity 21.4s|shadow_word_death 17.9s|halo 13.0s|shadowfiend 2.4s|dispersion 0.0s|waiting 2.2s&chtt=priest_90_di_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi_no4PT14 101285
devouring_plague 6413 (17979) 6.3% (17.8%) 20.2 23.26sec 400504 337182 117881 243981 142846 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 0.00 0.00 1.1878 0.0000 2886417.10 2886417.10 0.00 337181.71 337181.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 16.21 80.20% 117881.10 107519 143944 117918.94 110810 125145 1910340 1910340 0.00
crit 4.00 19.80% 243980.90 221488 296525 241316.42 0 296525 976077 976077 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2766 2.7% 52.2 8.62sec 23850 0 19677 40759 23880 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.19 52.12 0.00 0.00 0.0000 0.0000 1244726.04 1244726.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.73 80.06% 19676.82 17856 23904 19682.64 18696 21120 821127 821127 0.00
crit 10.39 19.94% 40759.29 36784 49242 40770.25 36784 46133 423599 423599 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8800 8.7% 20.2 23.26sec 196056 0 0 0 0 0.0% 0.0% 0.0% 0.0% 166.7 19592 40558 23760 19.9% 0.0% 27.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 166.73 166.73 0.0000 0.7532 3961555.16 3961555.16 0.00 31547.57 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 20.21 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 133.6 80.12% 19591.79 17856 27905 19597.03 18809 20487 2617043 2617043 0.00
crit 33.2 19.88% 40558.27 36784 57484 40564.56 38097 44119 1344512 1344512 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3533) 0.0% (3.5%) 11.1 41.99sec 143376 121937 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 1.1759 0.0000 0.00 0.00 0.00 121936.62 121936.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.89 80.17% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.83% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3533 3.5% 11.1 41.99sec 143376 0 118046 244543 143374 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 0.0000 0.0000 1590053.50 1590053.50 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.87 79.98% 118045.93 109581 139821 118064.27 110474 126491 1046999 1046999 0.00
crit 2.22 20.02% 244543.28 225736 288030 222440.74 0 288030 543054 543054 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.99sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.09 232.55 0.00 0.00 0.0000 0.0000 0.00 45678827.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 178.93 76.94% 0.00 0 0 0.00 0 0 0 28187233 100.00
crit 53.62 23.06% 0.00 0 0 0.00 0 0 0 17491594 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 13041 12.9% 51.2 8.83sec 114650 96520 94482 195678 114649 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.23 51.23 0.00 0.00 1.1878 0.0000 5873073.94 5873073.94 0.00 96520.41 96520.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 41.02 80.07% 94482.49 86183 115909 94504.79 91435 98358 3875394 3875394 0.00
crit 10.21 19.93% 195678.26 177536 238773 195757.99 177536 223517 1997680 1997680 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18646 (24489) 18.4% (24.2%) 123.0 3.61sec 89666 50009 0 0 0 0.0% 0.0% 0.0% 0.0% 275.9 25099 52004 30444 19.9% 0.0% 45.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.02 123.02 275.89 275.89 1.7930 0.7413 8399186.05 8399186.05 0.00 50009.19 50009.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 221.1 80.13% 25099.10 22887 30640 25105.16 24520 25812 5548769 5548769 0.00
crit 54.8 19.87% 52004.21 47146 63119 52016.56 49857 54340 2850417 2850417 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5843 5.8% 86.5 5.08sec 30409 0 25101 52023 30428 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.53 86.47 0.00 0.00 0.0000 0.0000 2631190.01 2631190.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.36 80.21% 25100.78 22887 30640 25106.52 24088 26327 1741110 1741110 0.00
crit 17.11 19.79% 52023.35 47146 63119 52030.96 48090 56490 890080 890080 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3831 3.8% 15.0 4.88sec 115082 96340 94649 196219 115085 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.01 15.01 0.00 0.00 1.1946 0.0000 1727481.30 1727481.30 0.00 96340.49 96340.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.99 79.88% 94648.86 83662 112752 94729.52 87895 104696 1134944 1134944 0.00
crit 3.02 20.12% 196219.17 172343 232270 189245.06 0 232270 592537 592537 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 6893 6.8% 18.1 23.76sec 171967 145320 141656 293435 171964 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.11 18.11 0.00 0.00 1.1834 0.0000 3113487.65 3113487.65 0.00 145320.31 145320.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.49 80.03% 141655.59 128911 173880 141689.96 133325 151558 2052489 2052489 0.00
crit 3.62 19.97% 293435.35 265556 358194 287065.27 0 358194 1060999 1060999 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9464 (12411) 9.3% (12.2%) 42.2 10.64sec 132170 111208 0 0 0 0.0% 0.0% 0.0% 0.0% 219.3 14708 30436 19407 29.9% 0.0% 88.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.22 42.22 219.28 219.28 1.1885 1.8259 4255608.82 4255608.82 0.00 12385.25 111208.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.22 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.8 70.12% 14707.82 13422 17966 14710.96 14300 15336 2261534 2261534 0.00
crit 65.5 29.88% 30435.56 27649 37009 30442.37 29149 32070 1994075 1994075 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2947 2.9% 68.6 6.46sec 19300 0 14648 30299 19314 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.64 68.59 0.00 0.00 0.0000 0.0000 1324715.36 1324715.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.14 70.19% 14648.01 13422 17966 14649.97 14004 15280 705132 705132 0.00
crit 20.45 29.81% 30298.61 27649 37009 30306.06 28361 32686 619584 619584 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2227 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3651 3.6% 76.1 5.85sec 21604 0 18277 36773 21957 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.05 74.83 0.00 0.00 0.0000 0.0000 1643116.73 1643116.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.94 80.10% 18276.62 16669 22484 18279.70 17518 18978 1095536 1095536 0.00
crit 14.89 19.90% 36773.28 33338 44968 36780.36 33681 40430 547580 547580 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8585 (11251) 8.5% (11.1%) 30.9 14.63sec 163700 137763 0 0 0 0.0% 0.0% 0.0% 0.0% 192.1 16581 34361 20127 19.9% 0.0% 96.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.95 30.95 192.06 192.06 1.1883 2.2583 3865696.07 3865696.07 0.00 10767.89 137762.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.8 80.05% 16580.70 15001 20366 16586.08 16010 17212 2549290 2549290 0.00
crit 38.3 19.95% 34360.95 30902 41955 34370.73 32669 36913 1316406 1316406 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2666 2.6% 60.2 7.31sec 19960 0 16465 34128 19977 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.15 60.10 0.00 0.00 0.0000 0.0000 1200662.43 1200662.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.16 80.12% 16464.89 15001 20366 16468.63 15730 17372 792879 792879 0.00
crit 11.95 19.88% 34127.84 30902 41955 34137.17 30902 38301 407784 407784 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52882 / 4205
melee 52882 4.1% 33.3 11.79sec 56161 55475 48879 98711 56161 20.4% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.32 33.32 0.00 0.00 1.0124 0.0000 1871109.67 1871109.67 0.00 55474.80 55474.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.52 55.58% 48878.82 38145 58728 48894.77 44607 54784 905063 905063 0.00
crit 6.81 20.43% 98710.60 76291 117456 98632.22 0 117456 671776 671776 0.00
glance 7.99 24.00% 36808.18 28609 44046 36804.42 0 44046 294271 294271 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1929 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.02%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 13.9 0.5 29.9sec 28.7sec 5.49% 26.59%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:5.49%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.25%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.60% 43.97%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.60%

    Trigger Attempt Success

    • trigger_pct:2.20%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.73% 41.73%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.73%

    Trigger Attempt Success

    • trigger_pct:14.94%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.74% 49.51%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.74%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.63%

Buff details

  • buff initial source:priest_90_di_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi_no4PT14
devouring_plague Shadow Orb 20.2 60.6 3.0 3.0 133499.5
halo Mana 11.1 449148.2 40500.0 40499.9 3.5
mind_blast Mana 51.2 326626.6 6376.1 6376.2 18.0
mind_flay Mana 123.0 369043.7 3000.0 3000.0 29.9
shadow_word_death Mana 15.0 117088.6 7800.0 7800.2 14.8
shadow_word_insanity Mana 18.1 135790.8 7500.0 7500.1 22.9
shadow_word_pain Mana 42.2 557316.7 13200.0 13200.1 10.0
vampiric_touch Mana 30.9 278542.1 9000.0 9000.0 18.2
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.02 368.64 (0.02%) 18000.00 0.00 0.00%
shadowfiend Mana 33.32 245441.86 (11.96%) 7366.91 54409.34 18.15%
Shadow Orbs from Mind Blast Shadow Orb 51.23 51.23 (87.11%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.58 7.58 (12.89%) 1.00 0.00 0.00%
Devouring Plague Health Health 218.86 0.00 (-nan%) 0.00 3039176.81 100.00%
Vampiric Touch Mana Mana 252.17 1283162.93 (62.50%) 5088.57 49519.15 3.72%
mp5_regen Mana 1801.40 523988.78 (25.52%) 290.88 16430.26 3.04%
Resource RPS-Gain RPS-Loss
Mana 4557.33 4958.22
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 119406.24 900.00 300000.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.1%
shadowfiend-Mana Cap 3.1%
lightwell-Mana Cap 3.1%

Procs

Count Interval
Shadowy Recall Extra Tick 267.3 1.7sec
Shadowy Apparition Procced 76.1 5.8sec
Divine Insight Mind Blast CD Reset 25.4 28.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_di_swi_no4PT14 Damage Per Second
Count 49992
Mean 101284.66
Minimum 94082.91
Maximum 110739.62
Spread ( max - min ) 16656.71
Range [ ( max - min ) / 2 * 100% ] 8.22%
Standard Deviation 2064.3934
5th Percentile 97983.55
95th Percentile 104751.78
( 95th Percentile - 5th Percentile ) 6768.23
Mean Distribution
Standard Deviation 9.2330
95.00% Confidence Intervall ( 101266.56 - 101302.76 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1595
0.1 Scale Factor Error with Delta=300 36380
0.05 Scale Factor Error with Delta=300 145521
0.01 Scale Factor Error with Delta=300 3638049
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 101284.66
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43716970.17
Distribution Chart

DTPS

Sample Data priest_90_di_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 270.45
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.64 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.01 shadow_word_death,if=active_enemies<=5
F 51.70 mind_blast,if=active_enemies<=6&cooldown_react
G 22.60 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.12 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.11 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.09 halo,if=talent.halo.enabled
M 15.57 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.48 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 15.30 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.22 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 19.62 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTHIGFMTFTFHTIGTFMTLWWWWFHTFTHIGQFMTQFHTIGTLFTHTFIGMTQFHTIGFTHTFLMWWWWWWFHTFTHFIGMTQFTHFTLIGTFMQQFTBHTFIGTHQFMTIFGTHLTFWWWWFWWTHTFMTFGHQQQQFTFHLMIGTQFTFHTIGFMTHQFTIGTFTHLTWWWFMTHTFTIGTFHTFIGMLHTFTFIGHTFMBTFHGTQFTEDEHLQFIGTEETFHMTEEFIGTEDEFHTIEEFG9LHMTEEFTIEDEFGHTPEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no2PT14 : 101026 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
101025.7 101025.7 17.61 / 0.02% 3315 / 3.3% 21.1 4585.1 4395.5 Mana 0.43% 37.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:351901|149443|126917|124407|99573|99038|83338|51961&chds=0,703802&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++351901++devouring_plague,9482C9,0,0,15|t++149443++vampiric_touch,9482C9,1,0,15|t++126917++halo,9482C9,2,0,15|t++124407++shadow_word_pain,9482C9,3,0,15|t++99573++shadow_word_death,9482C9,4,0,15|t++99038++mind_blast,9482C9,5,0,15|t++83338++mind_spike,4A79D3,6,0,15|t++51961++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,13,10,9,9,8,6,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:78643211zyxxxwwvuusrpollkjjihhhhgfeedcaaZYXXXYYYYYYZYZYXXXWWWWXXXXXXXXWWWWWXYYYYYZZYYYXXXWXXXXWWWVVVVWWXXYZaabbbbbbaabbbbbaaZZYYYYYZZZZZaaZZYYZZYYYZZYYXXXXXYYYYZZZZZaaaaaZZZZZaaaaaaabbbbbccccddddccbbaaZYYYYXXWWWVVWWWWWWXXXYYYXYYYYYZZZYYYYZZZaabbccccddddddeddddccbaZZYYYYYYYYYYYYXXXXXXXXXYYXXWWWVVUUUUVVVVWWWWWWWWWWXXXYYYYYYYYYYYZZZaabbbcccccccccccccbbbbbccdefghijjkkkkklllllkkjihggfeedddcccbbbbbbccccccccbbbbbbcccccccccccccccccccccccccdddeeefffgggggghhhhhhhhhhhgggfffffffeeeeeeeeeeffffgghhhiijjjkkkkkkkkkjjjiiiiihhhgggggffeeeeeeeeedddddeedddeeeffff&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4670,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=101026|max=216328&chxp=1,1,47,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,40,32,64,96,136,264,448,704,600,784,1104,1472,1936,1864,2264,2600,2552,2800,2960,3048,3064,2888,2760,2672,2176,2048,1584,1336,1088,1144,840,608,496,328,336,296,104,136,120,40,40,40,8,8,16,0,16,0,8&chds=0,3064&chbh=5&chxt=x&chxl=0:|min=94748|avg=101026|max=109787&chxp=0,1,42,100&chtt=priest_90_pi_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.1,12.2,10.4,9.9,7.8,4.9,3.9,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 212.0s|mind_blast 55.0s|shadow_word_pain 46.7s|mind_spike 44.5s|vampiric_touch 35.1s|devouring_plague 21.9s|shadow_word_death 17.6s|halo 12.7s|shadowfiend 2.4s|waiting 1.9s&chtt=priest_90_pi_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no2PT14 101026
devouring_plague 6027 (17103) 6.0% (16.9%) 19.0 24.78sec 405323 351901 117806 244019 142876 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.00 19.00 0.00 0.00 1.1518 0.0000 2714325.55 2714325.55 0.00 351900.97 351900.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.22 80.14% 117806.10 107519 143944 117844.24 111813 125710 1793544 1793544 0.00
crit 3.77 19.86% 244018.93 221488 296525 240589.15 0 296525 920782 920782 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2648 2.6% 49.9 9.02sec 23880 0 19692 40791 23911 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.93 49.87 0.00 0.00 0.0000 0.0000 1192411.92 1192411.92 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.90 80.01% 19691.97 17856 23904 19698.35 18655 21021 785701 785701 0.00
crit 9.97 19.99% 40791.27 36784 49242 40803.23 36784 49242 406711 406711 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8427 8.3% 19.0 24.78sec 199683 0 0 0 0 0.0% 0.0% 0.0% 0.0% 159.8 19581 40518 23736 19.8% 0.0% 25.9%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.00 19.00 159.82 159.82 0.0000 0.7289 3793559.52 3793559.52 0.00 32564.98 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 128.1 80.16% 19581.04 17856 23904 19587.18 18773 20360 2508532 2508532 0.00
crit 31.7 19.84% 40518.09 36784 49242 40526.83 38260 43430 1285028 1285028 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3569) 0.0% (3.5%) 11.2 41.61sec 143343 126917 0 0 0 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 0.00 0.00 1.1295 0.0000 0.00 0.00 0.00 126917.14 126917.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.99 80.18% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.82% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3569 3.5% 11.2 41.61sec 143343 0 118220 244614 143345 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 0.00 0.00 0.0000 0.0000 1606390.23 1606390.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.12% 118220.15 109581 139821 118237.34 110653 126196 1061506 1061506 0.00
crit 2.23 19.88% 244613.86 225736 288030 223291.45 0 288030 544885 544885 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.61sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.21 238.52 0.00 0.00 0.0000 0.0000 0.00 46891825.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.58 76.97% 0.00 0 0 0.00 0 0 0 28953777 100.00
crit 54.94 23.03% 0.00 0 0 0.00 0 0 0 17938049 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12103 12.0% 47.5 9.54sec 114752 99038 94591 195893 114752 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.50 47.50 0.00 0.00 1.1587 0.0000 5450978.37 5450978.37 0.00 99038.47 99038.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.05 80.10% 94590.84 86183 115909 94617.00 91520 98461 3599005 3599005 0.00
crit 9.45 19.90% 195892.81 177536 238773 195957.22 177536 221320 1851973 1851973 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18625 (24457) 18.5% (24.2%) 122.4 3.63sec 90009 51961 0 0 0 0.0% 0.0% 0.0% 0.0% 273.8 25222 52279 30644 20.0% 0.0% 43.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.41 122.41 273.82 273.82 1.7323 0.7140 8390820.27 8390820.27 0.00 51960.85 51960.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.41 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 219.0 79.96% 25222.37 22887 30640 25229.94 24597 25931 5522541 5522541 0.00
crit 54.9 20.04% 52278.63 47146 63119 52295.20 50029 55483 2868279 2868279 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5832 5.8% 85.8 5.13sec 30627 0 25231 52314 30647 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.79 85.73 0.00 0.00 0.0000 0.0000 2627426.43 2627426.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.59 80.00% 25230.65 22887 30640 25238.05 24185 26345 1730549 1730549 0.00
crit 17.14 20.00% 52314.16 47146 63119 52332.74 48141 57528 896877 896877 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8224 8.1% 38.6 11.29sec 96082 83338 79237 164241 96081 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.56 38.56 0.00 0.00 1.1529 0.0000 3705136.96 3705136.96 0.00 83338.29 83338.29
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.92 80.18% 79237.04 72412 97688 79255.05 74749 84223 2450054 2450054 0.00
crit 7.64 19.82% 164240.84 149169 201238 164107.66 0 201238 1255083 1255083 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.02sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3893 3.9% 15.2 4.83sec 115406 99573 94685 196394 115405 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.21 15.21 0.00 0.00 1.1590 0.0000 1755368.54 1755368.54 0.00 99572.78 99572.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.11 79.63% 94684.66 83662 112752 94757.92 86653 103545 1146793 1146793 0.00
crit 3.10 20.37% 196393.62 172343 232270 190025.92 0 232270 608576 608576 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9857 (12915) 9.7% (12.8%) 40.6 11.08sec 143135 124407 0 0 0 0.0% 0.0% 0.0% 0.0% 247.0 14782 30631 17952 20.0% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.58 40.58 246.96 246.96 1.1505 1.7990 4433375.57 4433375.57 0.00 11831.38 124407.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 197.6 80.00% 14781.97 13422 17966 14785.92 14309 15356 2920366 2920366 0.00
crit 49.4 20.00% 30631.16 27649 37009 30637.93 28974 32622 1513009 1513009 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3057 3.0% 77.3 5.75sec 17786 0 14680 30396 17800 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.33 77.27 0.00 0.00 0.0000 0.0000 1375334.94 1375334.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.93 80.15% 14679.56 13422 17966 14682.34 14041 15390 909058 909058 0.00
crit 15.34 19.85% 30395.82 27649 37009 30406.62 28064 33195 466277 466277 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.86sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2190 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2906 2.9% 60.4 7.35sec 21651 0 18320 36864 22012 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.40 59.40 0.00 0.00 0.0000 0.0000 1307629.23 1307629.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.58 80.09% 18320.18 16669 22484 18323.04 17441 19289 871623 871623 0.00
crit 11.83 19.91% 36863.95 33338 44968 36871.45 33338 41780 436007 436007 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8873 (11644) 8.8% (11.5%) 30.2 15.02sec 173623 149443 0 0 0 0.0% 0.0% 0.0% 0.0% 199.1 16545 34283 20070 19.9% 0.0% 95.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.20 30.20 199.11 199.11 1.1618 2.1628 3996089.05 3996089.05 0.00 11259.33 149442.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.5 80.13% 16544.77 15001 20366 16548.87 16057 17235 2639626 2639626 0.00
crit 39.6 19.87% 34282.51 30902 41955 34291.03 32312 36576 1356463 1356463 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2771 2.7% 62.4 7.07sec 19993 0 16492 34175 20010 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.41 62.36 0.00 0.00 0.0000 0.0000 1247706.58 1247706.58 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.95 80.11% 16492.32 15001 20366 16495.90 15827 17293 823835 823835 0.00
crit 12.40 19.89% 34175.39 30902 41955 34176.88 30902 38473 423871 423871 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52993 / 4212
melee 52993 4.1% 33.3 11.80sec 56238 55642 49008 99030 56238 20.3% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.33 33.33 0.00 0.00 1.0107 0.0000 1874477.18 1874477.18 0.00 55642.28 55642.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.50 55.52% 49007.88 38145 58728 49019.49 44076 55890 906892 906892 0.00
crit 6.78 20.33% 99030.34 76291 117456 98951.94 0 117456 670928 670928 0.00
glance 8.05 24.15% 36846.82 28609 44046 36855.45 0 44046 296657 296657 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1298 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.87%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:16.09%
glyph_mind_spike 27.4 11.2 16.0sec 11.3sec 37.54% 54.54%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:29.21%
  • glyph_mind_spike_2:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.1sec 20.1sec 44.63% 45.18%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.63%

    Trigger Attempt Success

    • trigger_pct:2.17%
light_of_the_cosmos 9.6 0.0 48.9sec 48.9sec 41.92% 41.92%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.92%

    Trigger Attempt Success

    • trigger_pct:14.85%
power_infusion 4.3 0.0 121.0sec 121.0sec 18.58% 21.28%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.1sec 10.1sec 9.85% 49.45%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 33.3 6.1 13.2sec 11.1sec 20.59% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:18.84%
  • surge_of_darkness_2:1.75%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.50%

Buff details

  • buff initial source:priest_90_pi_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no2PT14
devouring_plague Shadow Orb 19.0 57.0 3.0 3.0 135107.7
halo Mana 11.2 422213.5 37675.6 37675.5 3.8
mind_blast Mana 47.5 410333.8 8638.2 8638.2 13.3
mind_flay Mana 122.4 351845.2 2874.3 2874.3 31.3
shadow_word_death Mana 15.2 114179.5 7506.4 7506.7 15.4
shadow_word_pain Mana 40.6 506150.1 12472.0 12472.2 11.5
vampiric_touch Mana 30.2 260744.8 8633.2 8633.3 20.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.33 203941.68 (10.30%) 6118.67 96037.68 32.01%
Shadow Orbs from Mind Blast Shadow Orb 47.50 47.50 (86.07%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.69 7.69 (13.93%) 1.00 0.00 0.00%
Devouring Plague Health Health 209.70 0.00 (-nan%) 0.00 2911982.12 100.00%
Vampiric Touch Mana Mana 261.47 1269563.04 (64.12%) 4855.51 112177.44 8.12%
mp5_regen Mana 1801.40 506549.21 (25.58%) 281.20 33869.83 6.27%
Resource RPS-Gain RPS-Loss
Mana 4395.48 4585.08
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 214589.23 87540.00 300000.00
Shadow Orb 1.20 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
lightwell-Mana Cap 6.4%

Procs

Count Interval
Shadowy Recall Extra Tick 275.2 1.6sec
Shadowy Apparition Procced 60.4 7.3sec
FDCL Mind Spike proc 39.3 11.1sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 101025.67
Minimum 94747.67
Maximum 109786.62
Spread ( max - min ) 15038.95
Range [ ( max - min ) / 2 * 100% ] 7.44%
Standard Deviation 2008.6596
5th Percentile 97794.97
95th Percentile 104425.79
( 95th Percentile - 5th Percentile ) 6630.83
Mean Distribution
Standard Deviation 8.9837
95.00% Confidence Intervall ( 101008.06 - 101043.28 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1518
0.1 Scale Factor Error with Delta=300 34442
0.05 Scale Factor Error with Delta=300 137770
0.01 Scale Factor Error with Delta=300 3444263
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 101025.67
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43596553.17
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 283.97
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 3.79 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.21 shadow_word_death,if=active_enemies<=5
F 47.74 mind_blast,if=active_enemies<=6&cooldown_react
G 22.05 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.54 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 4.01 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.21 halo,if=talent.halo.enabled
M 15.21 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.91 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.73 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 34.55 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.20 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 18.53 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTGHFMRTFTHTGFTLWWWWWWFHMTFRTHTGTFRTHFMTLRGTFRTHTFTGHFMTCFRTHTGLFWWWRWWWQFMHTRTFTGHFTFHLJMGJRFTBHTFTGTFHMJRTRQFRTGHFJLRWWWWFMTHRTFRTGHCFTFMRTHLTGFRTFHTGFMTHTRTFTRTGRHFLWWWWRWFMHRTRTFTRTGFHTFMTHJLRFGRTRTFHTBCFGMTHRTFTRTEEGFJHLDPEEQFTRHEDEFGRTEEFHMRTEEFGT9HLPEDEFRTPEEFGHMTEEFRR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl_no4PT14 : 103234 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103234.4 103234.4 17.58 / 0.02% 3290 / 3.2% 21.6 4584.7 4394.0 Mana 0.43% 37.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:352131|149391|135381|126959|99517|98985|83485|51911&chds=0,704262&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++352131++devouring_plague,9482C9,0,0,15|t++149391++vampiric_touch,9482C9,1,0,15|t++135381++shadow_word_pain,9482C9,2,0,15|t++126959++halo,9482C9,3,0,15|t++99517++shadow_word_death,9482C9,4,0,15|t++98985++mind_blast,9482C9,5,0,15|t++83485++mind_spike,4A79D3,6,0,15|t++51911++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,12,11,9,9,8,6,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadowfiend: melee|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:78643211zyyxxwwvvutsqomllkjjiihhgfffdcbaZZYYYYYYYZZZZZZYXXXXXXXYYYYYXXXWWXXXYYZZZZZZYYYXXXXXXXXXWWWVWWXXYYZabbbbbbbbbbbccbbaaZZYZZZZZZaaaaaZZZZZZZZZZYYYYYXYYYZZZZaaaaaaaaaZZaaaaaabbbbbcccccccddddccbbbaZZYYYXXXWWWVWWWXXXXXYYYYYYYYZZZZZZYZZZZZabbbccddddeeeeeeedddcbaaZYYYYYYYYYYYYYYXXXYYYYYYYXXWWWVVUVVVVVWWWWWXXXXXXXXXYYYYYYYYYYZZZaabbbccccccccccccccccbbbcddefghijkkkkklllllllkjiihgffedddddcccccccccccccccccccbcccccdddddddddddddddddddddddeeefffgggggghhhhhiiiiihhhggggffffffffeeeeeeffffggghhhiijjkkkkkkkkkkkjjjjiiiihhhhggggfffeeeeeeeeeeeeeeeeeeeeffff&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4734,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=103234|max=218080&chxp=1,1,47,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,16,16,48,48,136,120,280,328,424,568,880,976,1184,1448,1800,2120,1992,2464,2680,2736,2624,2760,2736,2752,2592,2560,2200,1888,1816,1464,1072,1120,896,752,624,480,368,224,192,136,120,152,48,32,48,16,8,16,8&chds=0,2760&chbh=5&chxt=x&chxl=0:|min=96759|avg=103234|max=110894&chxp=0,1,46,100&chtt=priest_90_pi_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.1,12.2,10.4,9.8,7.8,4.9,3.9,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 212.3s|mind_blast 55.0s|shadow_word_pain 46.7s|mind_spike 44.3s|vampiric_touch 35.1s|devouring_plague 21.9s|shadow_word_death 17.6s|halo 12.7s|shadowfiend 2.4s|waiting 1.9s&chtt=priest_90_pi_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl_no4PT14 103234
devouring_plague 6025 (17105) 5.8% (16.6%) 19.0 24.79sec 405475 352131 117829 243658 142841 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.99 0.00 0.00 1.1515 0.0000 2712668.69 2712668.69 0.00 352130.82 352130.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.22 80.12% 117829.20 107519 143944 117861.61 111103 125145 1792930 1792930 0.00
crit 3.77 19.88% 243657.95 221488 296525 239919.80 0 296525 919738 919738 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2653 2.6% 50.0 9.01sec 23864 0 19689 40794 23895 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.03 49.97 0.00 0.00 0.0000 0.0000 1194008.81 1194008.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.01 80.07% 19689.28 17856 23904 19696.10 18849 20992 787749 787749 0.00
crit 9.96 19.93% 40793.74 36784 49242 40807.10 0 46750 406260 406260 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8427 8.2% 19.0 24.79sec 199764 0 0 0 0 0.0% 0.0% 0.0% 0.0% 159.8 19576 40523 23747 19.9% 0.0% 25.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.99 18.99 159.76 159.76 0.0000 0.7287 3793719.23 3793719.23 0.00 32586.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.99 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 127.9 80.09% 19575.99 17856 23904 19581.73 18837 20518 2504731 2504731 0.00
crit 31.8 19.91% 40523.43 36784 49242 40533.21 38337 43173 1288988 1288988 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3570) 0.0% (3.5%) 11.2 41.61sec 143379 126959 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 0.00 0.00 1.1294 0.0000 0.00 0.00 0.00 126959.05 126959.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.11% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.23 19.89% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3570 3.5% 11.2 41.61sec 143379 0 118218 244693 143376 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.21 11.21 0.00 0.00 0.0000 0.0000 1607174.61 1607174.61 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.11% 118217.57 109581 139821 118233.13 110921 126491 1061519 1061519 0.00
crit 2.23 19.89% 244692.73 225736 288030 222306.25 0 288030 545655 545655 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.61sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.21 238.71 0.00 0.00 0.0000 0.0000 0.00 46938273.51 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 183.64 76.93% 0.00 0 0 0.00 0 0 0 28957833 100.00
crit 55.07 23.07% 0.00 0 0 0.00 0 0 0 17980440 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12089 11.7% 47.5 9.54sec 114678 98985 94584 195802 114678 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.48 47.48 0.00 0.00 1.1585 0.0000 5444781.45 5444781.45 0.00 98985.23 98985.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.05 80.15% 94584.06 86183 115909 94610.31 91237 98134 3599223 3599223 0.00
crit 9.43 19.85% 195801.90 177536 238773 195874.65 177536 225607 1845558 1845558 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18630 (24464) 18.1% (23.7%) 122.6 3.63sec 89907 51911 0 0 0 0.0% 0.0% 0.0% 0.0% 274.1 25217 52289 30617 19.9% 0.0% 43.4%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 122.56 122.56 274.11 274.11 1.7320 0.7140 8392267.24 8392267.24 0.00 51910.65 51910.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 122.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 219.4 80.06% 25217.45 22887 30640 25224.95 24478 26064 5533665 5533665 0.00
crit 54.7 19.94% 52289.13 47146 63119 52306.86 50144 54926 2858602 2858602 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5834 5.7% 85.8 5.14sec 30635 0 25230 52298 30654 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.76 85.70 0.00 0.00 0.0000 0.0000 2627169.49 2627169.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 68.53 79.96% 25229.73 22887 30640 25236.83 24159 26384 1728967 1728967 0.00
crit 17.17 20.04% 52298.24 47146 63119 52309.79 47618 57881 898202 898202 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8209 8.0% 38.4 11.33sec 96240 83485 79235 164323 96239 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.43 38.43 0.00 0.00 1.1528 0.0000 3698656.98 3698656.98 0.00 83485.47 83485.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.75 80.02% 79235.01 72412 97688 79259.80 75391 85466 2436581 2436581 0.00
crit 7.68 19.98% 164323.11 149169 201238 164290.09 0 201238 1262076 1262076 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 121.03sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3886 3.8% 15.2 4.83sec 115354 99517 94691 196353 115355 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.20 15.20 0.00 0.00 1.1592 0.0000 1752990.21 1752990.21 0.00 99516.90 99516.90
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.11 79.68% 94690.59 83662 112752 94774.51 87711 103179 1146515 1146515 0.00
crit 3.09 20.32% 196353.25 172343 232270 189942.54 0 232270 606475 606475 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10721 (14044) 10.4% (13.6%) 40.6 11.08sec 155728 135381 0 0 0 0.0% 0.0% 0.0% 0.0% 247.0 14781 30586 19520 30.0% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.56 40.56 247.02 247.02 1.1503 1.7988 4821817.72 4821817.72 0.00 12864.64 135381.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 173.0 70.02% 14781.43 13422 17966 14785.07 14308 15406 2556501 2556501 0.00
crit 74.1 29.98% 30585.52 27649 37009 30593.44 29236 32167 2265317 2265317 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3323 3.2% 77.3 5.75sec 19337 0 14677 30373 19351 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.30 77.24 0.00 0.00 0.0000 0.0000 1494671.37 1494671.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.24 70.22% 14677.10 13422 17966 14680.08 14145 15327 796048 796048 0.00
crit 23.00 29.78% 30373.03 27649 37009 30380.81 28411 32662 698623 698623 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2192 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 4017 3.9% 83.5 5.34sec 21645 0 18316 36844 22002 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.55 82.19 0.00 0.00 0.0000 0.0000 1808359.48 1808359.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.84 80.10% 18315.62 16669 22484 18319.25 17733 19040 1205849 1205849 0.00
crit 16.35 19.90% 36843.54 33338 44968 36851.94 34062 41225 602510 602510 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8871 (11634) 8.6% (11.3%) 30.2 15.03sec 173530 149391 0 0 0 0.0% 0.0% 0.0% 0.0% 199.1 16541 34273 20065 19.9% 0.0% 95.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.20 30.20 199.11 199.11 1.1616 2.1627 3995289.57 3995289.57 0.00 11251.91 149390.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.5 80.13% 16541.40 15001 20366 16545.62 16011 17193 2639026 2639026 0.00
crit 39.6 19.87% 34273.44 30902 41955 34282.04 32390 36881 1356263 1356263 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2763 2.7% 62.3 7.09sec 19992 0 16493 34177 20009 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.26 62.21 0.00 0.00 0.0000 0.0000 1244735.14 1244735.14 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.84 80.12% 16493.07 15001 20366 16497.18 15822 17229 822038 822038 0.00
crit 12.37 19.88% 34177.39 30902 41955 34193.31 31392 38794 422697 422697 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 53054 / 4217
melee 53054 4.0% 33.3 11.79sec 56296 55712 48979 98989 56297 20.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.33 33.33 0.00 0.00 1.0105 0.0000 1876548.86 1876548.86 0.00 55712.05 55712.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.53 55.58% 48978.58 38145 58728 48995.19 44080 54508 907370 907370 0.00
crit 6.82 20.45% 98988.64 76291 117456 98918.59 0 117456 674872 674872 0.00
glance 7.99 23.97% 36834.21 28609 44046 36828.70 0 44046 294307 294307 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.29sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1299 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.86%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:16.29%
glyph_mind_spike 27.3 11.1 16.1sec 11.3sec 37.46% 54.27%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:29.18%
  • glyph_mind_spike_2:8.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.3sec 20.2sec 44.46% 45.02%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.46%

    Trigger Attempt Success

    • trigger_pct:2.16%
light_of_the_cosmos 9.6 0.0 48.9sec 48.9sec 41.92% 41.92%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.92%

    Trigger Attempt Success

    • trigger_pct:14.86%
power_infusion 4.3 0.0 121.0sec 121.0sec 18.58% 21.28%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.1sec 10.1sec 9.84% 49.46%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.84%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 33.1 6.1 13.2sec 11.2sec 20.53% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:18.79%
  • surge_of_darkness_2:1.73%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.47%

Buff details

  • buff initial source:priest_90_pi_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl_no4PT14
devouring_plague Shadow Orb 19.0 57.0 3.0 3.0 135157.3
halo Mana 11.2 422254.9 37670.1 37670.0 3.8
mind_blast Mana 47.5 410161.8 8638.8 8638.8 13.3
mind_flay Mana 122.6 352311.5 2874.5 2874.5 31.3
shadow_word_death Mana 15.2 114082.2 7506.8 7507.1 15.4
shadow_word_pain Mana 40.6 505805.8 12470.4 12470.2 12.5
vampiric_touch Mana 30.2 260665.6 8632.3 8632.3 20.1
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.33 203502.18 (10.28%) 6104.99 96501.66 32.17%
Shadow Orbs from Mind Blast Shadow Orb 47.48 47.48 (86.07%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.68 7.68 (13.93%) 1.00 0.00 0.00%
Devouring Plague Health Health 209.73 0.00 (-nan%) 0.00 2912379.84 100.00%
Vampiric Touch Mana Mana 261.32 1269409.40 (64.13%) 4857.68 111888.52 8.10%
mp5_regen Mana 1801.40 506485.02 (25.59%) 281.16 33934.02 6.28%
Resource RPS-Gain RPS-Loss
Mana 4394.02 4584.67
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 214112.27 73440.00 300000.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.4%
shadowfiend-Mana Cap 6.4%
lightwell-Mana Cap 6.4%

Procs

Count Interval
Shadowy Recall Extra Tick 275.1 1.6sec
Shadowy Apparition Procced 83.5 5.3sec
FDCL Mind Spike proc 39.2 11.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 103234.42
Minimum 96758.90
Maximum 110894.00
Spread ( max - min ) 14135.10
Range [ ( max - min ) / 2 * 100% ] 6.85%
Standard Deviation 2005.6627
5th Percentile 100058.18
95th Percentile 106639.18
( 95th Percentile - 5th Percentile ) 6581.00
Mean Distribution
Standard Deviation 8.9703
95.00% Confidence Intervall ( 103216.84 - 103252.00 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1449
0.1 Scale Factor Error with Delta=300 34339
0.05 Scale Factor Error with Delta=300 137359
0.01 Scale Factor Error with Delta=300 3433993
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103234.42
Distribution Chart

Damage

Sample Data
Count 49992
Mean 44588309.99
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 283.88
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 3.79 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.20 shadow_word_death,if=active_enemies<=5
F 47.72 mind_blast,if=active_enemies<=6&cooldown_react
G 22.05 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.54 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 4.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.21 halo,if=talent.halo.enabled
M 15.20 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.88 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.78 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 34.43 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.28 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 18.51 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTRTFTGFHMTFTRTHTGFTLWWWWWWFHMTFTHRGTFTRTHFMRLTGTFTHTQFTGHFMTRRTFCRTHTGFLWWWWWWWFMHTQFRTGHQFTFMHRLTGQFTBHFTGTFMHTFTRTGHFJLRWWWQFMHTQFTGFCHRTRTFMRTHTFGLRTRTFTHTFGMRTRRHFTGFRTWLWWWWFHMTFTHTFGTRTHFMTLRTFGTHRTFTCRBFGHMTRTFTEEHFGLMTEEQFTHTEDEFGTHEEFMTPEEFGHL9RTEDEFTHREEFGMJRTEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no2PT14 : 102273 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
102272.9 102272.9 15.74 / 0.02% 2952 / 2.9% 19.2 4770.3 4678.4 Mana 0.46% 34.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:351135|150120|127089|114471|99393|98283|52248&chds=0,702270&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++351135++devouring_plague,9482C9,0,0,15|t++150120++vampiric_touch,9482C9,1,0,15|t++127089++halo,9482C9,2,0,15|t++114471++shadow_word_pain,9482C9,3,0,15|t++99393++shadow_word_death,9482C9,4,0,15|t++98283++mind_blast,9482C9,5,0,15|t++52248++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:24,12,11,11,10,9,8,6,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb_no2PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:667786553101100zzyxwutrpnllkijjkhgggecaaZXWWWXWXXYYYYZZZZZabbcdfffffeedccdccddddcccbaZYYYYYYYYXXWVVUTVWWXYZabbccccddefghhihggffdeedddddccbbbabbbaaZaaZZZZZZYZZaZZZZYXXYZZZZZZZZaaaaaaaaabcdddcccccccdddddccccbaZYXXWVWWWVVUUTTTUUUVVWXXXYYZZabdefghiiijjjjjjkkkkkjihgffedccbaaaaaZZYYXXXXXXXXXXWWXWWWVVVVVWXYYZZZaabccddddeedeeedddccbbbbaaabbbbcddddccccccccccccccccddeffghijkkllmmllllmllkkjihhggfedcccccdddddcccccccccccddddddddeeffghhiijjkkkkkllmmmlllllkkjjjiiiiijiiiiihhhgggggfffffffeffgghijklmnopqrrssstttssrrqponmmlkjiihhhhhhgggfffffffeefeeedddccccccccd&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5020,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=102273|max=203742&chxp=1,1,50,100&chtt=priest_90_pi_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,8,16,8,32,0,24,48,104,152,192,288,320,528,704,792,1224,1344,1712,1888,2088,2240,2800,2752,3024,2616,2880,3008,2720,2608,2160,2072,1712,1376,1392,992,1008,808,584,496,328,256,208,144,80,72,80,32,40,24&chds=0,3024&chbh=5&chxt=x&chxl=0:|min=95468|avg=102273|max=108483&chxp=0,1,52,100&chtt=priest_90_pi_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:55.4,11.5,11.4,7.8,4.6,3.9,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 249.6s|mind_blast 52.0s|shadow_word_pain 51.5s|vampiric_touch 35.1s|devouring_plague 20.9s|shadow_word_death 17.5s|halo 12.7s|mindbender 8.0s|waiting 2.1s&chtt=priest_90_pi_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no2PT14 102273
devouring_plague 5750 (16273) 5.6% (15.9%) 18.0 26.30sec 406443 351135 118212 244590 143653 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.03 18.03 0.00 0.00 1.1575 0.0000 2589846.57 2589846.57 0.00 351135.10 351135.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.40 79.87% 118212.42 107519 143944 118256.44 112591 126824 1702136 1702136 0.00
crit 3.63 20.13% 244590.28 221488 296525 240650.25 0 296525 887710 887710 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2520 2.5% 47.4 9.52sec 23942 0 19755 40936 23980 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.38 47.31 0.00 0.00 0.0000 0.0000 1134481.42 1134481.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.87 80.05% 19754.80 17856 23904 19762.61 18752 20998 748118 748118 0.00
crit 9.44 19.95% 40936.20 36784 49242 40951.93 0 48137 386363 386363 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8003 7.8% 18.0 26.30sec 199861 0 0 0 0 0.0% 0.0% 0.0% 0.0% 151.2 19643 40670 23836 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.03 18.03 151.16 151.16 0.0000 0.7323 3603159.23 3603159.23 0.00 32547.98 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.03 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.0 80.06% 19643.37 17856 23904 19650.61 18906 20699 2377250 2377250 0.00
crit 30.1 19.94% 40670.11 36784 49242 40680.38 37722 43642 1225909 1225909 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3576) 0.0% (3.5%) 11.2 41.51sec 143336 127089 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 11.23 0.00 0.00 1.1279 0.0000 0.00 0.00 0.00 127089.18 127089.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.03 80.35% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 19.65% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3576 3.5% 11.2 41.51sec 143336 0 118213 244592 143336 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 11.23 0.00 0.00 0.0000 0.0000 1610092.87 1610092.87 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 9.00 80.12% 118213.38 109581 139821 118219.77 110653 128571 1063920 1063920 0.00
crit 2.23 19.88% 244592.04 225736 288030 223798.84 0 288030 546173 546173 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.51sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.23 240.14 0.00 0.00 0.0000 0.0000 0.00 47214790.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.77 76.94% 0.00 0 0 0.00 0 0 0 29136399 100.00
crit 55.37 23.06% 0.00 0 0 0.00 0 0 0 18078391 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11343 11.1% 44.6 10.18sec 114592 98283 94517 195729 114592 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.60 44.60 0.00 0.00 1.1660 0.0000 5110725.87 5110725.87 0.00 98283.19 98283.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.75 80.16% 94516.58 86183 115909 94543.00 91146 97916 3379228 3379228 0.00
crit 8.85 19.84% 195729.46 177536 238773 195816.79 177536 222754 1731498 1731498 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 22044 (28945) 21.6% (28.3%) 141.9 3.14sec 91915 52248 0 0 0 0.0% 0.0% 0.0% 0.0% 324.6 25203 52238 30595 19.9% 0.0% 51.5%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.88 141.88 324.63 324.63 1.7592 0.7153 9931908.65 9931908.65 0.00 52247.60 52247.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 259.9 80.05% 25202.66 22887 30640 25210.45 24572 25793 6549615 6549615 0.00
crit 64.7 19.95% 52237.74 47146 63119 52255.42 49969 54968 3382293 3382293 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6901 6.8% 101.6 4.34sec 30588 0 25202 52239 30608 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.65 101.58 0.00 0.00 0.0000 0.0000 3109196.77 3109196.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.27 80.00% 25201.67 22887 30640 25209.31 24262 26366 2048138 2048138 0.00
crit 20.31 20.00% 52239.10 47146 63119 52262.01 48176 56651 1061059 1061059 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.1550 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3860 3.8% 15.1 4.85sec 115258 99393 94693 196442 115256 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.10 15.10 0.00 0.00 1.1597 0.0000 1740379.57 1740379.57 0.00 99393.46 99393.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.05 79.79% 94693.26 83662 112752 94775.06 86186 103390 1140863 1140863 0.00
crit 3.05 20.21% 196442.48 172343 232270 189506.87 0 232270 599516 599516 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10011 (13118) 9.8% (12.8%) 44.8 10.02sec 131706 114471 0 0 0 0.0% 0.0% 0.0% 0.0% 251.0 14778 30623 17937 19.9% 0.0% 98.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.79 44.79 250.96 250.96 1.1506 1.7726 4501528.81 4501528.81 0.00 11882.77 114470.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 200.9 80.06% 14778.40 13422 17966 14781.90 14383 15312 2969451 2969451 0.00
crit 50.0 19.94% 30622.99 27649 37009 30629.37 29128 32613 1532078 1532078 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3107 3.0% 78.5 5.66sec 17798 0 14677 30403 17810 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.49 78.43 0.00 0.00 0.0000 0.0000 1396924.43 1396924.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.80 80.07% 14677.24 13422 17966 14679.55 14177 15252 921776 921776 0.00
crit 15.63 19.93% 30403.14 27649 37009 30409.45 28064 33295 475149 475149 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2926 2.9% 60.8 7.30sec 21650 0 18321 36850 22010 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.80 59.81 0.00 0.00 0.0000 0.0000 1316328.98 1316328.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.90 80.09% 18320.63 16669 22484 18323.08 17545 19146 877491 877491 0.00
crit 11.91 19.91% 36849.65 33338 44968 36857.52 33338 41436 438838 438838 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8931 (11700) 8.7% (11.4%) 30.2 15.03sec 174526 150120 0 0 0 0.0% 0.0% 0.0% 0.0% 199.6 16599 34418 20152 19.9% 0.0% 95.6%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.19 30.19 199.56 199.56 1.1626 2.1574 4021623.57 4021623.57 0.00 11313.86 150120.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.19 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.8 80.06% 16599.24 15001 20366 16604.00 16017 17222 2652054 2652054 0.00
crit 39.8 19.94% 34417.81 30902 41955 34426.33 32645 37100 1369570 1369570 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2769 2.7% 62.3 7.08sec 20000 0 16493 34191 20017 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.33 62.27 0.00 0.00 0.0000 0.0000 1246538.96 1246538.96 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.87 80.09% 16492.86 15001 20366 16496.57 15803 17348 822543 822543 0.00
crit 12.40 19.91% 34190.78 30902 41955 34193.58 30902 39036 423996 423996 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40566 / 10530
melee 40566 10.3% 107.4 4.09sec 44068 41427 38474 77581 44068 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.43 107.43 0.00 0.00 1.0638 0.0000 4734036.50 4734036.50 0.00 41426.70 41426.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.00 55.85% 38473.72 30516 46982 38491.45 36398 41057 2308419 2308419 0.00
crit 21.66 20.16% 77581.00 61032 93964 77605.56 70862 84400 1680238 1680238 0.00
glance 25.77 23.99% 28927.24 22887 35237 28939.33 26399 31611 745379 745379 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1267 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.85%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.13% 20.13%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.13%

    Trigger Attempt Success

    • trigger_pct:16.50%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.3sec 20.1sec 44.54% 45.10%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.54%

    Trigger Attempt Success

    • trigger_pct:2.16%
light_of_the_cosmos 9.7 0.0 48.7sec 48.7sec 42.04% 42.04%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.04%

    Trigger Attempt Success

    • trigger_pct:14.88%
power_infusion 4.3 0.0 121.1sec 121.1sec 18.56% 21.51%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.80% 49.52%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.39% 83.93%

Buff details

  • buff initial source:priest_90_pi_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no2PT14
devouring_plague Shadow Orb 18.0 54.1 3.0 3.0 135479.8
halo Mana 11.2 422507.7 37613.2 37613.1 3.8
mind_blast Mana 44.6 385843.4 8651.4 8651.4 13.2
mind_flay Mana 141.9 408237.0 2877.3 2877.3 31.9
shadow_word_death Mana 15.1 113423.5 7511.3 7511.6 15.3
shadow_word_pain Mana 44.8 558426.3 12469.0 12469.0 10.6
vampiric_touch Mana 30.2 260484.5 8629.4 8629.4 20.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.43 397773.07 (18.87%) 3702.78 72853.36 15.48%
Shadow Orbs from Mind Blast Shadow Orb 44.60 44.60 (85.40%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.62 7.62 (14.60%) 1.00 0.00 0.00%
Devouring Plague Health Health 198.47 0.00 (-nan%) 0.00 2756085.49 100.00%
Vampiric Touch Mana Mana 261.84 1220941.75 (57.93%) 4663.02 163247.69 11.79%
mp5_regen Mana 1801.40 488767.13 (23.19%) 271.33 51651.91 9.56%
Resource RPS-Gain RPS-Loss
Mana 4678.35 4770.35
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 258554.96 168552.38 300000.00
Shadow Orb 1.14 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.6%
shadowfiend-Mana Cap 9.6%
lightwell-Mana Cap 9.6%

Procs

Count Interval
Shadowy Recall Extra Tick 289.6 1.5sec
Shadowy Apparition Procced 60.8 7.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no2PT14 Damage Per Second
Count 49992
Mean 102272.88
Minimum 95468.50
Maximum 108483.13
Spread ( max - min ) 13014.64
Range [ ( max - min ) / 2 * 100% ] 6.36%
Standard Deviation 1795.9275
5th Percentile 99402.07
95th Percentile 105305.93
( 95th Percentile - 5th Percentile ) 5903.86
Mean Distribution
Standard Deviation 8.0323
95.00% Confidence Intervall ( 102257.14 - 102288.62 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1184
0.1 Scale Factor Error with Delta=300 27533
0.05 Scale Factor Error with Delta=300 110133
0.01 Scale Factor Error with Delta=300 2753349
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 102272.88
Distribution Chart

Damage

Sample Data
Count 49992
Mean 41312735.72
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 255.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.92 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.90 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.10 shadow_word_death,if=active_enemies<=5
F 45.46 mind_blast,if=active_enemies<=6&cooldown_react
G 22.06 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.48 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.23 halo,if=talent.halo.enabled
M 14.13 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.54 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.02 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 67.42 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 22.73 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTGHFMTQFTHTFGTLWWWWWFHMTAFTHTGTQFTHQFMTLTGTFTHTFTGTHQFMTCFATHGLTWWWWWWWFTHTQFMTGFHTQFTLHTGTFMTAHQFTGTFTHTFMTLGHTWWWWWWWFTHTFTGCFAHMTLQFTGHFTFMTHTGTFTHTFLTGTWWWAWWFHMTFTHTGQFTLTFHMTGFTHTFTCGQFAHMTQFLTEEGFHMTEEFTHGEDEFTEEFHLGMTEEFT9AHTEDEFTGTEEHFMTPEET

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb_no4PT14 : 104544 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
104544.1 104544.1 15.80 / 0.02% 2973 / 2.8% 19.7 4769.6 4677.3 Mana 0.46% 34.0 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:350762|150119|127283|124484|99554|98346|52272&chds=0,701523&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++350762++devouring_plague,9482C9,0,0,15|t++150119++vampiric_touch,9482C9,1,0,15|t++127283++halo,9482C9,2,0,15|t++124484++shadow_word_pain,9482C9,3,0,15|t++99554++shadow_word_death,9482C9,4,0,15|t++98346++mind_blast,9482C9,5,0,15|t++52272++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,12,12,11,9,9,7,6,4,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadowy_apparition|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_mb_no4PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:667786553101101zzzxwvuspomlkjkkkhhhgecbaZYWWXXXXYZYZYZaZZZacccefggfffedddeddededccccbaZYYYYZZYYYWVVUUVWXXYZabccccddefgghijihhgfefeeeeedddcccbbbbbaaabZZZZZZZZaaaZZZYYYZaaaaaaaaabaaaabbbbcddddcccdddddddddcccbbZYYXXWWWXWWVUUUUUVVVWXXXXYZZZacdefghiiijjjjjklllkkjihggfeddcbbabbaaZZYYXXXXXXXXXXXXXXWWVVWWXYYZZaabbbcddddeeeeefeedddccbbbbabbccccddddddccccddccdccccddeefghiijkllmmmmllmmmllkjjihhgfeedcccddddddddddddddddddddddddeeffgghiiijkkkkklllmmmmmllllkkkjjjjjjjjjjiiihhhhgggggffffffffghhijklmnopqrssstttttssrrqponmlkkjiiiiihhhhggffffffffffeedcccccbbbccc&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5089,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=104544|max=205412&chxp=1,1,51,100&chtt=priest_90_pi_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,24,0,0,40,56,64,168,280,384,552,624,904,1272,1400,1752,2152,2704,2536,2632,3288,3184,3344,3192,2896,2848,2336,1992,1848,1616,1344,1056,776,560,552,448,360,216,160,104,88,120,48,16,16,8,16,0,8&chds=0,3344&chbh=5&chxt=x&chxl=0:|min=97905|avg=104544|max=112052&chxp=0,1,47,100&chtt=priest_90_pi_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:55.4,11.5,11.4,7.8,4.6,3.9,2.8,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 249.6s|mind_blast 52.0s|shadow_word_pain 51.5s|vampiric_touch 35.1s|devouring_plague 20.9s|shadow_word_death 17.5s|halo 12.7s|mindbender 8.0s|waiting 2.1s&chtt=priest_90_pi_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb_no4PT14 104544
devouring_plague 5733 (16249) 5.5% (15.5%) 18.0 26.30sec 406058 350762 118226 244523 143275 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 18.02 0.00 0.00 1.1576 0.0000 2582038.95 2582038.95 0.00 350761.55 350761.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.45 80.17% 118226.06 107519 143944 118265.34 112130 126354 1708106 1708106 0.00
crit 3.57 19.83% 244523.20 221488 296525 239188.48 0 296525 873933 873933 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2519 2.4% 47.3 9.53sec 23974 0 19764 40929 24008 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.33 47.26 0.00 0.00 0.0000 0.0000 1134703.77 1134703.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.78 79.95% 19764.08 17856 23904 19772.45 18601 21179 746786 746786 0.00
crit 9.48 20.05% 40929.26 36784 49242 40936.20 0 47032 387917 387917 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7997 7.7% 18.0 26.30sec 199823 0 0 0 0 0.0% 0.0% 0.0% 0.0% 151.1 19649 40648 23827 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 18.02 151.14 151.14 0.0000 0.7323 3601195.44 3601195.44 0.00 32537.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.1 80.10% 19648.91 17856 23904 19655.53 18966 20528 2378808 2378808 0.00
crit 30.1 19.90% 40648.15 36784 49242 40661.71 38234 43469 1222387 1222387 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3580) 0.0% (3.4%) 11.2 41.53sec 143529 127283 0 0 0 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 11.23 0.00 0.00 1.1277 0.0000 0.00 0.00 0.00 127282.80 127282.80
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.95 79.73% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.28 20.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3580 3.4% 11.2 41.53sec 143529 0 118238 244685 143529 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.23 11.23 0.00 0.00 0.0000 0.0000 1611782.12 1611782.12 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.00% 118237.94 109581 139821 118248.48 110251 125406 1062190 1062190 0.00
crit 2.25 20.00% 244685.05 225736 288030 224273.70 0 288030 549592 549592 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.53sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.23 239.88 0.00 0.00 0.0000 0.0000 0.00 47145758.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 184.71 77.00% 0.00 0 0 0.00 0 0 0 29130734 100.00
crit 55.17 23.00% 0.00 0 0 0.00 0 0 0 18015025 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11348 10.9% 44.6 10.18sec 114666 98346 94501 195780 114667 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.59 44.59 0.00 0.00 1.1659 0.0000 5113001.70 5113001.70 0.00 98345.87 98345.87
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.71 80.09% 94500.90 86183 115909 94527.33 91438 97927 3374839 3374839 0.00
crit 8.88 19.91% 195779.69 177536 238773 195869.86 177536 238773 1738163 1738163 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 22056 (28955) 21.1% (27.7%) 141.8 3.14sec 91992 52272 0 0 0 0.0% 0.0% 0.0% 0.0% 324.7 25201 52251 30609 20.0% 0.0% 51.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.82 141.82 324.65 324.65 1.7599 0.7153 9937486.72 9937486.72 0.00 52272.46 52272.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 141.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 259.7 80.01% 25201.30 22887 30640 25209.21 24657 25832 6545876 6545876 0.00
crit 64.9 19.99% 52251.25 47146 63119 52270.85 50109 54971 3391611 3391611 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6899 6.6% 101.6 4.35sec 30593 0 25199 52238 30614 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 101.61 101.54 0.00 0.00 0.0000 0.0000 3108620.67 3108620.67 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 81.20 79.97% 25198.75 22887 30640 25205.89 24294 26274 2046249 2046249 0.00
crit 20.34 20.03% 52237.53 47146 63119 52249.00 47551 57054 1062372 1062372 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.77sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 6.92 0.00 0.00 1.1555 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.92 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.06sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3866 3.7% 15.1 4.85sec 115419 99554 94686 196532 115420 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.11 15.11 0.00 0.00 1.1594 0.0000 1743489.27 1743489.27 0.00 99554.00 99554.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.03 79.64% 94685.78 83662 112752 94761.77 87306 106934 1139136 1139136 0.00
crit 3.08 20.36% 196531.90 172343 232270 189850.74 0 232270 604354 604354 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10889 (14270) 10.4% (13.6%) 44.8 10.02sec 143243 124484 0 0 0 0.0% 0.0% 0.0% 0.0% 251.0 14774 30570 19511 30.0% 0.0% 98.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.80 44.80 250.96 250.96 1.1507 1.7726 4896541.01 4896541.01 0.00 12927.00 124484.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.7 70.01% 14774.20 13422 17966 14777.83 14286 15293 2595784 2595784 0.00
crit 75.3 29.99% 30570.27 27649 37009 30576.42 29322 32043 2300757 2300757 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3380 3.2% 78.6 5.65sec 19342 0 14673 30344 19356 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.61 78.55 0.00 0.00 0.0000 0.0000 1520487.46 1520487.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.08 70.11% 14672.79 13422 17966 14675.15 14109 15307 808130 808130 0.00
crit 23.48 29.89% 30344.05 27649 37009 30350.44 28510 32793 712357 712357 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 4042 3.9% 84.1 5.30sec 21643 0 18311 36835 22000 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.08 82.72 0.00 0.00 0.0000 0.0000 1819736.78 1819736.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 66.25 80.09% 18311.38 16669 22484 18314.04 17705 19094 1213104 1213104 0.00
crit 16.47 19.91% 36835.07 33338 44968 36846.18 34128 40393 606633 606633 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8925 (11696) 8.5% (11.2%) 30.2 15.04sec 174564 150119 0 0 0 0.0% 0.0% 0.0% 0.0% 199.5 16595 34404 20148 19.9% 0.0% 95.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.17 30.17 199.48 199.48 1.1629 2.1575 4019097.18 4019097.18 0.00 11315.44 150118.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.17 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 159.7 80.05% 16595.13 15001 20366 16599.70 16053 17209 2650036 2650036 0.00
crit 39.8 19.95% 34404.11 30902 41955 34411.57 32464 36746 1369061 1369061 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2771 2.7% 62.5 7.06sec 19976 0 16499 34166 19993 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.47 62.42 0.00 0.00 0.0000 0.0000 1247969.17 1247969.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.07 80.22% 16498.86 15001 20366 16502.34 15854 17452 826165 826165 0.00
crit 12.35 19.78% 34166.21 30902 41955 34175.11 30902 38319 421804 421804 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40600 / 10539
melee 40600 10.1% 107.4 4.09sec 44109 41459 38469 77593 44109 20.3% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.40 107.40 0.00 0.00 1.0639 0.0000 4737151.69 4737151.69 0.00 41459.41 41459.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.85 55.73% 38469.15 30516 46982 38487.28 36140 40726 2302464 2302464 0.00
crit 21.77 20.27% 77593.19 61032 93964 77610.25 70724 85646 1689306 1689306 0.00
glance 25.77 24.00% 28920.45 22887 35237 28931.65 26709 31671 745381 745381 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1270 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.86%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.27%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.4 36.4sec 20.1sec 44.48% 45.08%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.48%

    Trigger Attempt Success

    • trigger_pct:2.16%
light_of_the_cosmos 9.7 0.0 48.7sec 48.7sec 42.02% 42.02%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.02%

    Trigger Attempt Success

    • trigger_pct:14.75%
power_infusion 4.3 0.0 121.1sec 121.1sec 18.55% 21.50%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.80% 49.53%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.39% 83.95%

Buff details

  • buff initial source:priest_90_pi_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb_no4PT14
devouring_plague Shadow Orb 18.0 54.1 3.0 3.0 135352.5
halo Mana 11.2 422343.1 37609.8 37609.7 3.8
mind_blast Mana 44.6 385775.1 8651.5 8651.5 13.3
mind_flay Mana 141.8 408064.9 2877.4 2877.4 32.0
shadow_word_death Mana 15.1 113446.2 7509.9 7510.1 15.4
shadow_word_pain Mana 44.8 558583.9 12468.8 12468.9 11.5
vampiric_touch Mana 30.2 260367.6 8629.3 8629.3 20.2
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.40 397360.87 (18.86%) 3699.90 73143.60 15.55%
Shadow Orbs from Mind Blast Shadow Orb 44.59 44.59 (85.40%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.63 7.63 (14.60%) 1.00 0.00 0.00%
Devouring Plague Health Health 198.40 0.00 (-nan%) 0.00 2755132.31 100.00%
Vampiric Touch Mana Mana 261.90 1220973.75 (57.95%) 4661.98 163171.05 11.79%
mp5_regen Mana 1801.40 488655.87 (23.19%) 271.26 51763.17 9.58%
Resource RPS-Gain RPS-Loss
Mana 4677.26 4769.59
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 258409.21 171552.38 300000.00
Shadow Orb 1.15 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 9.6%
shadowfiend-Mana Cap 9.6%
lightwell-Mana Cap 9.6%

Procs

Count Interval
Shadowy Recall Extra Tick 289.8 1.5sec
Shadowy Apparition Procced 84.1 5.3sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_mb_no4PT14 Damage Per Second
Count 49992
Mean 104544.14
Minimum 97905.31
Maximum 112051.73
Spread ( max - min ) 14146.41
Range [ ( max - min ) / 2 * 100% ] 6.77%
Standard Deviation 1802.8453
5th Percentile 101662.69
95th Percentile 107608.36
( 95th Percentile - 5th Percentile ) 5945.66
Mean Distribution
Standard Deviation 8.0632
95.00% Confidence Intervall ( 104528.34 - 104559.95 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1142
0.1 Scale Factor Error with Delta=300 27746
0.05 Scale Factor Error with Delta=300 110984
0.01 Scale Factor Error with Delta=300 2774601
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 104544.14
Distribution Chart

Damage

Sample Data
Count 49992
Mean 42336150.24
Distribution Chart

DTPS

Sample Data priest_90_pi_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 255.21
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.92 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.89 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.11 shadow_word_death,if=active_enemies<=5
F 45.46 mind_blast,if=active_enemies<=6&cooldown_react
G 22.06 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.48 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.23 halo,if=talent.halo.enabled
M 14.13 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.57 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.03 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 67.29 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 22.74 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTGHFMTFTHTGQFTLWWWWWFHMTAQFTHTGQFTFHMTLTGFTHTFTGTFHMTQFTACTHGLFTWWWWWWWFMHTQFTGHFTFMLHTGTFTAHFTGTFMHTFTLGTHFWWWWWWWFTHTFMTGACFHTLTFTGHTFMTQFTHTGTFTHLFMTGTWWWAWWFHTFTHTGTFMTLTHQFTGTQFTHTQFMTGTACFHTLTFTEDEGHTFTEETFMHEEGTQFTEDEHFLTGPEETFH9ADPEETQFTGEDEHFTEETF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no2PT14 : 99798 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
99798.4 99798.4 16.39 / 0.02% 3040 / 3.0% 18.9 5055.6 4607.7 Mana 0.34% 35.2 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:350282|150475|147878|126523|101686|99527|97890|52350&chds=0,700563&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++350282++devouring_plague,9482C9,0,0,15|t++150475++vampiric_touch,9482C9,1,0,15|t++147878++shadow_word_insanity,9482C9,2,0,15|t++126523++halo,9482C9,3,0,15|t++101686++shadow_word_pain,9482C9,4,0,15|t++99527++shadow_word_death,9482C9,5,0,15|t++97890++mind_blast,9482C9,6,0,15|t++52350++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,10,9,8,7,7,6,4,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|shadow_word_insanity|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|devouring_plague_mastery&chtt=priest_90_pi_swi_no2PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:776543530yzyyyyxxvutrponnlkhhijhgffecaZYXWVUVVVWWXXXWXXWVWXXXYYZZYYYXXWWVWWVWXXWXYZaZZYYYYZaaaYXYXXWWWXXXXYbccccbbcccdddddcaaZYWWVVVUUUUUUUVVXYYYYYZZZZZZZZYZZZZYYXWWWXYZZZZZaabccdcdddddddccbbbbbbaaaaZZZZZZZZYYYXXWVVVVUUTTTTTTTUVWWWWXZYZZabbbbcddddcbbccddccccbbabbaZZZZZZaaZYYYXXXXXXWXXXXXXWWVVVUUUTTTUUUUUUUUUUVVWWWWXXYZYYYYYYYYaaaaaaabbcddcccccccddcbbbbcddeffghjkkkkkkkkkllkkjjihhgfedddcccccccccddcccbbbbbbccccccccccccccccccddddddddcddddeeefffgggggghhhhhhhhhhhggggggfffffeeeeeeeeeffgggghhhhiijjjkkkkkkkkkjjjiiiiihhhhhhggfffeeeedddddddddddddddddeee&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4656,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=99798|max=214360&chxp=1,1,47,100&chtt=priest_90_pi_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,0,0,24,56,64,72,136,200,240,440,728,864,1304,1584,2096,2480,2736,3208,2976,3384,3080,3368,3320,2936,2720,2384,2080,1592,1176,1120,976,584,520,448,264,208,176,144,128,64,40,24,16,8,8,8&chds=0,3384&chbh=5&chxt=x&chxl=0:|min=92020|avg=99798|max=107597&chxp=0,1,50,100&chtt=priest_90_pi_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:51.5,11.9,11.5,7.8,4.8,4.6,3.9,2.8,0.5,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 231.9s|shadow_word_pain 53.5s|mind_blast 52.0s|vampiric_touch 35.2s|shadow_word_insanity 21.8s|devouring_plague 20.8s|shadow_word_death 17.5s|halo 12.6s|shadowfiend 2.4s|dispersion 0.0s|waiting 1.5s&chtt=priest_90_pi_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no2PT14 99798
devouring_plague 5724 (16208) 5.7% (16.2%) 18.0 26.43sec 406329 350282 118284 244715 143519 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 0.00 0.00 1.1601 0.0000 2578154.14 2578154.14 0.00 350281.71 350281.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.38 80.04% 118283.62 107519 143944 118328.04 110887 125321 1700677 1700677 0.00
crit 3.59 19.96% 244715.38 221488 296525 239360.85 0 296525 877477 877477 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2506 2.5% 47.0 9.60sec 23988 0 19769 40947 24025 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.04 46.96 0.00 0.00 0.0000 0.0000 1128333.06 1128333.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.52 79.90% 19768.52 17856 23904 19777.75 18602 21008 741805 741805 0.00
crit 9.44 20.10% 40947.06 36784 49242 40963.07 36784 47822 386528 386528 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7978 8.0% 18.0 26.43sec 199997 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150.5 19666 40694 23878 20.0% 0.0% 24.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.96 17.96 150.46 150.46 0.0000 0.7333 3592683.07 3592683.07 0.00 32562.77 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.3 79.97% 19665.80 17856 23904 19672.81 18940 20592 2366099 2366099 0.00
crit 30.1 20.03% 40694.08 36784 49242 40707.43 38497 43747 1226585 1226585 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3538) 0.0% (3.5%) 11.1 41.94sec 143141 126523 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.12 0.00 0.00 1.1314 0.0000 0.00 0.00 0.00 126523.23 126523.23
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 80.07% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.93% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3538 3.5% 11.1 41.94sec 143141 0 118217 244552 143141 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.12 0.00 0.00 0.0000 0.0000 1592168.29 1592168.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 80.27% 118217.17 109581 139821 118238.72 111065 127945 1055517 1055517 0.00
crit 2.19 19.73% 244551.51 225736 288030 223482.93 0 288030 536652 536652 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.94sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.12 233.92 0.00 0.00 0.0000 0.0000 0.00 46006349.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 179.98 76.94% 0.00 0 0 0.00 0 0 0 28391224 100.00
crit 53.94 23.06% 0.00 0 0 0.00 0 0 0 17615126 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11294 11.3% 44.4 10.22sec 114575 97890 94504 195633 114575 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.40 44.40 0.00 0.00 1.1704 0.0000 5087556.12 5087556.12 0.00 97890.33 97890.33
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.59 80.15% 94503.59 86183 115909 94530.57 91515 98467 3363487 3363487 0.00
crit 8.81 19.85% 195633.22 177536 238773 195721.53 177536 221218 1724069 1724069 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20529 (26954) 20.6% (27.0%) 132.6 3.36sec 91592 52350 0 0 0 0.0% 0.0% 0.0% 0.0% 302.6 25177 52185 30564 19.9% 0.0% 47.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.56 132.56 302.56 302.56 1.7496 0.7136 9247567.21 9247567.21 0.00 52349.53 52349.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.2 80.05% 25177.04 22887 30640 25183.92 24562 25894 6098106 6098106 0.00
crit 60.4 19.95% 52184.55 47146 63119 52202.77 50079 54768 3149462 3149462 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6425 6.4% 94.8 4.66sec 30537 0 25179 52193 30557 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.77 94.71 0.00 0.00 0.0000 0.0000 2893964.44 2893964.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.85 80.09% 25179.38 22887 30640 25186.23 24268 26293 1909935 1909935 0.00
crit 18.85 19.91% 52193.36 47146 63119 52202.98 48176 56600 984030 984030 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3866 3.9% 15.1 4.85sec 115361 99527 94701 196473 115366 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.11 15.11 0.00 0.00 1.1591 0.0000 1743214.88 1743214.88 0.00 99526.97 99526.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.04 79.70% 94701.29 83662 112752 94777.44 86653 103918 1140518 1140518 0.00
crit 3.07 20.30% 196472.81 172343 232270 189595.38 0 232270 602697 602697 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7123 7.2% 18.7 23.37sec 172104 147878 141962 294012 172108 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.70 18.70 0.00 0.00 1.1639 0.0000 3218858.73 3218858.73 0.00 147877.92 147877.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.00 80.18% 141961.81 128911 173880 142019.49 132100 152024 2128776 2128776 0.00
crit 3.71 19.82% 294011.79 265556 358194 288066.67 0 358194 1090083 1090083 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9234 (12099) 9.2% (12.1%) 46.3 9.69sec 117403 101686 0 0 0 0.0% 0.0% 0.0% 0.0% 231.7 14756 30590 17911 19.9% 0.0% 88.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.32 46.32 231.73 231.73 1.1546 1.7268 4150630.64 4150630.64 0.00 11988.94 101685.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 185.6 80.07% 14756.47 13422 17966 14759.68 14351 15228 2738151 2738151 0.00
crit 46.2 19.93% 30590.02 27649 37009 30595.29 29004 32194 1412480 1412480 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2865 2.9% 72.5 6.13sec 17767 0 14669 30391 17781 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.50 72.44 0.00 0.00 0.0000 0.0000 1288030.01 1288030.01 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.10 80.20% 14668.91 13422 17966 14671.02 14082 15283 852213 852213 0.00
crit 14.34 19.80% 30391.19 27649 37009 30398.27 27649 33760 435817 435817 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2165 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2717 2.7% 56.5 7.85sec 21631 0 18322 36843 21982 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.50 55.60 0.00 0.00 0.0000 0.0000 1222197.35 1222197.35 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.61 80.24% 18322.36 16669 22484 18325.35 17485 19268 817445 817445 0.00
crit 10.99 19.76% 36843.01 33338 44968 36851.12 33338 42467 404752 404752 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8987 (11772) 9.0% (11.8%) 30.3 14.97sec 174877 150475 0 0 0 0.0% 0.0% 0.0% 0.0% 200.2 16639 34509 20216 20.0% 0.0% 95.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.32 30.32 200.20 200.20 1.1622 2.1561 4047181.32 4047181.32 0.00 11354.74 150475.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.1 79.99% 16639.25 15001 20366 16645.38 16120 17222 2664427 2664427 0.00
crit 40.1 20.01% 34509.34 30902 41955 34520.82 32639 37822 1382754 1382754 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2785 2.8% 62.7 7.05sec 20013 0 16494 34186 20030 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.67 62.62 0.00 0.00 0.0000 0.0000 1254220.08 1254220.08 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.11 80.02% 16494.44 15001 20366 16497.43 15773 17394 826474 826474 0.00
crit 12.51 19.98% 34186.35 30902 41955 34195.89 31229 39088 427746 427746 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 53200 / 4227
melee 53200 4.2% 33.3 11.78sec 56442 55860 48979 99002 56443 20.7% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.33 33.33 0.00 0.00 1.0104 0.0000 1880959.10 1880959.10 0.00 55859.56 55859.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.44 55.32% 48978.63 38145 58728 48995.29 43611 54715 902996 902996 0.00
crit 6.91 20.72% 99002.42 76291 117456 98994.14 0 117456 683777 683777 0.00
glance 7.98 23.95% 36855.36 28609 44046 36863.68 28609 44046 294186 294186 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1289 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.03%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.01%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.3 36.3sec 20.3sec 44.35% 44.96%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.35%

    Trigger Attempt Success

    • trigger_pct:2.20%
light_of_the_cosmos 9.6 0.0 48.9sec 48.9sec 41.88% 41.88%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.88%

    Trigger Attempt Success

    • trigger_pct:14.93%
power_infusion 4.3 0.0 121.0sec 121.1sec 18.58% 21.07%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.80% 49.50%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.47%

Buff details

  • buff initial source:priest_90_pi_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no2PT14
devouring_plague Shadow Orb 18.0 53.9 3.0 3.0 135443.1
halo Mana 11.1 420172.3 37774.9 37774.9 3.8
mind_blast Mana 44.4 384524.9 8659.7 8659.7 13.2
mind_flay Mana 132.6 380353.6 2869.3 2869.3 31.9
shadow_word_death Mana 15.1 113429.7 7506.3 7506.5 15.4
shadow_word_insanity Mana 18.7 135877.9 7265.1 7265.0 23.7
shadow_word_pain Mana 46.3 581443.3 12551.5 12551.5 9.4
vampiric_touch Mana 30.3 261606.8 8629.6 8629.6 20.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.04 639.36 (0.03%) 18000.00 0.00 0.00%
shadowfiend Mana 33.33 233119.49 (11.23%) 6995.21 66810.91 22.28%
Shadow Orbs from Mind Blast Shadow Orb 44.40 44.40 (85.33%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.63 7.63 (14.67%) 1.00 0.00 0.00%
Devouring Plague Health Health 197.42 0.00 (-nan%) 0.00 2741521.21 100.00%
Vampiric Touch Mana Mana 262.82 1320883.53 (63.64%) 5025.91 68157.27 4.91%
mp5_regen Mana 1801.40 521030.69 (25.10%) 289.24 19388.35 3.59%
Resource RPS-Gain RPS-Loss
Mana 4607.74 5055.57
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 98272.41 2160.00 277920.00
Shadow Orb 1.15 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.7%
shadowfiend-Mana Cap 3.7%
lightwell-Mana Cap 3.7%

Procs

Count Interval
Shadowy Recall Extra Tick 276.7 1.6sec
Shadowy Apparition Procced 56.5 7.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no2PT14 Damage Per Second
Count 49992
Mean 99798.44
Minimum 92020.30
Maximum 107596.53
Spread ( max - min ) 15576.23
Range [ ( max - min ) / 2 * 100% ] 7.80%
Standard Deviation 1870.0983
5th Percentile 96918.65
95th Percentile 102997.91
( 95th Percentile - 5th Percentile ) 6079.27
Mean Distribution
Standard Deviation 8.3640
95.00% Confidence Intervall ( 99782.04 - 99814.83 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1348
0.1 Scale Factor Error with Delta=300 29854
0.05 Scale Factor Error with Delta=300 119418
0.01 Scale Factor Error with Delta=300 2985468
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 99798.44
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43044759.34
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 264.01
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 3.92 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.11 shadow_word_death,if=active_enemies<=5
F 45.68 mind_blast,if=active_enemies<=6&cooldown_react
G 22.74 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.57 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.70 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.12 halo,if=talent.halo.enabled
M 14.05 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.44 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.32 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.48 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 23.59 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTIGHFMTFTHTIGTFTLWWWWWFHMTFTHIGTFTFHIGLMTQFTHTIFGTHFMTIGTCFTHTLTWWWWWWWFTHTQFMTIGHFTFTHIGLTFMTBTHFIGTFTHTIGFMTHLWWWWWWFTHTFTIGTCFHMTFIGLTHTFTIGFMHTFTIGHTFTLTFIGWWWHFMTFHIGTQFTHLIFGMTQFHTIGFTCTBHTFMTIGTFLTEEHTFDEEGTHQFTEDETFIGEEHTQFMLPEETIG9FHPEDETFTEEGHQFMTEET

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi_no4PT14 : 101947 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
101946.7 101946.7 16.71 / 0.02% 3126 / 3.1% 19.3 5054.7 4609.1 Mana 0.34% 35.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:349922|150549|148135|126790|110610|99522|97983|52342&chds=0,699845&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++349922++devouring_plague,9482C9,0,0,15|t++150549++vampiric_touch,9482C9,1,0,15|t++148135++shadow_word_insanity,9482C9,2,0,15|t++126790++halo,9482C9,3,0,15|t++110610++shadow_word_pain,9482C9,4,0,15|t++99522++shadow_word_death,9482C9,5,0,15|t++97983++mind_blast,9482C9,6,0,15|t++52342++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,10,9,8,7,7,6,4,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|shadow_word_insanity|mind_flay_mastery|devouring_plague|shadowfiend: melee|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_pi_swi_no4PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:786543530z0zzyzxxwvusqonnmliijjhggfedbaZYXVVWVVWXXXXXYXWWXXYXYYaaZYYYXWWVWWWXXXXXYZaZZZYYZZaaaYYYXXWWWYXXYZbccccbccdcedeeddbaZYXWVWVVVVVVVVVWXYYZYZZaZZZZZZZZZZZZYXXXXYZZZZZaabbcdddddddddddcbbbccbbbaaaaaaaaaZZYYYXWWWWWVVUUUTTTTUWWWWWXZZZaabcccdedddccbcdeeddcccbbbbaaZZZaaaaaZYYYYXXXXXXXXXXXXWWVVVVUUUUVVVVVVVVVVVVWXXXXXYZZYYZZZYZaaabbabbcddddddddddddccccccdeffghijkkkkkkkkllllkkjiihgfedddddccccccddddccccccccccccdddddccccccccddddddddddddeeeefffggggghhhhhhhhhhhhhhggggggfffffffeeeeffffggghhhhiiijjjkkklllllkkjjjiiiiihhhhhhggfffeeeeeedddddddddddddddee&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.4725,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=101947|max=215755&chxp=1,1,47,100&chtt=priest_90_pi_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,0,48,72,64,120,152,384,480,728,936,1016,1496,1984,2280,2368,3088,2968,3088,3456,3032,2944,3216,2776,2240,2240,1672,1640,1104,1160,856,632,480,424,208,192,144,88,64,40,32,32,16,8,0,0,0,0,0,8&chds=0,3456&chbh=5&chxt=x&chxl=0:|min=95665|avg=101947|max=111104&chxp=0,1,41,100&chtt=priest_90_pi_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:51.5,11.9,11.5,7.8,4.8,4.6,3.9,2.8,0.5,0.0,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 232.0s|shadow_word_pain 53.4s|mind_blast 52.0s|vampiric_touch 35.2s|shadow_word_insanity 21.8s|devouring_plague 20.8s|shadow_word_death 17.5s|halo 12.6s|shadowfiend 2.4s|dispersion 0.0s|waiting 1.5s&chtt=priest_90_pi_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi_no4PT14 101947
devouring_plague 5718 (16199) 5.6% (15.9%) 18.0 26.42sec 406003 349922 118242 244751 143345 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 0.00 0.00 1.1603 0.0000 2575663.31 2575663.31 0.00 349922.43 349922.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.40 80.16% 118242.00 107519 143944 118278.56 112171 126751 1703039 1703039 0.00
crit 3.57 19.84% 244751.00 221488 296525 239095.80 0 296525 872624 872624 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2508 2.5% 47.1 9.58sec 23965 0 19770 40945 23999 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.11 47.04 0.00 0.00 0.0000 0.0000 1128946.13 1128946.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.65 80.03% 19770.15 17856 23904 19778.09 18710 21004 744331 744331 0.00
crit 9.39 19.97% 40945.40 36784 49242 40956.14 36784 46831 384616 384616 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7974 7.8% 18.0 26.42sec 199828 0 0 0 0 0.0% 0.0% 0.0% 0.0% 150.5 19663 40676 23856 20.0% 0.0% 24.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.97 17.97 150.51 150.51 0.0000 0.7336 3590573.40 3590573.40 0.00 32520.66 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.97 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 120.5 80.05% 19663.01 17856 23904 19669.71 18976 20726 2368962 2368962 0.00
crit 30.0 19.95% 40675.63 36784 49242 40686.90 38181 43552 1221612 1221612 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3544) 0.0% (3.5%) 11.1 41.93sec 143433 126790 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.12 0.00 0.00 1.1313 0.0000 0.00 0.00 0.00 126790.14 126790.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.91 80.08% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 19.92% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3544 3.5% 11.1 41.93sec 143433 0 118237 244620 143434 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.12 11.12 0.00 0.00 0.0000 0.0000 1595273.49 1595273.49 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.90 80.06% 118236.64 109581 139821 118263.55 109581 126491 1052872 1052872 0.00
crit 2.22 19.94% 244620.08 225736 288030 222118.62 0 288030 542401 542401 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.93sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.12 233.94 0.00 0.00 0.0000 0.0000 0.00 46020229.04 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 180.00 76.94% 0.00 0 0 0.00 0 0 0 28397349 100.00
crit 53.94 23.06% 0.00 0 0 0.00 0 0 0 17622880 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11307 11.1% 44.4 10.22sec 114679 97983 94508 195644 114678 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.42 44.42 0.00 0.00 1.1704 0.0000 5094221.13 5094221.13 0.00 97982.75 97982.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.56 80.06% 94507.99 86183 115909 94534.81 91590 98117 3360878 3360878 0.00
crit 8.86 19.94% 195644.18 177536 238773 195696.42 177536 221218 1733343 1733343 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 20534 (26953) 20.2% (26.5%) 132.6 3.36sec 91586 52342 0 0 0 0.0% 0.0% 0.0% 0.0% 302.6 25183 52201 30571 19.9% 0.0% 47.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.56 132.56 302.55 302.55 1.7498 0.7137 9249378.93 9249378.93 0.00 52341.78 52341.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 132.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 242.2 80.06% 25182.79 22887 30640 25190.01 24613 25799 6099511 6099511 0.00
crit 60.3 19.94% 52200.57 47146 63119 52214.36 50326 54916 3149868 3149868 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6419 6.3% 94.6 4.66sec 30554 0 25183 52212 30572 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.63 94.58 0.00 0.00 0.0000 0.0000 2891453.42 2891453.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 75.72 80.06% 25182.89 22887 30640 25190.05 24217 26209 1906915 1906915 0.00
crit 18.86 19.94% 52212.07 47146 63119 52226.02 48401 57862 984538 984538 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.12sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3869 3.8% 15.1 4.84sec 115381 99522 94688 196380 115381 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.12 15.12 0.00 0.00 1.1594 0.0000 1744430.18 1744430.18 0.00 99522.49 99522.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.04 79.65% 94687.64 83662 112752 94764.95 87813 103384 1140270 1140270 0.00
crit 3.08 20.35% 196379.96 172343 232270 189633.33 0 232270 604160 604160 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7139 7.0% 18.7 23.36sec 172413 148135 141989 294034 172413 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.71 18.71 0.00 0.00 1.1639 0.0000 3225941.78 3225941.78 0.00 148135.27 148135.27
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.97 79.99% 141989.16 128911 173880 142048.92 133505 151365 2125081 2125081 0.00
crit 3.74 20.01% 294034.40 265556 358194 287811.94 0 358194 1100861 1100861 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 10036 (13151) 9.8% (12.9%) 46.3 9.70sec 127706 110610 0 0 0 0.0% 0.0% 0.0% 0.0% 231.7 14754 30535 19472 29.9% 0.0% 88.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.29 46.29 231.65 231.65 1.1546 1.7272 4510741.42 4510741.42 0.00 13033.27 110610.48
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 162.4 70.10% 14754.37 13422 17966 14757.59 14333 15222 2396090 2396090 0.00
crit 69.3 29.90% 30535.48 27649 37009 30543.07 29392 32330 2114651 2114651 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3115 3.1% 72.5 6.13sec 19326 0 14670 30351 19340 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.46 72.41 0.00 0.00 0.0000 0.0000 1400393.45 1400393.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.85 70.22% 14670.43 13422 17966 14672.49 13993 15507 745977 745977 0.00
crit 21.56 29.78% 30350.88 27649 37009 30356.74 28174 33181 654417 654417 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.93sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2164 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3792 3.7% 78.8 5.66sec 21659 0 18314 36832 22016 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.77 77.49 0.00 0.00 0.0000 0.0000 1706055.06 1706055.06 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 62.00 80.01% 18314.26 16669 22484 18317.03 17662 18979 1135493 1135493 0.00
crit 15.49 19.99% 36832.00 33338 44968 36838.32 33853 40747 570562 570562 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8992 (11774) 8.8% (11.6%) 30.3 14.97sec 174941 150549 0 0 0 0.0% 0.0% 0.0% 0.0% 200.2 16643 34513 20222 20.0% 0.0% 95.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.31 30.31 200.24 200.24 1.1620 2.1561 4049337.35 4049337.35 0.00 11354.41 150549.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.31 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.1 79.97% 16643.33 15001 20366 16649.09 16077 17224 2665204 2665204 0.00
crit 40.1 20.03% 34512.72 30902 41955 34522.86 32568 36957 1384133 1384133 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2782 2.7% 62.8 7.03sec 19962 0 16496 34191 19981 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.75 62.69 0.00 0.00 0.0000 0.0000 1252704.80 1252704.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.35 80.30% 16495.65 15001 20366 16498.70 15792 17285 830482 830482 0.00
crit 12.35 19.70% 34191.07 30902 41955 34196.44 30902 39270 422223 422223 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 53091 / 4217
melee 53091 4.1% 33.3 11.79sec 56326 55742 48962 99078 56325 20.5% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.32 33.32 0.00 0.00 1.0105 0.0000 1877055.45 1877055.45 0.00 55741.98 55741.98
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.47 55.43% 48961.77 38145 58728 48970.12 44119 54876 904344 904344 0.00
crit 6.84 20.51% 99077.81 76291 117456 99053.19 0 117456 677296 677296 0.00
glance 8.02 24.06% 36842.22 28609 44046 36841.93 0 44046 295416 295416 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1289 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.03%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.20%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.1sec 20.1sec 44.58% 45.20%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.58%

    Trigger Attempt Success

    • trigger_pct:2.21%
light_of_the_cosmos 9.6 0.0 48.9sec 48.9sec 41.88% 41.88%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.88%

    Trigger Attempt Success

    • trigger_pct:14.98%
power_infusion 4.3 0.0 121.0sec 121.1sec 18.58% 21.06%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.80% 49.51%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.47%

Buff details

  • buff initial source:priest_90_pi_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi_no4PT14
devouring_plague Shadow Orb 18.0 53.9 3.0 3.0 135334.2
halo Mana 11.1 420051.7 37767.4 37767.3 3.8
mind_blast Mana 44.4 384680.2 8659.8 8659.8 13.2
mind_flay Mana 132.6 380376.2 2869.4 2869.4 31.9
shadow_word_death Mana 15.1 113504.4 7507.2 7507.4 15.4
shadow_word_insanity Mana 18.7 135925.9 7264.7 7264.7 23.7
shadow_word_pain Mana 46.3 580969.4 12551.4 12551.5 10.2
vampiric_touch Mana 30.3 261515.8 8628.7 8628.7 20.3
Resource Gains Type Count Total Average Overflow
dispersion Mana 0.04 673.92 (0.03%) 18000.00 0.00 0.00%
shadowfiend Mana 33.32 233135.16 (11.23%) 6995.85 66788.04 22.27%
Shadow Orbs from Mind Blast Shadow Orb 44.42 44.42 (85.33%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.64 7.64 (14.67%) 1.00 0.00 0.00%
Devouring Plague Health Health 197.55 0.00 (-nan%) 0.00 2743363.13 100.00%
Vampiric Touch Mana Mana 262.94 1321500.43 (63.65%) 5025.93 68032.37 4.90%
mp5_regen Mana 1801.40 520963.92 (25.09%) 289.20 19455.12 3.60%
Resource RPS-Gain RPS-Loss
Mana 4609.07 5054.71
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 99255.10 300.00 295080.00
Shadow Orb 1.15 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 3.7%
shadowfiend-Mana Cap 3.7%
lightwell-Mana Cap 3.7%

Procs

Count Interval
Shadowy Recall Extra Tick 276.7 1.6sec
Shadowy Apparition Procced 78.8 5.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_pi_swi_no4PT14 Damage Per Second
Count 49992
Mean 101946.65
Minimum 95664.98
Maximum 111103.62
Spread ( max - min ) 15438.64
Range [ ( max - min ) / 2 * 100% ] 7.57%
Standard Deviation 1906.1687
5th Percentile 98922.18
95th Percentile 105173.21
( 95th Percentile - 5th Percentile ) 6251.03
Mean Distribution
Standard Deviation 8.5253
95.00% Confidence Intervall ( 101929.94 - 101963.36 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1342
0.1 Scale Factor Error with Delta=300 31017
0.05 Scale Factor Error with Delta=300 124069
0.01 Scale Factor Error with Delta=300 3101746
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 101946.65
Distribution Chart

Damage

Sample Data
Count 49992
Mean 44015113.86
Distribution Chart

DTPS

Sample Data priest_90_pi_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 263.90
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 3.92 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.12 shadow_word_death,if=active_enemies<=5
F 45.68 mind_blast,if=active_enemies<=6&cooldown_react
G 22.72 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.57 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.71 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.12 halo,if=talent.halo.enabled
M 14.05 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.38 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.24 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.51 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 23.56 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGHLTFTIGHFMTQFTHTIGTFTLWWWWWWFHMTFTHIGTFTFHIGLMTFTHTFIGTFHMTIFCGTHTLFWWWWWWWTFHMTQFTIGHTFTFHGLMTFTBTHTFIGTFHMTIGFTHLTWWWWWWFTHTFMTIGHCQFTFTIGHLTFMTIFGHTFTHIGQFMTLFWWWWWWHFTQFTHIGTFMTHTFIGLTFHTIFGMTBCHTFTIGQFTEDEHLQFTIEEGFMHTPEETFTIEDEFGHTEEFLM9THIEEFGTEDEFHTIGEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no2PT14 : 100140 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
100140.2 100140.2 17.42 / 0.02% 3233 / 3.2% 20.1 4765.3 4485.6 Mana 0.43% 36.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:346951|140676|124650|119208|110424|98790|83372|50521&chds=0,693901&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++346951++devouring_plague,9482C9,0,0,15|t++140676++vampiric_touch,9482C9,1,0,15|t++124650++halo,9482C9,2,0,15|t++119208++shadow_word_pain,9482C9,3,0,15|t++110424++shadow_word_death,9482C9,4,0,15|t++98790++mind_blast,9482C9,5,0,15|t++83372++mind_spike,4A79D3,6,0,15|t++50521++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:19,13,10,9,9,8,7,6,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no2PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6864311zxxwwwvwuvutsqpmlllkkllkjihggfdcbaaZZZaZaaaaaaaaaZYYYYZZaaaaaZZZYYZZZabbbbbbbbaaZZZZZZZZZYYXXXYZZabbcddeeedddddddddcbbaZYYYYYYYYZZZZZYYYYYYYZZaZZZZZZZZZabbbccddddcccccdddeeeeeeeeeeeeeffgggffeddccbbbbbaZZYYXYYYYYZZaaaaaaabbbbbccbbbaaaaaaabbbbcccddddddccccbbaaaZZZZZZYYZZZZaaaaaaaaaaaaZZZYYXXWXXXXYYYYZZaaaaaabbbbcbbbbbbcccdddeeeffgggghhhhhhhggggffgghiijjklmmnnnnnnnnnnmlkkjiihhggggggggggggghhhhhhhhhhhhhhiiiiiiiiijjjjjjjjjjjjjjjjkkllmmmnnnooooopppqqqqqqqqpppooooooonnnmmmmllllllmmmmmmmmmmnnoooppppppppoooppppppppooonnnmmmmmmmllllllkkkkkkkkkkk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5128,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=100140|max=195283&chxp=1,1,51,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,16,32,72,80,128,152,336,360,592,624,888,1208,1480,1928,2144,2232,2536,2992,3056,3256,3040,2728,2816,2624,2384,2288,1872,1608,1504,1280,912,800,496,360,416,160,160,120,104,48,24,40,24,8,32,0,8,16&chds=0,3256&chbh=5&chxt=x&chxl=0:|min=93279|avg=100140|max=108499&chxp=0,1,45,100&chtt=priest_90_tof_fdcl_no2PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.2,12.5,10.4,9.7,8.2,5.0,4.0,2.9,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 208.2s|mind_blast 56.2s|shadow_word_pain 47.0s|mind_spike 43.6s|vampiric_touch 36.7s|devouring_plague 22.6s|shadow_word_death 18.1s|halo 13.1s|shadowfiend 2.4s|waiting 1.9s&chtt=priest_90_tof_fdcl_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no2PT14 100140
devouring_plague 6238 (17378) 6.2% (17.4%) 18.9 24.92sec 414022 346951 122504 253618 148625 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.90 18.90 0.00 0.00 1.1933 0.0000 2809150.76 2809150.76 0.00 346950.64 346950.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.14 80.08% 122503.58 107519 165536 122524.93 114622 133203 1854185 1854185 0.00
crit 3.77 19.92% 253618.18 221488 341004 249744.58 0 341004 954966 954966 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2665 2.7% 48.4 9.30sec 24769 0 20433 42377 24804 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.44 48.37 0.00 0.00 0.0000 0.0000 1199799.68 1199799.68 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.74 80.08% 20433.32 17856 27490 20438.77 19095 22490 791562 791562 0.00
crit 9.63 19.92% 42377.36 36784 56629 42394.92 36784 52031 408237 408237 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8476 8.5% 18.9 24.92sec 201921 0 0 0 0 0.0% 0.0% 0.0% 0.0% 154.8 20320 42107 24655 19.9% 0.0% 26.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.90 18.90 154.80 154.80 0.0000 0.7595 3816521.17 3816521.17 0.00 32463.63 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.90 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.0 80.10% 20319.90 17856 27490 20324.05 19521 21301 2519551 2519551 0.00
crit 30.8 19.90% 42107.43 36784 56629 42115.59 39051 45738 1296970 1296970 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3633) 0.0% (3.6%) 11.2 41.72sec 146516 124650 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.16 11.16 0.00 0.00 1.1754 0.0000 0.00 0.00 0.00 124650.02 124650.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.97 80.36% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.19 19.64% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3633 3.6% 11.2 41.72sec 146516 0 120935 250311 146512 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.16 11.16 0.00 0.00 0.0000 0.0000 1635782.23 1635782.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.96 80.23% 120934.95 109581 160794 120915.91 109581 135337 1083207 1083207 0.00
crit 2.21 19.77% 250311.28 225736 331235 227083.24 0 331235 552575 552575 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.72sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.16 236.35 0.00 0.00 0.0000 0.0000 0.00 47411924.36 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.04 77.02% 0.00 0 0 0.00 0 0 0 29301468 100.00
crit 54.31 22.98% 0.00 0 0 0.00 0 0 0 18110457 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12318 12.3% 47.3 9.58sec 117356 98790 96763 200633 117356 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.27 47.27 0.00 0.00 1.1879 0.0000 5547158.62 5547158.62 0.00 98790.02 98790.02
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.90 80.17% 96763.26 86183 133296 96786.14 93197 100532 3667022 3667022 0.00
crit 9.37 19.83% 200632.74 177536 274589 200736.50 177536 244307 1880137 1880137 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17777 (23340) 17.8% (23.3%) 116.8 3.80sec 90056 50521 0 0 0 0.0% 0.0% 0.0% 0.0% 259.0 25472 52790 30923 20.0% 0.0% 42.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.77 116.77 259.01 259.01 1.7826 0.7411 8009548.44 8009548.44 0.00 50520.55 50520.55
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.77 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.3 80.05% 25472.36 22887 35236 25477.39 24764 26235 5281180 5281180 0.00
crit 51.7 19.95% 52790.29 47146 72586 52802.45 50253 56605 2728369 2728369 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5563 5.6% 81.1 5.41sec 30909 0 25482 52816 30928 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.10 81.05 0.00 0.00 0.0000 0.0000 2506708.03 2506708.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.90 80.08% 25482.07 22887 35236 25487.22 24383 26793 1653889 1653889 0.00
crit 16.15 19.92% 52815.78 47146 72586 52823.40 47854 59832 852819 852819 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8069 8.1% 37.0 11.72sec 98300 83372 81105 167886 98301 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.99 36.99 0.00 0.00 1.1791 0.0000 3635923.76 3635923.76 0.00 83371.71 83371.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.66 80.19% 81105.14 72412 112341 81126.61 75656 90564 2405535 2405535 0.00
crit 7.33 19.81% 167885.85 149169 231423 167731.35 0 207909 1230389 1230389 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4426 4.4% 15.1 4.85sec 131906 110424 108414 224938 131901 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 15.13 0.00 0.00 1.1946 0.0000 1996126.18 1996126.18 0.00 110423.53 110423.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.08 79.84% 108414.06 83662 129665 108505.46 98608 121331 1309866 1309866 0.00
crit 3.05 20.16% 224937.70 172343 267111 216762.83 0 267111 686260 686260 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9499 (12463) 9.5% (12.4%) 39.6 11.35sec 141596 119208 0 0 0 0.0% 0.0% 0.0% 0.0% 235.3 14973 31000 18159 19.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.60 39.60 235.34 235.34 1.1878 1.8871 4273593.38 4273593.38 0.00 11416.71 119208.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.60 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 188.6 80.12% 14973.32 13422 20660 14974.64 14502 15441 2823308 2823308 0.00
crit 46.8 19.88% 31000.23 27649 42560 31001.80 29273 33307 1450285 1450285 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2964 3.0% 73.5 6.04sec 18151 0 14986 31042 18164 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.47 73.42 0.00 0.00 0.0000 0.0000 1333608.23 1333608.23 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 58.89 80.20% 14985.72 13422 20660 14987.59 14345 15773 882438 882438 0.00
crit 14.53 19.80% 31041.64 27649 42560 31044.64 28361 34809 451170 451170 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.87sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2236 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2828 2.8% 57.7 7.67sec 22078 0 18676 37584 22450 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.65 56.70 0.00 0.00 0.0000 0.0000 1272877.79 1272877.79 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.38 80.04% 18675.85 16669 25856 18676.07 17656 19778 847553 847553 0.00
crit 11.32 19.96% 37583.80 33338 51713 37591.63 33338 46338 425325 425325 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8747 (11470) 8.7% (11.5%) 30.9 14.67sec 167251 140676 0 0 0 0.0% 0.0% 0.0% 0.0% 191.7 16932 35112 20549 19.9% 0.0% 96.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.89 30.89 191.71 191.71 1.1889 2.2577 3939592.54 3939592.54 0.00 11001.31 140676.31
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.6 80.10% 16932.17 15001 23421 16935.90 16146 17516 2600271 2600271 0.00
crit 38.1 19.90% 35112.24 30902 48248 35119.21 32677 37864 1339321 1339321 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2722 2.7% 60.0 7.33sec 20440 0 16865 34943 20457 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.99 59.94 0.00 0.00 0.0000 0.0000 1226182.13 1226182.13 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.03 80.13% 16865.12 15001 23421 16869.18 15757 18127 810010 810010 0.00
crit 11.91 19.87% 34942.58 30902 48248 34951.65 30902 42369 416172 416172 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 53005 / 4215
melee 53005 4.2% 33.3 11.80sec 56316 55617 48863 98884 56317 20.7% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.31 33.31 0.00 0.00 1.0126 0.0000 1875640.93 1875640.93 0.00 55617.39 55617.39
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.47 55.47% 48862.63 38145 58728 48875.60 44032 54527 902658 902658 0.00
crit 6.89 20.68% 98884.23 76291 117456 98847.22 0 117456 681035 681035 0.00
glance 7.94 23.85% 36746.40 28609 44046 36746.17 0 44046 291948 291948 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.27sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1934 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.89%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.28%
glyph_mind_spike 26.6 10.4 16.5sec 11.7sec 36.32% 53.04%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.55%
  • glyph_mind_spike_2:7.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.7sec 43.58% 43.88%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.58%

    Trigger Attempt Success

    • trigger_pct:2.19%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.78% 41.78%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.78%

    Trigger Attempt Success

    • trigger_pct:15.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.7 0.0 10.1sec 10.1sec 9.81% 49.45%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.81%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 32.0 5.7 13.6sec 11.5sec 20.32% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:18.62%
  • surge_of_darkness_2:1.71%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 110.4 0.0sec 0.7sec 16.14% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.60%

Buff details

  • buff initial source:priest_90_tof_fdcl_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no2PT14
devouring_plague Shadow Orb 18.9 56.7 3.0 3.0 138007.2
halo Mana 11.2 452161.4 40500.0 40499.9 3.6
mind_blast Mana 47.3 425410.6 9000.0 9000.0 13.0
mind_flay Mana 116.8 350322.2 3000.0 3000.0 30.0
shadow_word_death Mana 15.1 118040.8 7800.0 7800.2 16.9
shadow_word_pain Mana 39.6 522720.0 13200.0 13200.0 10.7
vampiric_touch Mana 30.9 277977.6 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.31 240506.50 (11.90%) 7221.20 59243.90 19.76%
Shadow Orbs from Mind Blast Shadow Orb 47.27 47.27 (86.07%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.65 7.65 (13.93%) 1.00 0.00 0.00%
Devouring Plague Health Health 203.17 0.00 (-nan%) 0.00 2821290.34 100.00%
Vampiric Touch Mana Mana 251.65 1261678.70 (62.44%) 5013.60 68415.70 5.14%
mp5_regen Mana 1801.40 518464.03 (25.66%) 287.81 21955.01 4.06%
Resource RPS-Gain RPS-Loss
Mana 4485.59 4765.26
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 174017.52 44400.00 295500.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.2%
shadowfiend-Mana Cap 4.2%
lightwell-Mana Cap 4.2%

Procs

Count Interval
Shadowy Recall Extra Tick 262.8 1.7sec
Shadowy Apparition Procced 57.7 7.7sec
FDCL Mind Spike proc 37.7 11.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Per Second
Count 49992
Mean 100140.17
Minimum 93278.79
Maximum 108498.88
Spread ( max - min ) 15220.09
Range [ ( max - min ) / 2 * 100% ] 7.60%
Standard Deviation 1987.1170
5th Percentile 96967.57
95th Percentile 103432.84
( 95th Percentile - 5th Percentile ) 6465.26
Mean Distribution
Standard Deviation 8.8874
95.00% Confidence Intervall ( 100122.75 - 100157.59 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1512
0.1 Scale Factor Error with Delta=300 33707
0.05 Scale Factor Error with Delta=300 134831
0.01 Scale Factor Error with Delta=300 3370781
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 100140.17
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43202572.94
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 275.63
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.81 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.13 shadow_word_death,if=active_enemies<=5
F 47.57 mind_blast,if=active_enemies<=6&cooldown_react
G 21.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.13 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.87 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.16 halo,if=talent.halo.enabled
M 15.09 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.05 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.85 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 33.12 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.25 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.65 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTRTFRTRTHTFGMTRTFRTHRTQFGJRTRLFMRWWHTFTRQFHTGTFMTHRRFRTLRGQFTHRTFMTGFHTRTFTHTFGLMRWWWWFHTFTHTGFMRTFHTLTFGTRHBRQFMTFGHTQFJRTRTHFGLMWRWRFWHTFTRTFGHMTRFTHLRFRGTRTQFMHRTFTGTHFRTQFMTGHLTWWWWWFRHTRRTFTRTGFHMTFTLHRTGFTRTFHMRTBGFTHTFTRRTEDEFGHLRTEEFJMRHTEEFGTPEDEFHRTEEF9GMHLTEEFRTPEDEFGHRTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl_no4PT14 : 102367 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
102367.2 102367.2 17.63 / 0.02% 3340 / 3.3% 20.6 4765.2 4485.1 Mana 0.43% 36.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://1.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:347153|140692|129777|124714|110597|98859|83380|50493&chds=0,694305&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++347153++devouring_plague,9482C9,0,0,15|t++140692++vampiric_touch,9482C9,1,0,15|t++129777++shadow_word_pain,9482C9,2,0,15|t++124714++halo,9482C9,3,0,15|t++110597++shadow_word_death,9482C9,4,0,15|t++98859++mind_blast,9482C9,5,0,15|t++83380++mind_spike,4A79D3,6,0,15|t++50493++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://2.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:18,13,11,9,9,8,6,6,5,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_spike|devouring_plague|mind_flay_mastery|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl_no4PT14 Damage Sources&chts=dddddd,18
http://4.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6864321zxxxwxvwuvvusrpmmmllllllkjihhgedcbaaaaaaaaabbbbbaaZZZZZaaaaaaaaZZZZZabbbcccccbbaaaZZaaZZZZYYYYYZaabcddeeeeeeddddeeddcbbaZYYYYYZZZaaaZZZZZZZZaaaaaaZZZZZaabbccddddddccccddeeeeeefeeeeeeffgghggfeeddcbbbbbbaaZZYYYYZZZaaabbbbbbbbbcccbbbbbbbbbbbbccccddddddddddccbbbaaaZZZZZZZZaaaaaaaaaaaaaaaZZZYYYXYYYYYYZZZaaaaabbbbbccbbbcccccddddeefffgghhhhhhhhhhgggggghiijjkllmnnnnnnnnnnnmmlkjjiihhggggggggghhhhhhiiihhhhhiiiiiijjjjjjjjjjjkkkkkjjjjjkkllmmnnnooooppppqqrrrrrrqqqppppppooooonnmmmmmmmmmmmmmmmmmnnnoopppqqqqppppppppqqqqppppoooonnnnnnnmlllmmlllllllllll&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5212,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=102367|max=196391&chxp=1,1,52,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Timeline&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,8,16,16,40,32,96,112,328,344,560,672,840,1072,1240,1480,1776,2072,2224,2384,3048,2600,3088,2888,2960,2528,2616,2384,2144,1680,1792,1176,1112,1016,880,696,576,304,296,280,176,112,120,88,24,16,24,16,8&chds=0,3088&chbh=5&chxt=x&chxl=0:|min=95257|avg=102367|max=109758&chxp=0,1,49,100&chtt=priest_90_tof_fdcl_no4PT14 DPS Distribution&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.2,12.5,10.4,9.7,8.2,5.0,4.0,2.9,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 208.1s|mind_blast 56.2s|shadow_word_pain 47.0s|mind_spike 43.6s|vampiric_touch 36.7s|devouring_plague 22.6s|shadow_word_death 18.1s|halo 13.1s|shadowfiend 2.4s|waiting 2.0s&chtt=priest_90_tof_fdcl_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl_no4PT14 102367
devouring_plague 6243 (17392) 6.1% (17.0%) 18.9 24.91sec 414224 347153 122436 253927 148697 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.91 18.91 0.00 0.00 1.1932 0.0000 2811267.32 2811267.32 0.00 347152.56 347152.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.13 80.03% 122436.20 107519 165536 122461.06 114035 132256 1852530 1852530 0.00
crit 3.78 19.97% 253927.11 221488 341004 250316.68 0 341004 958738 958738 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2675 2.6% 48.5 9.28sec 24821 0 20440 42354 24853 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.51 48.45 0.00 0.00 0.0000 0.0000 1204154.91 1204154.91 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.70 79.86% 20440.32 17856 27490 20446.16 19022 22092 790949 790949 0.00
crit 9.76 20.14% 42354.24 36784 56629 42362.37 36784 51853 413206 413206 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8475 8.3% 18.9 24.91sec 201838 0 0 0 0 0.0% 0.0% 0.0% 0.0% 154.8 20318 42092 24646 19.9% 0.0% 26.1%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.91 18.91 154.83 154.83 0.0000 0.7595 3815992.48 3815992.48 0.00 32450.85 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 124.1 80.12% 20318.10 17856 27490 20323.04 19413 21334 2520504 2520504 0.00
crit 30.8 19.88% 42091.90 36784 56629 42100.02 38908 46928 1295489 1295489 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3636) 0.0% (3.6%) 11.2 41.71sec 146602 124714 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 1.1755 0.0000 0.00 0.00 0.00 124713.77 124713.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.93 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.23 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3636 3.6% 11.2 41.71sec 146602 0 120932 250494 146602 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.17 11.17 0.00 0.00 0.0000 0.0000 1637117.69 1637117.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.95 80.19% 120932.14 109581 160794 120925.44 109581 131774 1082891 1082891 0.00
crit 2.21 19.81% 250493.78 225736 331235 228629.08 0 331235 554227 554227 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.71sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.17 236.56 0.00 0.00 0.0000 0.0000 0.00 47492518.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.04 76.95% 0.00 0 0 0.00 0 0 0 29311208 100.00
crit 54.52 23.05% 0.00 0 0 0.00 0 0 0 18181310 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12328 12.0% 47.3 9.58sec 117430 98859 96771 200509 117429 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.28 47.28 0.00 0.00 1.1879 0.0000 5551907.13 5551907.13 0.00 98858.75 98858.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.86 80.09% 96770.83 86183 133296 96797.41 93109 101354 3664062 3664062 0.00
crit 9.42 19.91% 200509.39 177536 274589 200579.11 177536 246089 1887845 1887845 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 17770 (23327) 17.4% (22.8%) 116.8 3.80sec 89969 50493 0 0 0 0.0% 0.0% 0.0% 0.0% 259.0 25471 52799 30913 19.9% 0.0% 42.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.81 116.81 258.99 258.99 1.7818 0.7411 8006122.67 8006122.67 0.00 50492.78 50492.78
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 207.4 80.09% 25470.80 22887 35236 25476.03 24817 26368 5282993 5282993 0.00
crit 51.6 19.91% 52798.93 47146 72586 52810.41 50311 56206 2723130 2723130 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5556 5.4% 81.0 5.42sec 30903 0 25482 52818 30922 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.00 80.95 0.00 0.00 0.0000 0.0000 2503090.99 2503090.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 64.84 80.10% 25482.36 22887 35236 25487.21 24278 26773 1652272 1652272 0.00
crit 16.11 19.90% 52818.14 47146 72586 52836.15 48340 60525 850819 850819 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 8075 7.9% 37.0 11.71sec 98320 83380 81091 168113 98320 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.1792 0.0000 3637522.08 3637522.08 0.00 83379.68 83379.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 29.67 80.20% 81090.88 72412 112341 81106.77 74758 87113 2406117 2406117 0.00
crit 7.32 19.80% 168113.34 149169 231423 168080.32 0 220802 1231405 1231405 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4430 4.3% 15.1 4.85sec 132101 110597 108434 224729 132099 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.13 15.13 0.00 0.00 1.1945 0.0000 1998487.28 1998487.28 0.00 110596.97 110596.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.05 79.65% 108434.10 83662 129665 108517.38 98350 119175 1306603 1306603 0.00
crit 3.08 20.35% 224729.39 172343 267111 216325.72 0 267111 691884 691884 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10330 (13563) 10.1% (13.2%) 39.6 11.36sec 154154 129777 0 0 0 0.0% 0.0% 0.0% 0.0% 235.3 14971 30964 19750 29.9% 0.0% 98.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 39.58 39.58 235.31 235.31 1.1879 1.8872 4647464.65 4647464.65 0.00 12423.69 129777.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.58 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 165.0 70.12% 14971.07 13422 20660 14972.70 14477 15497 2470143 2470143 0.00
crit 70.3 29.88% 30964.20 27649 42560 30965.78 29221 32824 2177322 2177322 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3233 3.2% 73.6 6.03sec 19761 0 14979 31008 19776 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.57 73.51 0.00 0.00 0.0000 0.0000 1453760.81 1453760.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.51 70.07% 14978.56 13422 20660 14980.21 14230 15782 771587 771587 0.00
crit 22.00 29.93% 31007.70 27649 42560 31012.41 28526 33925 682174 682174 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.88sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2237 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3943 3.9% 80.4 5.53sec 22067 0 18674 37589 22436 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.43 79.10 0.00 0.00 0.0000 0.0000 1774748.56 1774748.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.37 80.11% 18674.10 16669 25856 18675.31 17882 19556 1183374 1183374 0.00
crit 15.73 19.89% 37588.54 33338 51713 37592.64 33681 43575 591375 591375 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8754 (11471) 8.6% (11.2%) 30.9 14.67sec 167277 140692 0 0 0 0.0% 0.0% 0.0% 0.0% 191.7 16934 35113 20564 20.0% 0.0% 96.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.88 30.88 191.70 191.70 1.1890 2.2577 3942053.52 3942053.52 0.00 11002.31 140692.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.88 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.4 80.03% 16933.58 15001 23421 16936.95 16436 17518 2598073 2598073 0.00
crit 38.3 19.97% 35113.42 30902 48248 35124.64 32851 38512 1343981 1343981 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2718 2.7% 59.9 7.34sec 20427 0 16867 34954 20445 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.91 59.86 0.00 0.00 0.0000 0.0000 1223884.99 1223884.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.02 80.22% 16867.25 15001 23421 16871.58 16040 17812 809944 809944 0.00
crit 11.84 19.78% 34953.74 30902 48248 34969.44 30902 40362 413941 413941 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52876 / 4204
melee 52876 4.1% 33.3 11.81sec 56177 55474 48848 98790 56178 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.31 33.31 0.00 0.00 1.0127 0.0000 1870977.96 1870977.96 0.00 55474.19 55474.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.54 55.66% 48848.46 38145 58728 48865.55 44291 54996 905515 905515 0.00
crit 6.81 20.44% 98790.36 76291 117456 98727.97 0 117456 672610 672610 0.00
glance 7.96 23.90% 36792.40 28609 44046 36796.40 0 44046 292853 292853 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1934 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.90%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.23%
glyph_mind_spike 26.6 10.4 16.4sec 11.7sec 36.39% 52.98%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:28.62%
  • glyph_mind_spike_2:7.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.4sec 20.6sec 43.73% 44.01%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.73%

    Trigger Attempt Success

    • trigger_pct:2.20%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.76% 41.76%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.76%

    Trigger Attempt Success

    • trigger_pct:15.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.80% 49.48%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.80%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 32.0 5.7 13.6sec 11.5sec 20.33% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:18.63%
  • surge_of_darkness_2:1.70%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.0 114.1 0.0sec 0.6sec 16.14% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.60%

Buff details

  • buff initial source:priest_90_tof_fdcl_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl_no4PT14
devouring_plague Shadow Orb 18.9 56.7 3.0 3.0 138074.6
halo Mana 11.2 452265.1 40500.0 40499.9 3.6
mind_blast Mana 47.3 425507.0 9000.0 9000.0 13.0
mind_flay Mana 116.8 350425.4 3000.0 3000.0 30.0
shadow_word_death Mana 15.1 118005.9 7800.0 7800.2 16.9
shadow_word_pain Mana 39.6 522441.2 13200.0 13200.0 11.7
vampiric_touch Mana 30.9 277943.0 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.31 240598.42 (11.91%) 7224.03 59149.10 19.73%
Shadow Orbs from Mind Blast Shadow Orb 47.28 47.28 (86.08%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.64 7.64 (13.92%) 1.00 0.00 0.00%
Devouring Plague Health Health 203.28 0.00 (-nan%) 0.00 2822907.85 100.00%
Vampiric Touch Mana Mana 251.56 1261472.59 (62.44%) 5014.52 68327.57 5.14%
mp5_regen Mana 1801.40 518356.08 (25.66%) 287.75 22062.96 4.08%
Resource RPS-Gain RPS-Loss
Mana 4485.10 4765.16
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 173836.53 32700.00 298500.00
Shadow Orb 1.20 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 4.2%
shadowfiend-Mana Cap 4.2%
lightwell-Mana Cap 4.2%

Procs

Count Interval
Shadowy Recall Extra Tick 262.8 1.7sec
Shadowy Apparition Procced 80.4 5.5sec
FDCL Mind Spike proc 37.7 11.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Per Second
Count 49992
Mean 102367.17
Minimum 95256.87
Maximum 109758.03
Spread ( max - min ) 14501.17
Range [ ( max - min ) / 2 * 100% ] 7.08%
Standard Deviation 2010.7313
5th Percentile 99113.85
95th Percentile 105794.85
( 95th Percentile - 5th Percentile ) 6681.00
Mean Distribution
Standard Deviation 8.9930
95.00% Confidence Intervall ( 102349.55 - 102384.80 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1482
0.1 Scale Factor Error with Delta=300 34513
0.05 Scale Factor Error with Delta=300 138054
0.01 Scale Factor Error with Delta=300 3451371
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 102367.17
Distribution Chart

Damage

Sample Data
Count 49992
Mean 44207575.09
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 275.69
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.82 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.13 shadow_word_death,if=active_enemies<=5
F 47.58 mind_blast,if=active_enemies<=6&cooldown_react
G 21.95 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.14 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 3.86 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.17 halo,if=talent.halo.enabled
M 15.09 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 2.02 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.84 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 33.14 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 62.34 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.63 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTHTFGMRTQFRTHTRTFGTRTLWWWWWFHMTFTHRTGFTRTFHMJLRGQFTHTFTRQFGHMTFRTHTFGLWWWWWWFHJMRTFTHTGFTFHMTLTGFTBHTFTFGHMTQFRTHTGFLRWRWRWQFHTRFMRTRTHFGTRQFTHTLFMGTFHRTRRFTGHTFMTFGHLWWWWWFRTHTFMTGTFHTFRTHLGTFMRTFHTBGQFTHTFMRTEEGFHLTPEDEFRTHEEFGMTRPEEFHTPEDEFGT9HLPEEFMRTEEFGHTREDEFRT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no2PT14 : 101347 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
101347.1 101347.1 15.36 / 0.02% 2857 / 2.8% 18.4 4938.1 4809.5 Mana 0.46% 32.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://5.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:348797|140839|124962|110728|110600|98533|50913&chds=0,697594&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++348797++devouring_plague,9482C9,0,0,15|t++140839++vampiric_touch,9482C9,1,0,15|t++124962++halo,9482C9,2,0,15|t++110728++shadow_word_pain,9482C9,3,0,15|t++110600++shadow_word_death,9482C9,4,0,15|t++98533++mind_blast,9482C9,5,0,15|t++50913++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,13,12,11,10,9,7,7,5,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|mindbender: melee|shadow_word_pain|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no2PT14 Damage Sources&chts=dddddd,18
http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:5677865310000z0y0zyxwurqonmmmnmlkjiigecbaZYYZZYZZaaaabccbcdeffhjjjjjiiggghgghghhfgffedbbbbbbcbaaZYXWWXYZZacdeeffffgghiikklkjiihffeeedddccbccbbbbbbabbbcbccccbcccbbbabaabccccccccdeeeeeffffggggfffggfgggffffffeedcbbaZaaZZYYXXWWXXXXYYYYZabbbcefgghijjjkkkkklmlllkjihgffeedddccccbbaaaaaaaaaaaZZYYYYXXXWXXXYabbcddeffhhiijjkkjjkjihhggffffeefffgghiiiiiiiihiihhhhhhgghhhiijjklmnoooppooooooonnmmllkjjiihhhhiiijjjjiiiijjjjjjjjjjjjjkklmnnopqqrrssssstuuuvvvuuuuttssssssstttsssrrqqqqppppppooonnnnoopqrrsttuvwwxxxyyzzzzyyxwvuutssrrrrrrrqqqppooooonnnnnmmlkjjiiihhhhh&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5585,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=101347|max=181456&chxp=1,1,56,100&chtt=priest_90_tof_mb_no2PT14 DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,8,16,16,32,24,72,72,168,176,264,336,632,680,1000,1272,1568,1680,2136,2456,2568,2656,2688,2976,2840,2984,2712,2720,2504,2176,1904,1528,1528,1400,960,872,544,512,312,328,288,112,72,64,56,40,32&chds=0,2984&chbh=5&chxt=x&chxl=0:|min=94124|avg=101347|max=107189&chxp=0,1,55,100&chtt=priest_90_tof_mb_no2PT14 DPS Distribution&chts=dddddd,18 http://7.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.5,11.7,11.4,8.1,4.7,4.0,2.9,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 245.5s|mind_blast 52.8s|shadow_word_pain 51.4s|vampiric_touch 36.7s|devouring_plague 21.3s|shadow_word_death 18.0s|halo 13.1s|mindbender 8.3s|waiting 2.1s&chtt=priest_90_tof_mb_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no2PT14 101347
devouring_plague 5931 (16528) 5.9% (16.3%) 17.9 26.50sec 416070 348797 123099 255007 149329 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.89 17.89 0.00 0.00 1.1929 0.0000 2671817.39 2671817.39 0.00 348797.16 348797.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.33 80.11% 123098.69 107519 165536 123124.33 115066 133509 1764509 1764509 0.00
crit 3.56 19.89% 255006.92 221488 341004 250449.78 0 341004 907308 907308 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2534 2.5% 45.8 9.84sec 24920 0 20555 42575 24955 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.78 45.72 0.00 0.00 0.0000 0.0000 1140960.94 1140960.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.58 80.02% 20555.06 17856 27490 20562.33 19224 22093 751956 751956 0.00
crit 9.14 19.98% 42574.67 36784 56629 42581.39 0 51044 389005 389005 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8063 8.0% 17.9 26.50sec 202972 0 0 0 0 0.0% 0.0% 0.0% 0.0% 146.5 20421 42306 24782 19.9% 0.0% 24.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.89 17.89 146.54 146.54 0.0000 0.7586 3631599.51 3631599.51 0.00 32666.49 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.3 80.07% 20421.43 17856 27490 20425.26 19503 21583 2396284 2396284 0.00
crit 29.2 19.93% 42305.53 36784 56629 42313.95 38942 47100 1235316 1235316 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3642) 0.0% (3.6%) 11.2 41.69sec 146705 124962 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 11.18 0.00 0.00 1.1741 0.0000 0.00 0.00 0.00 124961.70 124961.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.98 80.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.66% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3642 3.6% 11.2 41.69sec 146705 0 120989 250488 146710 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 11.18 0.00 0.00 0.0000 0.0000 1639622.45 1639622.45 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.96 80.14% 120989.35 109581 160794 120986.88 110474 131972 1083696 1083696 0.00
crit 2.22 19.86% 250488.17 225736 331235 229578.58 0 331235 555927 555927 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.69sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.18 236.75 0.00 0.00 0.0000 0.0000 0.00 47559399.43 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.11 76.92% 0.00 0 0 0.00 0 0 0 29336020 100.00
crit 54.63 23.08% 0.00 0 0 0.00 0 0 0 18223379 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11540 11.4% 44.3 10.25sec 117436 98533 96839 200897 117438 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.27 44.27 0.00 0.00 1.1919 0.0000 5198581.40 5198581.40 0.00 98532.63 98532.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.50 80.21% 96838.59 86183 133296 96861.08 92774 100846 3438214 3438214 0.00
crit 8.76 19.79% 200897.00 177536 274589 200979.44 179346 235608 1760368 1760368 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 21129 (27743) 20.9% (27.4%) 135.6 3.28sec 92172 50913 0 0 0 0.0% 0.0% 0.0% 0.0% 307.8 25491 52833 30936 19.9% 0.0% 50.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.63 135.63 307.76 307.76 1.8104 0.7417 9520834.80 9520834.80 0.00 50913.36 50913.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.63 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 246.5 80.09% 25490.77 22887 35236 25496.39 24927 26182 6282722 6282722 0.00
crit 61.3 19.91% 52833.43 47146 72586 52846.41 50296 55818 3238113 3238113 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6614 6.5% 96.4 4.57sec 30928 0 25490 52854 30948 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.36 96.30 0.00 0.00 0.0000 0.0000 2980277.98 2980277.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.10 80.06% 25490.04 22887 35236 25496.20 24516 26709 1965181 1965181 0.00
crit 19.21 19.94% 52854.38 47146 72586 52865.15 47919 58472 1015097 1015097 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1970 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4406 4.4% 15.0 4.87sec 132121 110600 108481 225349 132120 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 15.04 0.00 0.00 1.1946 0.0000 1986704.05 1986704.05 0.00 110599.79 110599.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.00 79.77% 108481.29 83662 129665 108577.91 98592 120702 1301271 1301271 0.00
crit 3.04 20.23% 225348.86 172343 267111 217238.35 0 267111 685433 685433 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 9647 (12663) 9.5% (12.5%) 43.3 10.36sec 131539 110728 0 0 0 0.0% 0.0% 0.0% 0.0% 239.0 14970 31014 18155 19.9% 0.0% 98.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.30 43.30 239.01 239.01 1.1880 1.8597 4339266.46 4339266.46 0.00 11485.14 110728.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 191.6 80.15% 14970.44 13422 20660 14971.57 14469 15549 2867722 2867722 0.00
crit 47.4 19.85% 31014.22 27649 42560 31015.21 29074 32828 1471545 1471545 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3016 3.0% 74.8 5.93sec 18145 0 14976 31057 18158 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.77 74.71 0.00 0.00 0.0000 0.0000 1356594.65 1356594.65 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.93 80.22% 14976.18 13422 20660 14978.30 14205 15879 897535 897535 0.00
crit 14.78 19.78% 31056.71 27649 42560 31059.80 28202 35281 459060 459060 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 2851 2.8% 58.2 7.60sec 22049 0 18684 37575 22417 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.18 57.23 0.00 0.00 0.0000 0.0000 1282852.10 1282852.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.92 80.24% 18684.08 16669 25856 18685.18 17794 19840 858001 858001 0.00
crit 11.31 19.76% 37574.95 33338 51713 37583.59 33338 44865 424851 424851 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8753 (11476) 8.6% (11.3%) 30.9 14.68sec 167511 140839 0 0 0 0.0% 0.0% 0.0% 0.0% 191.7 16935 35118 20569 20.0% 0.0% 96.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.85 30.85 191.65 191.65 1.1894 2.2583 3942169.76 3942169.76 0.00 11008.22 140839.08
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.3 80.01% 16934.63 15001 23421 16938.03 16407 17610 2596844 2596844 0.00
crit 38.3 19.99% 35118.31 30902 48248 35127.16 32921 38022 1345326 1345326 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2723 2.7% 60.0 7.33sec 20433 0 16867 34975 20451 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.02 59.97 0.00 0.00 0.0000 0.0000 1226342.70 1226342.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.10 80.21% 16866.87 15001 23421 16869.97 16013 17866 811294 811294 0.00
crit 11.87 19.79% 34975.11 30902 48248 34983.95 0 44996 415049 415049 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40485 / 10499
melee 40485 10.3% 107.3 4.10sec 43995 41336 38420 77459 43995 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.28 107.28 0.00 0.00 1.0643 0.0000 4719689.52 4719689.52 0.00 41335.88 41335.88
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.90 55.84% 38420.29 30516 46982 38440.53 35993 40679 2301514 2301514 0.00
crit 21.61 20.15% 77459.01 61032 93964 77484.66 71204 85103 1674163 1674163 0.00
glance 25.76 24.01% 28880.58 22887 35237 28893.68 26611 31402 744013 744013 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 1.1908 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.74%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.11% 20.11%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.11%

    Trigger Attempt Success

    • trigger_pct:16.35%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.5sec 20.6sec 43.62% 43.89%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.62%

    Trigger Attempt Success

    • trigger_pct:2.19%
light_of_the_cosmos 9.6 0.0 48.8sec 48.8sec 41.90% 41.90%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.90%

    Trigger Attempt Success

    • trigger_pct:14.95%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.77% 49.53%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.0 110.9 0.0sec 0.7sec 16.13% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.38% 84.09%

Buff details

  • buff initial source:priest_90_tof_mb_no2PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no2PT14
devouring_plague Shadow Orb 17.9 53.7 3.0 3.0 138689.8
halo Mana 11.2 452641.0 40500.0 40499.9 3.6
mind_blast Mana 44.3 398404.8 9000.0 9000.0 13.0
mind_flay Mana 135.6 406882.1 3000.0 3000.0 30.7
shadow_word_death Mana 15.0 117292.0 7800.0 7800.2 16.9
shadow_word_pain Mana 43.3 571585.3 13200.0 13200.1 10.0
vampiric_touch Mana 30.9 277691.0 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.28 419212.81 (19.35%) 3907.68 50772.25 10.80%
Shadow Orbs from Mind Blast Shadow Orb 44.27 44.27 (85.36%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.59 7.59 (14.64%) 1.00 0.00 0.00%
Devouring Plague Health Health 192.26 0.00 (-nan%) 0.00 2669875.19 100.00%
Vampiric Touch Mana Mana 251.62 1239072.40 (57.19%) 4924.41 90741.20 6.82%
mp5_regen Mana 1801.40 508275.46 (23.46%) 282.16 32143.58 5.95%
Resource RPS-Gain RPS-Loss
Mana 4809.50 4938.11
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 242065.70 155604.76 300000.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 6.0%
shadowfiend-Mana Cap 6.0%
lightwell-Mana Cap 6.0%

Procs

Count Interval
Shadowy Recall Extra Tick 276.7 1.6sec
Shadowy Apparition Procced 58.2 7.6sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no2PT14 Damage Per Second
Count 49992
Mean 101347.10
Minimum 94124.07
Maximum 107188.73
Spread ( max - min ) 13064.66
Range [ ( max - min ) / 2 * 100% ] 6.45%
Standard Deviation 1752.6848
5th Percentile 98561.63
95th Percentile 104274.84
( 95th Percentile - 5th Percentile ) 5713.21
Mean Distribution
Standard Deviation 7.8389
95.00% Confidence Intervall ( 101331.74 - 101362.47 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1148
0.1 Scale Factor Error with Delta=300 26223
0.05 Scale Factor Error with Delta=300 104894
0.01 Scale Factor Error with Delta=300 2622354
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 101347.10
Distribution Chart

Damage

Sample Data
Count 49992
Mean 40917624.20
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 246.80
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.90 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.04 shadow_word_death,if=active_enemies<=5
F 44.86 mind_blast,if=active_enemies<=6&cooldown_react
G 21.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.09 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.18 halo,if=talent.halo.enabled
M 13.99 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.76 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 8.33 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 65.45 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 21.34 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTHTFGMTFTHTFGTLWWWWWFHMTAFTHTGTQFTHQFMTLTGTFTHTFTGTHQFMTFAHTGLTWWWWWWFHTQFMTHTGFTFHLTFGMTHATFTFGHTFMTHLTGWWWWWFTHTQFTGFHMATQFTLHTGFTFHMTGQFTHTQFTLTGFHMWWWAWFHTFTHTGQFMTLHFTGFTHTFMTGAFHTLFTEDEGHQFTEETFHDEEGTQFTEDEHFLTEEGF9AHMTEEQFTEDEFGHTPEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb_no4PT14 : 103568 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
103568.3 103568.3 15.66 / 0.02% 2911 / 2.8% 18.8 4938.2 4809.1 Mana 0.45% 32.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:349066|140685|125095|120493|110502|98493|50886&chds=0,698131&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++349066++devouring_plague,9482C9,0,0,15|t++140685++vampiric_touch,9482C9,1,0,15|t++125095++halo,9482C9,2,0,15|t++120493++shadow_word_pain,9482C9,3,0,15|t++110502++shadow_word_death,9482C9,4,0,15|t++98493++mind_blast,9482C9,5,0,15|t++50886++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:23,12,11,11,9,9,7,6,5,4,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|mindbender: melee|vampiric_touch|devouring_plague_tick|mind_flay_mastery|devouring_plague|shadow_word_death|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_mb_no4PT14 Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:5677865310001z0z0zyxwvsqpnnmnnnmkkjihfdcbZYZZaZaabbbbbcdccdefghjkjjjiihghhhghhhhgggfedcbbbbccbaaZYYXWXZZabceeffggggghijkllljjihgffeeeedddccccccbbbbbcccccccccccccbbbbbbccccccccddeefefffffggggggggggggggggffffeddcbbaaaaZZYYYXXXXXYYZZZZabbcdefghijjjkkklkllmmllkjihggffeedddccccbbbaaabbbbaaaZZYYYYXXXXXXZabccdeefghiijjkkkkkkjihhhggffgffffggghiiiijjiiiiiihhhhhgghhiijjkllnoooppppoooppoonnmllkkjiiihhiiijjjjjjjjjjjjkkkkkkkjjkkllmnoppqrrsssssttuvvvvvvuuutttssssstttttsssrrrqqqqqppppooonnoopqqrsstuvvwxxyyyzz0zzzyxwwvuttssrrrrrrrqqqpppoooonnnnnmmlkkjjjjjiii&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5656,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=103568|max=183113&chxp=1,1,57,100&chtt=priest_90_tof_mb_no4PT14 DPS Timeline&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,8,0,16,32,80,136,208,216,376,320,504,672,920,1184,1568,1648,2000,2192,2432,2664,2512,2872,2728,2920,2672,2536,2392,2456,1856,1952,1432,1480,1120,1000,616,512,464,384,264,160,168,88,96,64,24,0,16,8&chds=0,2920&chbh=5&chxt=x&chxl=0:|min=97164|avg=103568|max=109979&chxp=0,1,50,100&chtt=priest_90_tof_mb_no4PT14 DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:54.5,11.7,11.4,8.1,4.7,4.0,2.9,1.8,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 245.5s|mind_blast 52.8s|shadow_word_pain 51.4s|vampiric_touch 36.7s|devouring_plague 21.3s|shadow_word_death 18.0s|halo 13.1s|mindbender 8.3s|waiting 2.0s&chtt=priest_90_tof_mb_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb_no4PT14 103568
devouring_plague 5938 (16540) 5.7% (16.0%) 17.9 26.50sec 416361 349066 123109 254973 149461 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.89 17.89 0.00 0.00 1.1928 0.0000 2674429.99 2674429.99 0.00 349065.71 349065.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.32 80.02% 123109.34 107519 165536 123129.30 113628 133956 1762751 1762751 0.00
crit 3.58 19.98% 254972.70 221488 341004 249944.50 0 341004 911679 911679 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2536 2.4% 45.9 9.83sec 24911 0 20545 42579 24946 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.86 45.79 0.00 0.00 0.0000 0.0000 1142340.15 1142340.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.64 80.02% 20545.22 17856 27490 20550.87 19143 22378 752873 752873 0.00
crit 9.15 19.98% 42578.99 36784 56629 42588.47 0 52890 389468 389468 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8067 7.8% 17.9 26.50sec 203065 0 0 0 0 0.0% 0.0% 0.0% 0.0% 146.6 20419 42324 24791 20.0% 0.0% 24.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.89 17.89 146.57 146.57 0.0000 0.7586 3633688.30 3633688.30 0.00 32679.99 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.3 80.04% 20419.42 17856 27490 20423.41 19574 21540 2395484 2395484 0.00
crit 29.3 19.96% 42323.79 36784 56629 42330.65 39298 46478 1238204 1238204 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3647) 0.0% (3.5%) 11.2 41.69sec 146854 125095 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 11.18 0.00 0.00 1.1740 0.0000 0.00 0.00 0.00 125095.00 125095.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.23 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3647 3.5% 11.2 41.69sec 146854 0 120976 250509 146857 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.18 11.18 0.00 0.00 0.0000 0.0000 1641246.38 1641246.38 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.94 80.02% 120975.99 109581 160794 120962.15 110653 132804 1081909 1081909 0.00
crit 2.23 19.98% 250508.77 225736 331235 228877.09 0 331235 559337 559337 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.2 41.69sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.18 236.76 0.00 0.00 0.0000 0.0000 0.00 47548097.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 182.16 76.94% 0.00 0 0 0.00 0 0 0 29342785 100.00
crit 54.59 23.06% 0.00 0 0 0.00 0 0 0 18205312 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11537 11.1% 44.3 10.25sec 117404 98493 96859 200699 117406 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.28 44.28 0.00 0.00 1.1920 0.0000 5198065.22 5198065.22 0.00 98492.97 98492.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.52 80.21% 96858.73 86183 133296 96883.97 92522 100971 3439943 3439943 0.00
crit 8.76 19.79% 200698.86 177536 274589 200766.43 177536 256681 1758122 1758122 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 21122 (27726) 20.4% (26.8%) 135.6 3.28sec 92117 50886 0 0 0 0.0% 0.0% 0.0% 0.0% 307.7 25488 52837 30926 19.9% 0.0% 50.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.62 135.62 307.75 307.75 1.8103 0.7417 9517581.83 9517581.83 0.00 50885.63 50885.63
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 135.62 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 246.6 80.12% 25488.31 22887 35236 25494.24 24910 26114 6284180 6284180 0.00
crit 61.2 19.88% 52837.39 47146 72586 52850.52 50194 55869 3233401 3233401 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6604 6.4% 96.3 4.57sec 30906 0 25495 52835 30926 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.27 96.21 0.00 0.00 0.0000 0.0000 2975348.62 2975348.62 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 77.09 80.13% 25494.99 22887 35236 25501.38 24217 27133 1965532 1965532 0.00
crit 19.11 19.87% 52835.18 47146 72586 52847.09 48765 59021 1009817 1009817 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.82sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1969 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4403 4.3% 15.0 4.86sec 132006 110502 108446 225000 132006 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.04 15.04 0.00 0.00 1.1946 0.0000 1985389.36 1985389.36 0.00 110502.00 110502.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.00 79.79% 108445.74 83662 129665 108529.56 99542 119376 1301350 1301350 0.00
crit 3.04 20.21% 224999.71 172343 267111 217606.83 0 267111 684039 684039 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 10494 (13781) 10.1% (13.3%) 43.3 10.36sec 143143 120493 0 0 0 0.0% 0.0% 0.0% 0.0% 239.0 14970 30962 19750 29.9% 0.0% 98.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.30 43.30 238.98 238.98 1.1880 1.8597 4720042.49 4720042.49 0.00 12500.09 120493.06
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 43.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 167.5 70.11% 14969.94 13422 20660 14971.24 14388 15578 2508161 2508161 0.00
crit 71.4 29.89% 30962.26 27649 42560 30964.35 29632 32991 2211882 2211882 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3287 3.2% 74.9 5.92sec 19753 0 14976 30989 19768 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.85 74.80 0.00 0.00 0.0000 0.0000 1478602.37 1478602.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.42 70.08% 14975.90 13422 20660 14977.46 14310 15738 784984 784984 0.00
crit 22.38 29.92% 30989.45 27649 42560 30994.96 28553 34288 693619 693619 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 3973 3.8% 81.0 5.49sec 22067 0 18677 37578 22435 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.03 79.70 0.00 0.00 0.0000 0.0000 1788177.56 1788177.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 63.85 80.11% 18676.59 16669 25856 18677.94 17916 19591 1192546 1192546 0.00
crit 15.85 19.89% 37577.82 33338 51713 37578.53 33990 44108 595631 595631 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8750 (11464) 8.4% (11.1%) 30.9 14.68sec 167340 140685 0 0 0 0.0% 0.0% 0.0% 0.0% 191.6 16932 35123 20560 19.9% 0.0% 96.1%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.85 30.85 191.65 191.65 1.1895 2.2582 3940279.10 3940279.10 0.00 10995.96 140685.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.4 80.06% 16931.84 15001 23421 16935.57 16426 17481 2597791 2597791 0.00
crit 38.2 19.94% 35122.78 30902 48248 35130.59 32778 38041 1342488 1342488 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2714 2.6% 59.8 7.35sec 20423 0 16864 34941 20441 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.84 59.79 0.00 0.00 0.0000 0.0000 1222160.15 1222160.15 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.96 80.22% 16864.16 15001 23421 16866.87 16012 18152 808830 808830 0.00
crit 11.83 19.78% 34940.96 30902 48248 34952.95 30902 42725 413330 413330 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40489 / 10498
melee 40489 10.1% 107.2 4.10sec 44006 41346 38425 77458 44006 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.24 107.24 0.00 0.00 1.0643 0.0000 4719445.17 4719445.17 0.00 41346.41 41346.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.86 55.81% 38424.68 30516 46982 38445.14 36490 40932 2300044 2300044 0.00
crit 21.64 20.18% 77458.28 61032 93964 77487.12 70068 84301 1676096 1676096 0.00
glance 25.75 24.01% 28868.70 22887 35237 28880.27 26805 31581 743305 743305 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.23sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.40 23.40 0.00 0.00 1.1908 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.40 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.75%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.6sec 108.6sec 20.12% 20.12%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.12%

    Trigger Attempt Success

    • trigger_pct:16.36%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 8.9 36.4sec 20.6sec 43.66% 43.93%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.66%

    Trigger Attempt Success

    • trigger_pct:2.19%
light_of_the_cosmos 9.6 0.0 48.9sec 48.9sec 41.86% 41.86%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.86%

    Trigger Attempt Success

    • trigger_pct:14.95%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.77% 49.54%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.77%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.0 114.5 0.0sec 0.6sec 16.14% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.39% 84.09%

Buff details

  • buff initial source:priest_90_tof_mb_no4PT14_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb_no4PT14
devouring_plague Shadow Orb 17.9 53.7 3.0 3.0 138785.7
halo Mana 11.2 452628.0 40500.0 40499.9 3.6
mind_blast Mana 44.3 398476.8 9000.0 9000.0 13.0
mind_flay Mana 135.6 406858.6 3000.0 3000.0 30.7
shadow_word_death Mana 15.0 117317.0 7800.0 7800.2 16.9
shadow_word_pain Mana 43.3 571610.7 13200.0 13200.0 10.8
vampiric_touch Mana 30.9 277650.7 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.25 419295.30 (19.35%) 3909.68 50541.87 10.76%
Shadow Orbs from Mind Blast Shadow Orb 44.28 44.28 (85.36%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.59 7.59 (14.64%) 1.00 0.00 0.00%
Devouring Plague Health Health 192.36 0.00 (-nan%) 0.00 2671250.52 100.00%
Vampiric Touch Mana Mana 251.44 1238604.83 (57.17%) 4926.03 90666.85 6.82%
mp5_regen Mana 1801.40 508482.61 (23.47%) 282.27 31936.43 5.91%
Resource RPS-Gain RPS-Loss
Mana 4809.11 4938.21
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 241841.65 147804.76 300000.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 5.9%
shadowfiend-Mana Cap 5.9%
lightwell-Mana Cap 5.9%

Procs

Count Interval
Shadowy Recall Extra Tick 276.6 1.6sec
Shadowy Apparition Procced 81.0 5.5sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_mb_no4PT14 Damage Per Second
Count 49992
Mean 103568.34
Minimum 97164.34
Maximum 109979.11
Spread ( max - min ) 12814.78
Range [ ( max - min ) / 2 * 100% ] 6.19%
Standard Deviation 1786.2797
5th Percentile 100727.81
95th Percentile 106549.41
( 95th Percentile - 5th Percentile ) 5821.60
Mean Distribution
Standard Deviation 7.9891
95.00% Confidence Intervall ( 103552.68 - 103584.00 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1142
0.1 Scale Factor Error with Delta=300 27238
0.05 Scale Factor Error with Delta=300 108953
0.01 Scale Factor Error with Delta=300 2723846
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 103568.34
Distribution Chart

Damage

Sample Data
Count 49992
Mean 41917351.53
Distribution Chart

DTPS

Sample Data priest_90_tof_mb_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 246.83
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.91 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.04 shadow_word_death,if=active_enemies<=5
F 44.89 mind_blast,if=active_enemies<=6&cooldown_react
G 21.97 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 31.09 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.18 halo,if=talent.halo.enabled
M 13.98 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.74 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 8.33 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 65.45 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 21.34 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGHLTFTHTGFMTFHTGFTLWWWWWFHMTAFTHTGQFTHQFMTLTGFTHTFTGHFMTFAHTGLTWWWWWWFHTQFMTHTGFTFHLTGQFMTHTATFTGHFTFMTHLGTWWWWWWFHTFTHGTFMATFHLTGTFTHTFMTGTFHTQFTGHLTWWWAWFMHTFTGHFTFMHLTGTFTHTQFTGTAFHMTFTEEGHLQFMTEETFHTEDEGQFTHEETFMTEEGF9AHLTEDEFTGHEEFMTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no2PT14 : 98486 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
98486.0 98486.0 19.82 / 0.02% 3597 / 3.7% 18.2 5179.2 4632.0 Mana 0.59% 35.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://3.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:348916|148411|140791|124196|110654|98544|97879|50942&chds=0,697832&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++348916++devouring_plague,9482C9,0,0,15|t++148411++shadow_word_insanity,9482C9,1,0,15|t++140791++vampiric_touch,9482C9,2,0,15|t++124196++halo,9482C9,3,0,15|t++110654++shadow_word_death,9482C9,4,0,15|t++98544++shadow_word_pain,9482C9,5,0,15|t++97879++mind_blast,9482C9,6,0,15|t++50942++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no2PT14 Damage Per Execute Time&&chts=dddddd,18 http://4.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:21,12,9,9,9,8,6,6,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|shadow_word_insanity|mind_flay_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|shadowy_apparition|devouring_plague_mastery&chtt=priest_90_tof_swi_no2PT14 Damage Sources&chts=dddddd,18
http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6864321z0yxyzxywxwvtsronpnmmmklljihgfdcaaYXYYWXYZZZZZZZZYZZaZaaccbbbaZZYYZYYZaZaabcdccbbbbbcdcaaaaYYYZZZaabeffffeeeeeffgffdcbaZXVUVUUUUUVVVWWXXYZZZabbbbbbbbaabbbbaaaaabccccccdefghhggggggfffeeeeffeddcccbcccccbbaaZYYXXWXWWWVWWVWWYYZYYabbbccdddddddddcbbbcddcccbbaaabbbaaabbbbbaaZZZaaaaaZZZZZZZYYXXXWWVWWWWWWXXXXXXXYZaaaabcbbbbcccbcdddeedeefggggggggfgggfffeffghiijkklmnnnnnnnnnnmllkkjjiihggggggggghhiiiiiihhhhhhiiiiijjjiiiiiiijjjjkkjjjjjjjkklllmmmnnnnooopppqqqqqppppooooooonnnnmmlllkkkkkkkkkkkkkkkkkkkkllllllllllkkkkkkkkkkjjjjiiihhhgggfffffffffeeeeeeee&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5115,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=98486|max=192534&chxp=1,1,51,100&chtt=priest_90_tof_swi_no2PT14 DPS Timeline&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,0,0,8,24,16,8,16,8,16,64,96,128,128,128,168,176,248,368,496,784,1048,1296,1688,2264,2952,3128,3648,3656,3640,3776,3704,3272,2640,2672,2072,1584,1248,840,752,400,264,240,104,72,56,24,24,24&chds=0,3776&chbh=5&chxt=x&chxl=0:|min=86093|avg=98486|max=106381&chxp=0,1,61,100&chtt=priest_90_tof_swi_no2PT14 DPS Distribution&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:50.4,11.8,11.7,8.1,4.8,4.7,3.9,2.8,0.5,0.3,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 227.0s|shadow_word_pain 53.3s|mind_blast 52.8s|vampiric_touch 36.5s|shadow_word_insanity 21.6s|devouring_plague 21.2s|shadow_word_death 17.7s|halo 12.7s|shadowfiend 2.4s|dispersion 1.3s|waiting 2.7s&chtt=priest_90_tof_swi_no2PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no2PT14 98486
devouring_plague 5901 (16459) 6.0% (16.7%) 17.8 26.62sec 416086 348916 122863 254370 149181 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 17.81 0.00 0.00 1.1925 0.0000 2657661.07 2657661.07 0.00 348916.20 348916.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.25 79.98% 122862.69 107519 165536 122887.93 113466 132690 1750655 1750655 0.00
crit 3.57 20.02% 254370.32 221488 341004 248748.00 0 341004 907006 907006 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2535 2.6% 45.8 9.83sec 24922 0 20521 42570 24957 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.80 45.74 0.00 0.00 0.0000 0.0000 1141491.47 1141491.47 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.54 79.88% 20521.28 17856 27490 20527.07 19288 22392 749813 749813 0.00
crit 9.20 20.12% 42570.17 36784 56629 42546.18 0 54087 391678 391678 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8023 8.2% 17.8 26.62sec 202824 0 0 0 0 0.0% 0.0% 0.0% 0.0% 146.1 20383 42225 24732 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 17.81 146.09 146.09 0.0000 0.7580 3613223.10 3613223.10 0.00 32627.69 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.0 80.09% 20383.33 17856 27490 20387.93 19475 21708 2384899 2384899 0.00
crit 29.1 19.91% 42225.13 36784 56629 42233.09 38721 46564 1228324 1228324 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3500) 0.0% (3.5%) 10.8 42.31sec 145803 124196 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.1740 0.0000 0.00 0.00 0.00 124195.65 124195.65
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.64 80.04% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.96% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3500 3.5% 10.8 42.31sec 145803 0 120431 248930 145808 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 0.0000 0.0000 1573062.09 1573062.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.66 80.25% 120430.99 109581 160794 120444.20 110653 131728 1042752 1042752 0.00
crit 2.13 19.75% 248930.49 225736 331235 226095.27 0 331235 530310 530310 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 42.31sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.79 228.76 0.00 0.00 0.0000 0.0000 0.00 45788779.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.02 76.94% 0.00 0 0 0.00 0 0 0 28256338 100.00
crit 52.74 23.06% 0.00 0 0 0.00 0 0 0 17532442 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no2PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11469 11.7% 44.1 10.27sec 117219 97879 96702 200427 117218 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.08 44.08 0.00 0.00 1.1976 0.0000 5166535.22 5166535.22 0.00 97878.85 97878.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.36 80.22% 96702.36 86183 133296 96723.67 92790 100985 3419193 3419193 0.00
crit 8.72 19.78% 200426.55 177536 274589 200558.53 177536 245621 1747342 1747342 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 19550 (25669) 19.9% (26.1%) 126.3 3.51sec 91540 50942 0 0 0 0.0% 0.0% 0.0% 0.0% 285.0 25472 52795 30906 19.9% 0.0% 46.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.32 126.32 284.96 284.96 1.7969 0.7414 8806744.69 8806744.69 0.00 50941.84 50941.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.32 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 228.3 80.11% 25471.82 22887 35236 25475.70 24763 26069 5814846 5814846 0.00
crit 56.7 19.89% 52795.09 47146 72586 52802.80 50270 55941 2991898 2991898 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6119 6.2% 89.3 4.91sec 30885 0 25473 52799 30902 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.25 89.21 0.00 0.00 0.0000 0.0000 2756645.63 2756645.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.49 80.13% 25473.10 22887 35236 25476.73 24404 26742 1820965 1820965 0.00
crit 17.72 19.87% 52798.59 47146 72586 52804.22 48340 59654 935681 935681 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4354 4.4% 14.8 4.93sec 132211 110654 108327 224860 132206 20.5% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 0.00 0.00 1.1948 0.0000 1961899.66 1961899.66 0.00 110654.24 110654.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.80 79.51% 108327.43 83662 129665 108410.76 98509 119714 1278037 1278037 0.00
crit 3.04 20.49% 224859.65 172343 267111 216611.17 0 267111 683863 683863 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7093 7.2% 18.3 23.63sec 175279 148411 144431 299494 175283 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.28 18.28 0.00 0.00 1.1811 0.0000 3203745.93 3203745.93 0.00 148410.89 148410.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.64 80.11% 144431.07 128911 199962 144427.43 133239 157731 2114717 2114717 0.00
crit 3.64 19.89% 299493.90 265556 411923 292725.87 0 411923 1089029 1089029 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 8902 (11677) 9.0% (11.8%) 44.8 9.98sec 117196 98544 0 0 0 0.0% 0.0% 0.0% 0.0% 220.3 14979 31050 18163 19.8% 0.0% 88.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.80 44.80 220.33 220.33 1.1893 1.8024 4001977.22 4001977.22 0.00 11656.06 98543.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.80 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.7 80.18% 14978.78 13422 20660 14980.29 14438 15475 2646264 2646264 0.00
crit 43.7 19.82% 31049.73 27649 42560 31052.63 29140 33410 1355713 1355713 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 2775 2.8% 68.9 6.41sec 18107 0 14952 30981 18120 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.92 68.86 0.00 0.00 0.0000 0.0000 1247841.95 1247841.95 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.25 80.23% 14951.80 13422 20660 14953.24 14281 15816 826100 826100 0.00
crit 13.61 19.77% 30981.35 27649 42560 30980.19 27649 35162 421742 421742 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.94sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2228 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 2645 2.7% 53.9 8.17sec 22068 0 18653 37532 22393 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.93 53.15 0.00 0.00 0.0000 0.0000 1190249.81 1190249.81 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.63 80.19% 18653.34 16669 25856 18653.34 17540 19788 795106 795106 0.00
crit 10.53 19.81% 37532.12 33338 51713 37520.21 0 45714 395143 395143 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8714 (11418) 8.9% (11.6%) 30.7 14.67sec 167427 140791 0 0 0 0.0% 0.0% 0.0% 0.0% 191.0 16923 35088 20546 19.9% 0.0% 95.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.71 30.71 190.97 190.97 1.1892 2.2585 3923580.25 3923580.25 0.00 10990.24 140791.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 152.9 80.05% 16922.56 15001 23421 16926.03 16263 17583 2587101 2587101 0.00
crit 38.1 19.95% 35088.02 30902 48248 35095.82 32955 37960 1336479 1336479 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2704 2.7% 59.6 7.35sec 20437 0 16850 34938 20453 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.60 59.55 0.00 0.00 0.0000 0.0000 1217982.78 1217982.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.69 80.08% 16850.46 15001 23421 16851.97 15872 18283 803582 803582 0.00
crit 11.86 19.92% 34938.41 30902 48248 34940.19 31294 41022 414401 414401 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52872 / 4201
melee 52872 4.2% 33.3 11.80sec 56161 55480 48833 98816 56160 20.5% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.29 33.29 0.00 0.00 1.0123 0.0000 1869612.34 1869612.34 0.00 55479.76 55479.76
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.49 55.53% 48833.37 38145 58728 48846.62 43747 54169 902687 902687 0.00
crit 6.82 20.48% 98815.64 76291 117456 98811.05 0 117456 673622 673622 0.00
glance 7.99 24.00% 36715.99 28609 44046 36728.83 0 44046 293303 293303 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.28sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1930 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.91%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.09% 20.09%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.09%

    Trigger Attempt Success

    • trigger_pct:16.36%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.8 36.6sec 20.8sec 43.45% 43.74%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.45%

    Trigger Attempt Success

    • trigger_pct:2.23%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.70% 41.70%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.70%

    Trigger Attempt Success

    • trigger_pct:14.97%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.5 0.0 10.2sec 10.2sec 9.71% 49.13%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.71%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.0 106.0 0.0sec 0.7sec 16.13% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.37% 78.62%

Buff details

  • buff initial source:priest_90_tof_swi_no2PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no2PT14
devouring_plague Shadow Orb 17.8 53.4 3.0 3.0 138695.1
halo Mana 10.8 436952.9 40500.0 40500.1 3.6
mind_blast Mana 44.1 396684.0 9000.0 9000.0 13.0
mind_flay Mana 126.3 378964.8 3000.0 3000.0 30.5
shadow_word_death Mana 14.8 115749.5 7800.0 7800.3 16.9
shadow_word_insanity Mana 18.3 137079.6 7500.0 7499.7 23.4
shadow_word_pain Mana 44.8 591296.6 13200.0 13200.0 8.9
vampiric_touch Mana 30.7 276383.5 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 1.63 29318.40 (1.41%) 18000.00 0.00 0.00%
shadowfiend Mana 33.29 247538.98 (11.86%) 7435.75 52074.62 17.38%
Shadow Orbs from Mind Blast Shadow Orb 44.08 44.08 (85.38%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.55 7.55 (14.62%) 1.00 0.00 0.00%
Devouring Plague Health Health 191.83 0.00 (-nan%) 0.00 2663898.39 100.00%
Vampiric Touch Mana Mana 250.52 1283389.63 (61.51%) 5122.95 41069.09 3.10%
mp5_regen Mana 1801.40 526372.99 (25.23%) 292.20 14046.05 2.60%
Resource RPS-Gain RPS-Loss
Mana 4632.04 5179.22
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 53513.92 0.00 280800.00
Shadow Orb 1.18 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 263.4 1.7sec
Shadowy Apparition Procced 53.9 8.2sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no2PT14 Damage Per Second
Count 49992
Mean 98486.02
Minimum 86092.66
Maximum 106380.63
Spread ( max - min ) 20287.98
Range [ ( max - min ) / 2 * 100% ] 10.30%
Standard Deviation 2261.3153
5th Percentile 94860.65
95th Percentile 102055.15
( 95th Percentile - 5th Percentile ) 7194.49
Mean Distribution
Standard Deviation 10.1137
95.00% Confidence Intervall ( 98466.19 - 98505.84 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 2025
0.1 Scale Factor Error with Delta=300 43652
0.05 Scale Factor Error with Delta=300 174608
0.01 Scale Factor Error with Delta=300 4365217
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 98486.02
Distribution Chart

Damage

Sample Data
Count 49992
Mean 42462640.86
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no2PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no2PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no2PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 267.83
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.88 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.84 shadow_word_death,if=active_enemies<=5
F 45.09 mind_blast,if=active_enemies<=6&cooldown_react
G 22.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.89 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.28 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.79 halo,if=talent.halo.enabled
M 13.94 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 11.36 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 10.00 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.77 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 22.47 shadow_word_pain,moving=1
X 0.21 dispersion

Sample Sequence

DFGHLTFTHIGFMTQFTHTIGTFTLWWWWWFHMTFTHTIGFTFHMIGLTQFTHTFIGTFHMTIFGTHTLFWWWWWWQFHTQFMTHGTFTFHLTIGTFMTBHTFIGTFHTIFGMLHTWWWWWWFTHTFTIGTHFMTLFHGTFTHTFIGMTQFHTIFGLTHTWWWWWWFMTHTFTIGHQFTLTFMIGHTQFTHFIGTBTFMTHTIGFLTEEHFMTIGEEQFTHTEDEFIGTEEFHLMTPEEFG9THTEDEFTIEEFGHMTEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no2PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi_no4PT14 : 100572 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
100572.3 100572.3 19.88 / 0.02% 3654 / 3.6% 18.6 5179.7 4633.4 Mana 0.58% 35.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600

Charts

http://7.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:348590|148449|140806|124417|110288|107220|97905|50922&chds=0,697180&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++348590++devouring_plague,9482C9,0,0,15|t++148449++shadow_word_insanity,9482C9,1,0,15|t++140806++vampiric_touch,9482C9,2,0,15|t++124417++halo,9482C9,3,0,15|t++110288++shadow_word_death,9482C9,4,0,15|t++107220++shadow_word_pain,9482C9,5,0,15|t++97905++mind_blast,9482C9,6,0,15|t++50922++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi_no4PT14 Damage Per Execute Time&&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:20,12,10,9,8,7,6,6,5,4,4,4,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=mind_flay|mind_blast|shadow_word_pain|vampiric_touch|devouring_plague_tick|shadow_word_insanity|mind_flay_mastery|devouring_plague|shadow_word_death|shadowfiend: melee|shadowy_apparition|halo_damage|shadow_word_pain_mastery|vampiric_touch_mastery|devouring_plague_mastery&chtt=priest_90_tof_swi_no4PT14 Damage Sources&chts=dddddd,18
http://0.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6864321z0yxyzxyxxwvttrooponmnlmmjihhfecbaYXZZXYZZaaaaaaZYZaaabbdcbbbbaZYYaZYZbaaaccdccbbbbcddcbbbaZZZZaZabcfgfffeefefggggfeccaZYVVVVVVVVWVVWWXYZZaaabbbbbbbbbbbcbbbbaabcccccddefghhhghhgggggffefffffeddccccccccccbaZZZYYXXXWWWWWWWXYZZZZacbbcdddddeeddddcbbdddccccbbbbcbbbbbbbccbaaaZaabbbaaaaaaZZZYYXXXXWWXXXXXXXYXYYYZabababcccbcccccdeeeeeeeffhhhhhhgggggggffffghhijjklmnnnoonnnnnnnmllkkjjihgggggggghhiiijjiiihhhhiiiijjjjjjjjjijjjjkkkkkkkkkkkklllmmmnnnoooopppqqqqqqqqpppoooooooonnmmmllkkkkklllkkkkkkkkkkkllllmmmmllllllllkkkkkkkjjjiiiihhhggffffgfffffffefee&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5194,0.4&chxt=x,y&chxl=0:|0|sec=548|1:|0|avg=100572|max=193620&chxp=1,1,52,100&chtt=priest_90_tof_swi_no4PT14 DPS Timeline&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,0,8,24,24,16,32,24,48,56,88,72,104,56,96,160,328,304,448,744,752,1224,1584,1800,2200,2528,3128,3400,3752,3808,3608,3600,3144,2704,2472,1896,1472,1368,824,624,608,368,208,104,56,40,16,32,8,8&chds=0,3808&chbh=5&chxt=x&chxl=0:|min=89054|avg=100572|max=108675&chxp=0,1,59,100&chtt=priest_90_tof_swi_no4PT14 DPS Distribution&chts=dddddd,18 http://9.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:50.4,11.8,11.7,8.1,4.8,4.7,3.9,2.8,0.5,0.3,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,C79C6E,ffffff&chl=mind_flay 226.9s|shadow_word_pain 53.3s|mind_blast 52.8s|vampiric_touch 36.5s|shadow_word_insanity 21.6s|devouring_plague 21.2s|shadow_word_death 17.7s|halo 12.7s|shadowfiend 2.4s|dispersion 1.3s|waiting 2.6s&chtt=priest_90_tof_swi_no4PT14 Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi_no4PT14 100572
devouring_plague 5897 (16445) 5.9% (16.4%) 17.8 26.62sec 415669 348590 122853 254539 149076 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.82 17.82 0.00 0.00 1.1925 0.0000 2656165.33 2656165.33 0.00 348589.92 348589.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.27 80.09% 122853.48 107519 165536 122878.16 113158 132269 1753029 1753029 0.00
crit 3.55 19.91% 254539.16 221488 341004 249114.21 0 341004 903136 903136 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2525 2.5% 45.7 9.86sec 24872 0 20523 42549 24906 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.70 45.64 0.00 0.00 0.0000 0.0000 1136718.70 1136718.70 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.56 80.10% 20522.80 17856 27490 20528.50 19189 22298 750303 750303 0.00
crit 9.08 19.90% 42548.88 36784 56629 42556.75 0 52381 386415 386415 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8023 8.0% 17.8 26.62sec 202794 0 0 0 0 0.0% 0.0% 0.0% 0.0% 146.1 20387 42213 24728 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.82 17.82 146.12 146.12 0.0000 0.7580 3613257.47 3613257.47 0.00 32624.76 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.82 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 117.1 80.11% 20387.13 17856 27490 20391.53 19524 21555 2386496 2386496 0.00
crit 29.1 19.89% 42212.64 36784 56629 42222.40 39151 46407 1226762 1226762 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (3507) 0.0% (3.5%) 10.8 42.32sec 146045 124417 0 0 0 19.6% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 1.1739 0.0000 0.00 0.00 0.00 124417.03 124417.03
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.68 80.41% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.11 19.59% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 3507 3.5% 10.8 42.32sec 146045 0 120467 249217 146048 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.79 10.79 0.00 0.00 0.0000 0.0000 1575617.31 1575617.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.65 80.13% 120467.46 109581 160794 120472.45 110653 132344 1041487 1041487 0.00
crit 2.14 19.87% 249216.95 225736 331235 226612.23 0 331235 534131 534131 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.8 42.32sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.79 228.79 0.00 0.00 0.0000 0.0000 0.00 45826234.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 175.99 76.92% 0.00 0 0 0.00 0 0 0 28268585 100.00
crit 52.80 23.08% 0.00 0 0 0.00 0 0 0 17557649 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi_no4PT14
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11475 11.4% 44.1 10.27sec 117244 97905 96721 200437 117243 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.10 44.10 0.00 0.00 1.1975 0.0000 5169982.06 5169982.06 0.00 97905.20 97905.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.37 80.21% 96720.93 86183 133296 96737.95 92290 101000 3421063 3421063 0.00
crit 8.73 19.79% 200437.01 177536 274589 200479.06 177536 241034 1748919 1748919 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 19541 (25651) 19.4% (25.5%) 126.3 3.51sec 91516 50922 0 0 0 0.0% 0.0% 0.0% 0.0% 284.9 25471 52794 30903 19.9% 0.0% 46.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.27 126.27 284.87 284.87 1.7972 0.7413 8803514.11 8803514.11 0.00 50922.46 50922.46
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.27 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 228.2 80.12% 25471.19 22887 35236 25474.25 24810 26298 5813460 5813460 0.00
crit 56.6 19.88% 52793.96 47146 72586 52803.87 49492 55585 2990054 2990054 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 6109 6.1% 89.1 4.92sec 30886 0 25469 52812 30903 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.10 89.06 0.00 0.00 0.0000 0.0000 2752117.09 2752117.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.36 80.13% 25469.16 22887 35236 25471.75 24387 26641 1817460 1817460 0.00
crit 17.70 19.87% 52811.74 47146 72586 52816.39 48325 57778 934657 934657 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4340 4.3% 14.8 4.93sec 131760 110288 108380 224591 131759 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 0.00 0.00 1.1947 0.0000 1955626.23 1955626.23 0.00 110287.97 110287.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.86 79.88% 108380.15 83662 129665 108465.51 98824 119659 1284987 1284987 0.00
crit 2.99 20.12% 224591.22 172343 267111 216196.96 0 267111 670639 670639 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 7114 7.1% 18.3 23.58sec 175332 148449 144431 299269 175334 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.33 18.33 0.00 0.00 1.1811 0.0000 3213465.45 3213465.45 0.00 148448.54 148448.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.67 80.04% 144430.88 128911 199962 144419.12 134511 156969 2118823 2118823 0.00
crit 3.66 19.96% 299269.20 265556 411923 292929.85 0 411923 1094643 1094643 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 9680 (12706) 9.6% (12.6%) 44.8 9.98sec 127539 107220 0 0 0 0.0% 0.0% 0.0% 0.0% 220.2 14979 30998 19759 29.8% 0.0% 88.1%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.79 44.79 220.24 220.24 1.1895 1.8026 4351771.59 4351771.59 0.00 12685.98 107220.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 44.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 154.5 70.16% 14979.13 13422 20660 14980.53 14523 15510 2314445 2314445 0.00
crit 65.7 29.84% 30997.85 27649 42560 31001.10 29344 32721 2037327 2037327 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 3026 3.0% 69.1 6.40sec 19695 0 14954 30939 19708 29.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.07 69.02 0.00 0.00 0.0000 0.0000 1360279.98 1360279.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.49 70.26% 14954.24 13422 20660 14955.68 14047 15731 725180 725180 0.00
crit 20.53 29.74% 30938.94 27649 42560 30941.55 28538 34469 635100 635100 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2229 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 3717 3.7% 75.8 5.85sec 22074 0 18652 37519 22400 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.77 74.67 0.00 0.00 0.0000 0.0000 1672607.56 1672607.56 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.84 80.14% 18652.29 16669 25856 18653.11 17777 19596 1116101 1116101 0.00
crit 14.83 19.86% 37518.73 33338 51713 37523.41 33853 42253 556507 556507 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 8707 (11418) 8.7% (11.4%) 30.7 14.67sec 167478 140806 0 0 0 0.0% 0.0% 0.0% 0.0% 190.9 16922 35088 20533 19.9% 0.0% 95.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.70 30.70 190.94 190.94 1.1894 2.2586 3920681.98 3920681.98 0.00 10992.08 140806.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 30.70 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 153.0 80.12% 16922.42 15001 23421 16925.78 16240 17559 2588963 2588963 0.00
crit 38.0 19.88% 35087.62 30902 48248 35097.26 32328 38236 1331719 1331719 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:5
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 2711 2.7% 59.8 7.33sec 20434 0 16854 34947 20450 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.76 59.71 0.00 0.00 0.0000 0.0000 1221147.99 1221147.99 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.84 80.12% 16853.66 15001 23421 16854.03 15890 17831 806326 806326 0.00
crit 11.87 19.88% 34946.67 30902 48248 34951.95 30902 42569 414822 414822 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52838 / 4199
melee 52838 4.1% 33.3 11.80sec 56145 55452 48847 98730 56144 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.29 33.29 0.00 0.00 1.0125 0.0000 1868833.61 1868833.61 0.00 55451.71 55451.71
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.52 55.65% 48847.31 38145 58728 48861.78 44293 54673 904758 904758 0.00
crit 6.80 20.44% 98730.21 76291 117456 98699.07 0 117456 671632 671632 0.00
glance 7.96 23.92% 36733.11 28609 44046 36742.91 0 44046 292444 292444 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.26sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.95 5.95 0.00 0.00 1.1929 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.95 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.91%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 108.7sec 108.7sec 20.09% 20.09%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.09%

    Trigger Attempt Success

    • trigger_pct:16.27%
jade_serpent_potion 1.0 0.0 421.2sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.5sec 20.7sec 43.58% 43.91%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.58%

    Trigger Attempt Success

    • trigger_pct:2.24%
light_of_the_cosmos 9.6 0.0 49.0sec 49.0sec 41.71% 41.71%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:41.71%

    Trigger Attempt Success

    • trigger_pct:14.98%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.5 0.0 10.2sec 10.2sec 9.70% 49.15%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.70%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.0 109.4 0.0sec 0.7sec 16.13% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:16.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.3sec 74.3sec 83.36% 78.64%

Buff details

  • buff initial source:priest_90_tof_swi_no4PT14_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi_no4PT14
devouring_plague Shadow Orb 17.8 53.5 3.0 3.0 138554.8
halo Mana 10.8 436933.4 40500.0 40499.5 3.6
mind_blast Mana 44.1 396865.4 9000.0 9000.0 13.0
mind_flay Mana 126.3 378805.4 3000.0 3000.0 30.5
shadow_word_death Mana 14.8 115774.5 7800.0 7800.3 16.9
shadow_word_insanity Mana 18.3 137460.0 7500.0 7500.0 23.4
shadow_word_pain Mana 44.8 591184.7 13200.0 13200.0 9.7
vampiric_touch Mana 30.7 276314.4 9000.0 9000.0 18.6
Resource Gains Type Count Total Average Overflow
dispersion Mana 1.65 29675.52 (1.42%) 18000.00 0.00 0.00%
shadowfiend Mana 33.29 247531.97 (11.86%) 7436.47 52044.19 17.37%
Shadow Orbs from Mind Blast Shadow Orb 44.10 44.10 (85.39%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.55 7.55 (14.61%) 1.00 0.00 0.00%
Devouring Plague Health Health 191.76 0.00 (-nan%) 0.00 2662954.10 100.00%
Vampiric Touch Mana Mana 250.66 1283638.56 (61.50%) 5121.08 41168.64 3.11%
mp5_regen Mana 1801.40 526387.78 (25.22%) 292.21 14031.26 2.60%
Resource RPS-Gain RPS-Loss
Mana 4633.40 5179.73
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 53899.28 0.00 289800.00
Shadow Orb 1.19 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.7%
shadowfiend-Mana Cap 2.7%
lightwell-Mana Cap 2.7%

Procs

Count Interval
Shadowy Recall Extra Tick 263.4 1.7sec
Shadowy Apparition Procced 75.8 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data priest_90_tof_swi_no4PT14 Damage Per Second
Count 49992
Mean 100572.28
Minimum 89054.39
Maximum 108675.24
Spread ( max - min ) 19620.85
Range [ ( max - min ) / 2 * 100% ] 9.75%
Standard Deviation 2267.8300
5th Percentile 96847.66
95th Percentile 104155.40
( 95th Percentile - 5th Percentile ) 7307.74
Mean Distribution
Standard Deviation 10.1429
95.00% Confidence Intervall ( 100552.40 - 100592.16 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1953
0.1 Scale Factor Error with Delta=300 43904
0.05 Scale Factor Error with Delta=300 175616
0.01 Scale Factor Error with Delta=300 4390405
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 100572.28
Distribution Chart

Damage

Sample Data
Count 49992
Mean 43402952.85
Distribution Chart

DTPS

Sample Data priest_90_tof_swi_no4PT14 Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi_no4PT14 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi_no4PT14 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 267.62
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 3.89 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.84 shadow_word_death,if=active_enemies<=5
F 45.12 mind_blast,if=active_enemies<=6&cooldown_react
G 22.32 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 30.90 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 18.33 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.79 halo,if=talent.halo.enabled
M 13.93 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 10.95 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 10.08 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 60.81 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 22.47 shadow_word_pain,moving=1
X 0.21 dispersion

Sample Sequence

DFGHLTFTHIGFMTFTHTIGTFTLWWWWWFHMTFTHTIGFTFHMTIGLQFTHTFTIGTFHMTIFGTHTFLWWWWWTFHMTFTHGTFTHQFMLIGTFTBHTFIGTHQFMTIFGTHLTWWWWWWFTHTFMTHGFTQFLHTIGTFMTHTFTIGTFHTIFGLMHTWWWWWWFTHTFTIGHTFMTLTFIGHTFTHIFGMTBTFHTIGLFTEDEHTFTIEEGTFHDPEETFTIEDEGHFLTPEET9FHDEEGTFTEDEHTFIGTEET

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi_no4PT14"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 356 - 549 ( 450.5 )

Performance:
Total Events Processed: 2123653480
Max Event Queue: 301
Sim Seconds: 22523762
CPU Seconds: 6191.1300
Speed Up: 3638

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Standard Deviation 54.4907
5th Percentile 367.41
95th Percentile 536.99
( 95th Percentile - 5th Percentile ) 169.57
Mean Distribution
Standard Deviation 0.2437
95.00% Confidence Intervall ( 450.00 - 450.95 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 562
0.1% Error 56208
0.1 Scale Factor Error with Delta=300 25
0.05 Scale Factor Error with Delta=300 101
0.01 Scale Factor Error with Delta=300 2534
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague 2944 3008258 6678 2.80 117840 244052 21.1 21.1 19.8% 0.0% 0.0% 0.0% 22.23sec 3008258 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_mastery 124467 1295512 2876 7.23 19664 40718 54.4 54.3 19.9% 0.0% 0.0% 0.0% 8.27sec 1295512 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 devouring_plague_tick ticks -2944 4128863 9175 23.18 19587 40551 21.1 173.8 19.9% 0.0% 0.0% 0.0% 22.23sec 4128863 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.6% 0.0% 0.0% 0.0% 41.79sec 0 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_damage 120696 1596783 3545 1.48 118194 244607 11.1 11.1 19.8% 0.0% 0.0% 0.0% 41.79sec 1596783 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 halo_heal 120696 0 0 31.38 0 0 11.1 235.6 23.1% 0.0% 0.0% 0.0% 41.79sec 46305279 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_blast 8092 6162136 13679 7.16 94530 195760 53.8 53.8 19.9% 0.0% 0.0% 0.0% 8.41sec 6162136 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay ticks -15407 7522375 16716 32.91 25110 52011 112.5 246.8 20.0% 0.0% 0.0% 0.0% 3.94sec 7522375 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_flay_mastery 124468 2353481 5224 10.28 25113 52067 77.2 77.2 19.9% 0.0% 0.0% 0.0% 5.67sec 2353481 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 mind_spike 73510 3551503 7884 4.93 79193 163987 37.0 37.0 19.8% 0.0% 0.0% 0.0% 11.71sec 3551503 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_death 32379 1737785 3858 2.01 94599 196473 15.1 15.1 20.4% 0.0% 0.0% 0.0% 4.86sec 1737785 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain ticks -589 4172335 9272 31.18 14707 30467 38.0 233.9 19.9% 0.0% 0.0% 0.0% 11.86sec 4172335 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadow_word_pain_mastery 124464 1299084 2884 9.74 14662 30365 73.2 73.1 19.8% 0.0% 0.0% 0.0% 6.06sec 1299084 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 shadowy_apparition 87532 1242679 2759 7.53 18299 36787 57.5 56.6 19.8% 0.0% 0.0% 0.0% 7.70sec 1242679 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch ticks -34914 3858997 8576 25.54 16582 34365 30.9 191.6 20.0% 0.0% 0.0% 0.0% 14.68sec 3858997 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14 vampiric_touch_mastery 124465 1194747 2652 7.97 16471 34130 59.9 59.8 19.8% 0.0% 0.0% 0.0% 7.35sec 1194747 450.48sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend melee 0 1873439 52883 56.43 48890 98811 33.3 33.3 20.5% 0.0% 24.0% 0.0% 11.80sec 1873439 35.43sec
priest_90_di_fdcl_no2PT14 priest_90_di_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.23sec 0 35.43sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague 2944 3000640 6661 2.80 117815 243950 21.0 21.0 19.7% 0.0% 0.0% 0.0% 22.25sec 3000640 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_mastery 124467 1294532 2874 7.22 19654 40694 54.3 54.2 20.0% 0.0% 0.0% 0.0% 8.28sec 1294532 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 devouring_plague_tick ticks -2944 4125542 9168 23.16 19583 40539 21.0 173.7 19.9% 0.0% 0.0% 0.0% 22.25sec 4125542 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.7% 0.0% 0.0% 0.0% 41.80sec 0 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_damage 120696 1593809 3538 1.48 118159 244721 11.1 11.1 19.7% 0.0% 0.0% 0.0% 41.80sec 1593809 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 halo_heal 120696 0 0 31.36 0 0 11.1 235.4 23.1% 0.0% 0.0% 0.0% 41.80sec 46272093 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_blast 8092 6160983 13677 7.16 94521 195788 53.7 53.7 19.9% 0.0% 0.0% 0.0% 8.41sec 6160983 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay ticks -15407 7532711 16739 32.97 25111 52025 112.7 247.3 19.9% 0.0% 0.0% 0.0% 3.94sec 7532711 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_flay_mastery 124468 2357963 5234 10.30 25118 52055 77.4 77.3 20.0% 0.0% 0.0% 0.0% 5.66sec 2357963 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 mind_spike 73510 3537577 7853 4.90 79187 163973 36.8 36.8 19.9% 0.0% 0.0% 0.0% 11.76sec 3537577 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_death 32379 1736157 3854 2.01 94625 196368 15.1 15.1 20.2% 0.0% 0.0% 0.0% 4.86sec 1736157 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain ticks -589 4532867 10073 31.17 14702 30405 37.9 233.8 29.9% 0.0% 0.0% 0.0% 11.87sec 4532867 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadow_word_pain_mastery 124464 1413334 3137 9.74 14660 30306 73.2 73.1 29.8% 0.0% 0.0% 0.0% 6.06sec 1413334 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.85sec 0 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 shadowy_apparition 87532 1731521 3844 10.51 18284 36774 80.2 78.9 19.8% 0.0% 0.0% 0.0% 5.55sec 1731521 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch ticks -34914 3856773 8571 25.54 16584 34380 30.9 191.6 19.9% 0.0% 0.0% 0.0% 14.68sec 3856773 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14 vampiric_touch_mastery 124465 1196577 2656 7.98 16462 34119 59.9 59.9 19.9% 0.0% 0.0% 0.0% 7.34sec 1196577 450.48sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend melee 0 1872474 52853 56.43 48906 98760 33.3 33.3 20.5% 0.0% 24.1% 0.0% 11.80sec 1872474 35.43sec
priest_90_di_fdcl_no4PT14 priest_90_di_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.25sec 0 35.43sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague 2944 2907274 6454 2.71 117929 244174 20.3 20.3 19.8% 0.0% 0.0% 0.0% 23.09sec 2907274 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_mastery 124467 1252108 2780 6.99 19675 40781 52.5 52.5 19.9% 0.0% 0.0% 0.0% 8.57sec 1252108 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 devouring_plague_tick ticks -2944 3993088 8874 22.39 19602 40587 20.3 167.9 19.9% 0.0% 0.0% 0.0% 23.09sec 3993088 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.79sec 0 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_damage 120696 1596225 3543 1.48 118156 244620 11.1 11.1 19.8% 0.0% 0.0% 0.0% 41.79sec 1596225 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 halo_heal 120696 0 0 31.41 0 0 11.1 235.8 23.0% 0.0% 0.0% 0.0% 41.79sec 46326510 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_blast 8092 5919092 13140 6.88 94493 195733 51.6 51.6 19.9% 0.0% 0.0% 0.0% 8.76sec 5919092 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay ticks -15407 9042535 20095 39.60 25100 52012 131.8 297.0 19.9% 0.0% 0.0% 0.0% 3.37sec 9042535 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mind_flay_mastery 124468 2825719 6273 12.37 25105 52021 92.9 92.9 19.8% 0.0% 0.0% 0.0% 4.74sec 2825719 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.83sec 0 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_death 32379 1730171 3841 2.00 94644 196436 15.0 15.0 20.2% 0.0% 0.0% 0.0% 4.88sec 1730171 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain ticks -589 4212457 9361 31.51 14702 30449 40.6 236.3 19.8% 0.0% 0.0% 0.0% 11.07sec 4212457 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadow_word_pain_mastery 124464 1314041 2917 9.85 14655 30340 74.0 73.9 19.9% 0.0% 0.0% 0.0% 5.99sec 1314041 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 shadowy_apparition 87532 1249266 2773 7.57 18291 36773 57.8 56.9 19.9% 0.0% 0.0% 0.0% 7.65sec 1249266 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch ticks -34914 3846459 8548 25.49 16582 34372 30.8 191.1 19.9% 0.0% 0.0% 0.0% 14.72sec 3846459 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14 vampiric_touch_mastery 124465 1193844 2650 7.96 16467 34105 59.8 59.8 19.9% 0.0% 0.0% 0.0% 7.35sec 1193844 450.48sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender melee 0 4718297 40423 55.16 38411 77402 107.3 107.3 20.1% 0.0% 24.0% 0.0% 4.09sec 4718297 116.72sec
priest_90_di_mb_no2PT14 priest_90_di_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.23sec 0 116.72sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague 2944 2910419 6461 2.71 117913 244198 20.4 20.4 19.9% 0.0% 0.0% 0.0% 23.08sec 2910419 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_mastery 124467 1248426 2771 6.97 19671 40769 52.4 52.3 19.9% 0.0% 0.0% 0.0% 8.59sec 1248426 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 devouring_plague_tick ticks -2944 3991445 8870 22.39 19599 40584 20.4 167.9 19.9% 0.0% 0.0% 0.0% 23.08sec 3991445 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.8% 0.0% 0.0% 0.0% 41.80sec 0 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_damage 120696 1599135 3550 1.48 118174 244453 11.1 11.1 20.0% 0.0% 0.0% 0.0% 41.80sec 1599135 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 halo_heal 120696 0 0 31.39 0 0 11.1 235.7 23.0% 0.0% 0.0% 0.0% 41.80sec 46291312 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_blast 8092 5914844 13130 6.88 94501 195661 51.6 51.6 19.8% 0.0% 0.0% 0.0% 8.76sec 5914844 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay ticks -15407 9045793 20102 39.59 25101 51996 131.7 296.9 19.9% 0.0% 0.0% 0.0% 3.37sec 9045793 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mind_flay_mastery 124468 2833728 6291 12.39 25102 52022 93.1 93.0 19.9% 0.0% 0.0% 0.0% 4.73sec 2833728 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.84sec 0 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_death 32379 1728961 3838 2.00 94635 196067 15.0 15.0 20.1% 0.0% 0.0% 0.0% 4.88sec 1728961 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain ticks -589 4584823 10188 31.51 14699 30397 40.6 236.3 29.9% 0.0% 0.0% 0.0% 11.06sec 4584823 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadow_word_pain_mastery 124464 1428459 3171 9.84 14653 30301 73.9 73.9 29.9% 0.0% 0.0% 0.0% 6.00sec 1428459 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 shadowy_apparition 87532 1743181 3870 10.58 18285 36759 80.8 79.4 19.8% 0.0% 0.0% 0.0% 5.51sec 1743181 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch ticks -34914 3849446 8554 25.49 16585 34381 30.8 191.2 19.9% 0.0% 0.0% 0.0% 14.72sec 3849446 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14 vampiric_touch_mastery 124465 1194074 2651 7.96 16469 34115 59.8 59.8 19.9% 0.0% 0.0% 0.0% 7.35sec 1194074 450.48sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender melee 0 4716912 40409 55.17 38403 77394 107.3 107.3 20.1% 0.0% 24.1% 0.0% 4.09sec 4716912 116.73sec
priest_90_di_mb_no4PT14 priest_90_di_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.23sec 0 116.73sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague 2944 2889034 6413 2.69 117870 244080 20.2 20.2 19.9% 0.0% 0.0% 0.0% 23.27sec 2889034 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_mastery 124467 1245144 2764 6.94 19676 40767 52.2 52.1 19.9% 0.0% 0.0% 0.0% 8.62sec 1245144 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 devouring_plague_tick ticks -2944 3963140 8807 22.23 19593 40563 20.2 166.7 19.9% 0.0% 0.0% 0.0% 23.27sec 3963140 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 20.0% 0.0% 0.0% 0.0% 41.97sec 0 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_damage 120696 1589399 3528 1.48 118053 244289 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.97sec 1589399 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 halo_heal 120696 0 0 31.01 0 0 11.1 232.9 23.0% 0.0% 0.0% 0.0% 41.97sec 45708765 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_blast 8092 5874136 13040 6.82 94498 195657 51.2 51.2 20.0% 0.0% 0.0% 0.0% 8.83sec 5874136 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay ticks -15407 8408954 18687 36.80 25104 52002 123.1 276.0 19.9% 0.0% 0.0% 0.0% 3.61sec 8408954 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 mind_flay_mastery 124468 2625048 5827 11.48 25102 52024 86.3 86.2 19.9% 0.0% 0.0% 0.0% 5.10sec 2625048 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_death 32379 1730871 3842 2.00 94616 196229 15.0 15.0 20.3% 0.0% 0.0% 0.0% 4.87sec 1730871 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_insanity 129249 3098882 6879 2.40 141650 293263 18.1 18.1 19.8% 0.0% 0.0% 0.0% 23.80sec 3098882 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain ticks -589 3916203 8703 29.25 14714 30486 42.2 219.4 19.9% 0.0% 0.0% 0.0% 10.64sec 3916203 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadow_word_pain_mastery 124464 1218079 2704 9.13 14656 30350 68.6 68.5 19.9% 0.0% 0.0% 0.0% 6.46sec 1218079 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 shadowy_apparition 87532 1169976 2597 7.10 18291 36793 54.2 53.3 19.8% 0.0% 0.0% 0.0% 8.16sec 1169976 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch ticks -34914 3863196 8585 25.60 16582 34366 30.9 192.0 19.9% 0.0% 0.0% 0.0% 14.64sec 3863196 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14 vampiric_touch_mastery 124465 1199647 2663 8.00 16471 34116 60.1 60.1 19.8% 0.0% 0.0% 0.0% 7.31sec 1199647 450.48sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend melee 0 1874188 52909 56.41 48888 98835 33.3 33.3 20.6% 0.0% 24.0% 0.0% 11.80sec 1874188 35.42sec
priest_90_di_swi_no2PT14 priest_90_di_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.23sec 0 35.42sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague 2944 2886417 6407 2.69 117881 243981 20.2 20.2 19.8% 0.0% 0.0% 0.0% 23.26sec 2886417 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_mastery 124467 1244726 2763 6.94 19677 40759 52.2 52.1 19.9% 0.0% 0.0% 0.0% 8.62sec 1244726 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 devouring_plague_tick ticks -2944 3961555 8803 22.23 19592 40558 20.2 166.7 19.9% 0.0% 0.0% 0.0% 23.26sec 3961555 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.8% 0.0% 0.0% 0.0% 41.99sec 0 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_damage 120696 1590054 3530 1.48 118046 244543 11.1 11.1 20.0% 0.0% 0.0% 0.0% 41.99sec 1590054 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 halo_heal 120696 0 0 30.97 0 0 11.1 232.5 23.1% 0.0% 0.0% 0.0% 41.99sec 45678827 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_blast 8092 5873074 13038 6.82 94482 195678 51.2 51.2 19.9% 0.0% 0.0% 0.0% 8.83sec 5873074 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay ticks -15407 8399186 18665 36.78 25099 52004 123.0 275.9 19.9% 0.0% 0.0% 0.0% 3.61sec 8399186 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 mind_flay_mastery 124468 2631190 5841 11.52 25101 52023 86.5 86.5 19.8% 0.0% 0.0% 0.0% 5.08sec 2631190 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_death 32379 1727481 3835 2.00 94649 196219 15.0 15.0 20.1% 0.0% 0.0% 0.0% 4.88sec 1727481 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_insanity 129249 3113488 6912 2.41 141656 293435 18.1 18.1 20.0% 0.0% 0.0% 0.0% 23.76sec 3113488 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain ticks -589 4255609 9457 29.24 14708 30436 42.2 219.3 29.9% 0.0% 0.0% 0.0% 10.64sec 4255609 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadow_word_pain_mastery 124464 1324715 2941 9.14 14648 30299 68.6 68.6 29.8% 0.0% 0.0% 0.0% 6.46sec 1324715 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 shadowy_apparition 87532 1643117 3648 9.97 18277 36773 76.1 74.8 19.9% 0.0% 0.0% 0.0% 5.85sec 1643117 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch ticks -34914 3865696 8590 25.61 16581 34361 30.9 192.1 19.9% 0.0% 0.0% 0.0% 14.63sec 3865696 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14 vampiric_touch_mastery 124465 1200662 2665 8.01 16465 34128 60.2 60.1 19.9% 0.0% 0.0% 0.0% 7.31sec 1200662 450.48sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend melee 0 1871110 52826 56.44 48879 98711 33.3 33.3 20.4% 0.0% 24.0% 0.0% 11.79sec 1871110 35.42sec
priest_90_di_swi_no4PT14 priest_90_di_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.24sec 0 35.42sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague 2944 2714326 6025 2.53 117806 244019 19.0 19.0 19.9% 0.0% 0.0% 0.0% 24.78sec 2714326 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_mastery 124467 1192412 2647 6.64 19692 40791 49.9 49.9 20.0% 0.0% 0.0% 0.0% 9.02sec 1192412 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 devouring_plague_tick ticks -2944 3793560 8430 21.31 19581 40518 19.0 159.8 19.8% 0.0% 0.0% 0.0% 24.78sec 3793560 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.8% 0.0% 0.0% 0.0% 41.61sec 0 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_damage 120696 1606390 3566 1.49 118220 244614 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.61sec 1606390 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 halo_heal 120696 0 0 31.77 0 0 11.2 238.5 23.0% 0.0% 0.0% 0.0% 41.61sec 46891826 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_blast 8092 5450978 12101 6.33 94591 195893 47.5 47.5 19.9% 0.0% 0.0% 0.0% 9.54sec 5450978 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay ticks -15407 8390820 18646 36.51 25222 52279 122.4 273.8 20.0% 0.0% 0.0% 0.0% 3.63sec 8390820 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_flay_mastery 124468 2627426 5833 11.42 25231 52314 85.8 85.7 20.0% 0.0% 0.0% 0.0% 5.13sec 2627426 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 mind_spike 73510 3705137 8225 5.14 79237 164241 38.6 38.6 19.8% 0.0% 0.0% 0.0% 11.29sec 3705137 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.02sec 0 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_death 32379 1755369 3897 2.03 94685 196394 15.2 15.2 20.4% 0.0% 0.0% 0.0% 4.83sec 1755369 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain ticks -589 4433376 9852 32.93 14782 30631 40.6 247.0 20.0% 0.0% 0.0% 0.0% 11.08sec 4433376 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadow_word_pain_mastery 124464 1375335 3053 10.29 14680 30396 77.3 77.3 19.9% 0.0% 0.0% 0.0% 5.75sec 1375335 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.86sec 0 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 shadowy_apparition 87532 1307629 2903 7.91 18320 36864 60.4 59.4 19.9% 0.0% 0.0% 0.0% 7.35sec 1307629 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch ticks -34914 3996089 8880 26.55 16545 34283 30.2 199.1 19.9% 0.0% 0.0% 0.0% 15.02sec 3996089 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14 vampiric_touch_mastery 124465 1247707 2770 8.31 16492 34175 62.4 62.4 19.9% 0.0% 0.0% 0.0% 7.07sec 1247707 450.48sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend melee 0 1874477 52936 56.48 49008 99030 33.3 33.3 20.3% 0.0% 24.2% 0.0% 11.80sec 1874477 35.41sec
priest_90_pi_fdcl_no2PT14 priest_90_pi_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.26sec 0 35.41sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague 2944 2712669 6022 2.53 117829 243658 19.0 19.0 19.9% 0.0% 0.0% 0.0% 24.79sec 2712669 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_mastery 124467 1194009 2651 6.66 19689 40794 50.0 50.0 19.9% 0.0% 0.0% 0.0% 9.01sec 1194009 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 devouring_plague_tick ticks -2944 3793719 8430 21.30 19576 40523 19.0 159.8 19.9% 0.0% 0.0% 0.0% 24.79sec 3793719 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.61sec 0 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_damage 120696 1607175 3568 1.49 118218 244693 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.61sec 1607175 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 halo_heal 120696 0 0 31.79 0 0 11.2 238.7 23.1% 0.0% 0.0% 0.0% 41.61sec 46938274 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_blast 8092 5444781 12087 6.32 94584 195802 47.5 47.5 19.9% 0.0% 0.0% 0.0% 9.54sec 5444781 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay ticks -15407 8392267 18649 36.55 25217 52289 122.6 274.1 19.9% 0.0% 0.0% 0.0% 3.63sec 8392267 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_flay_mastery 124468 2627169 5832 11.42 25230 52298 85.8 85.7 20.0% 0.0% 0.0% 0.0% 5.14sec 2627169 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 mind_spike 73510 3698657 8211 5.12 79235 164323 38.4 38.4 20.0% 0.0% 0.0% 0.0% 11.33sec 3698657 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.03sec 0 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_death 32379 1752990 3891 2.02 94691 196353 15.2 15.2 20.3% 0.0% 0.0% 0.0% 4.83sec 1752990 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain ticks -589 4821818 10715 32.94 14781 30586 40.6 247.0 30.0% 0.0% 0.0% 0.0% 11.08sec 4821818 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadow_word_pain_mastery 124464 1494671 3318 10.29 14677 30373 77.3 77.2 29.8% 0.0% 0.0% 0.0% 5.75sec 1494671 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 shadowy_apparition 87532 1808359 4014 10.95 18316 36844 83.5 82.2 19.9% 0.0% 0.0% 0.0% 5.34sec 1808359 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch ticks -34914 3995290 8878 26.55 16541 34273 30.2 199.1 19.9% 0.0% 0.0% 0.0% 15.03sec 3995290 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14 vampiric_touch_mastery 124465 1244735 2763 8.29 16493 34177 62.3 62.2 19.9% 0.0% 0.0% 0.0% 7.09sec 1244735 450.48sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend melee 0 1876549 52999 56.49 48979 98989 33.3 33.3 20.5% 0.0% 24.0% 0.0% 11.79sec 1876549 35.41sec
priest_90_pi_fdcl_no4PT14 priest_90_pi_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.29sec 0 35.41sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague 2944 2589847 5749 2.40 118212 244590 18.0 18.0 20.1% 0.0% 0.0% 0.0% 26.30sec 2589847 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_mastery 124467 1134481 2518 6.30 19755 40936 47.4 47.3 20.0% 0.0% 0.0% 0.0% 9.52sec 1134481 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 devouring_plague_tick ticks -2944 3603159 8007 20.16 19643 40670 18.0 151.2 19.9% 0.0% 0.0% 0.0% 26.30sec 3603159 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo 120644 0 0 1.50 0 0 11.2 11.2 19.6% 0.0% 0.0% 0.0% 41.51sec 0 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_damage 120696 1610093 3574 1.50 118213 244592 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.51sec 1610093 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 halo_heal 120696 0 0 31.99 0 0 11.2 240.1 23.1% 0.0% 0.0% 0.0% 41.51sec 47214791 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_blast 8092 5110726 11345 5.94 94517 195729 44.6 44.6 19.8% 0.0% 0.0% 0.0% 10.18sec 5110726 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay ticks -15407 9931909 22071 43.28 25203 52238 141.9 324.6 19.9% 0.0% 0.0% 0.0% 3.14sec 9931909 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mind_flay_mastery 124468 3109197 6902 13.53 25202 52239 101.6 101.6 20.0% 0.0% 0.0% 0.0% 4.34sec 3109197 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.78sec 0 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.06sec 0 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_death 32379 1740380 3863 2.01 94693 196442 15.1 15.1 20.2% 0.0% 0.0% 0.0% 4.85sec 1740380 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain ticks -589 4501529 10003 33.46 14778 30623 44.8 251.0 19.9% 0.0% 0.0% 0.0% 10.02sec 4501529 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadow_word_pain_mastery 124464 1396924 3101 10.45 14677 30403 78.5 78.4 19.9% 0.0% 0.0% 0.0% 5.66sec 1396924 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 shadowy_apparition 87532 1316329 2922 7.97 18321 36850 60.8 59.8 19.9% 0.0% 0.0% 0.0% 7.30sec 1316329 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch ticks -34914 4021624 8937 26.61 16599 34418 30.2 199.6 19.9% 0.0% 0.0% 0.0% 15.03sec 4021624 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14 vampiric_touch_mastery 124465 1246539 2767 8.29 16493 34191 62.3 62.3 19.9% 0.0% 0.0% 0.0% 7.08sec 1246539 450.48sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender melee 0 4734036 40521 55.17 38474 77581 107.4 107.4 20.2% 0.0% 24.0% 0.0% 4.09sec 4734036 116.83sec
priest_90_pi_mb_no2PT14 priest_90_pi_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.21sec 0 116.83sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague 2944 2582039 5732 2.40 118226 244523 18.0 18.0 19.8% 0.0% 0.0% 0.0% 26.30sec 2582039 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_mastery 124467 1134704 2519 6.30 19764 40929 47.3 47.3 20.1% 0.0% 0.0% 0.0% 9.53sec 1134704 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 devouring_plague_tick ticks -2944 3601195 8003 20.15 19649 40648 18.0 151.1 19.9% 0.0% 0.0% 0.0% 26.30sec 3601195 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo 120644 0 0 1.50 0 0 11.2 11.2 20.3% 0.0% 0.0% 0.0% 41.53sec 0 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_damage 120696 1611782 3578 1.50 118238 244685 11.2 11.2 20.0% 0.0% 0.0% 0.0% 41.53sec 1611782 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 halo_heal 120696 0 0 31.95 0 0 11.2 239.9 23.0% 0.0% 0.0% 0.0% 41.53sec 47145759 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_blast 8092 5113002 11350 5.94 94501 195780 44.6 44.6 19.9% 0.0% 0.0% 0.0% 10.18sec 5113002 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay ticks -15407 9937487 22083 43.29 25201 52251 141.8 324.7 20.0% 0.0% 0.0% 0.0% 3.14sec 9937487 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mind_flay_mastery 124468 3108621 6901 13.52 25199 52238 101.6 101.5 20.0% 0.0% 0.0% 0.0% 4.35sec 3108621 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.77sec 0 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.06sec 0 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_death 32379 1743489 3870 2.01 94686 196532 15.1 15.1 20.4% 0.0% 0.0% 0.0% 4.85sec 1743489 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain ticks -589 4896541 10881 33.46 14774 30570 44.8 251.0 30.0% 0.0% 0.0% 0.0% 10.02sec 4896541 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadow_word_pain_mastery 124464 1520487 3375 10.46 14673 30344 78.6 78.6 29.9% 0.0% 0.0% 0.0% 5.65sec 1520487 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 shadowy_apparition 87532 1819737 4040 11.02 18311 36835 84.1 82.7 19.9% 0.0% 0.0% 0.0% 5.30sec 1819737 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch ticks -34914 4019097 8931 26.60 16595 34404 30.2 199.5 19.9% 0.0% 0.0% 0.0% 15.04sec 4019097 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14 vampiric_touch_mastery 124465 1247969 2770 8.31 16499 34166 62.5 62.4 19.8% 0.0% 0.0% 0.0% 7.06sec 1247969 450.48sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender melee 0 4737152 40551 55.16 38469 77593 107.4 107.4 20.3% 0.0% 24.0% 0.0% 4.09sec 4737152 116.82sec
priest_90_pi_mb_no4PT14 priest_90_pi_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.21sec 0 116.82sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague 2944 2578154 5723 2.39 118284 244715 18.0 18.0 20.0% 0.0% 0.0% 0.0% 26.43sec 2578154 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_mastery 124467 1128333 2505 6.26 19769 40947 47.0 47.0 20.1% 0.0% 0.0% 0.0% 9.60sec 1128333 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 devouring_plague_tick ticks -2944 3592683 7984 20.06 19666 40694 18.0 150.5 20.0% 0.0% 0.0% 0.0% 26.43sec 3592683 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.94sec 0 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_damage 120696 1592168 3534 1.48 118217 244552 11.1 11.1 19.7% 0.0% 0.0% 0.0% 41.94sec 1592168 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 halo_heal 120696 0 0 31.16 0 0 11.1 233.9 23.1% 0.0% 0.0% 0.0% 41.94sec 46006350 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_blast 8092 5087556 11294 5.91 94504 195633 44.4 44.4 19.8% 0.0% 0.0% 0.0% 10.22sec 5087556 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay ticks -15407 9247567 20550 40.34 25177 52185 132.6 302.6 19.9% 0.0% 0.0% 0.0% 3.36sec 9247567 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 mind_flay_mastery 124468 2893964 6424 12.61 25179 52193 94.8 94.7 19.9% 0.0% 0.0% 0.0% 4.66sec 2893964 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.12sec 0 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_death 32379 1743215 3870 2.01 94701 196473 15.1 15.1 20.3% 0.0% 0.0% 0.0% 4.85sec 1743215 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_insanity 129249 3218859 7145 2.49 141962 294012 18.7 18.7 19.8% 0.0% 0.0% 0.0% 23.37sec 3218859 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain ticks -589 4150631 9224 30.90 14756 30590 46.3 231.7 19.9% 0.0% 0.0% 0.0% 9.69sec 4150631 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadow_word_pain_mastery 124464 1288030 2859 9.65 14669 30391 72.5 72.4 19.8% 0.0% 0.0% 0.0% 6.13sec 1288030 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.94sec 0 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 shadowy_apparition 87532 1222197 2713 7.41 18322 36843 56.5 55.6 19.8% 0.0% 0.0% 0.0% 7.85sec 1222197 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch ticks -34914 4047181 8994 26.69 16639 34509 30.3 200.2 20.0% 0.0% 0.0% 0.0% 14.97sec 4047181 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14 vampiric_touch_mastery 124465 1254220 2784 8.34 16494 34186 62.7 62.6 20.0% 0.0% 0.0% 0.0% 7.05sec 1254220 450.48sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend melee 0 1880959 53140 56.49 48979 99002 33.3 33.3 20.7% 0.0% 24.0% 0.0% 11.78sec 1880959 35.40sec
priest_90_pi_swi_no2PT14 priest_90_pi_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.27sec 0 35.40sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague 2944 2575663 5718 2.39 118242 244751 18.0 18.0 19.8% 0.0% 0.0% 0.0% 26.42sec 2575663 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_mastery 124467 1128946 2506 6.27 19770 40945 47.1 47.0 20.0% 0.0% 0.0% 0.0% 9.58sec 1128946 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 devouring_plague_tick ticks -2944 3590573 7979 20.07 19663 40676 18.0 150.5 20.0% 0.0% 0.0% 0.0% 26.42sec 3590573 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 dispersion 47585 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo 120644 0 0 1.48 0 0 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.93sec 0 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_damage 120696 1595273 3541 1.48 118237 244620 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.93sec 1595273 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 halo_heal 120696 0 0 31.16 0 0 11.1 233.9 23.1% 0.0% 0.0% 0.0% 41.93sec 46020229 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_blast 8092 5094221 11309 5.92 94508 195644 44.4 44.4 19.9% 0.0% 0.0% 0.0% 10.22sec 5094221 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay ticks -15407 9249379 20554 40.34 25183 52201 132.6 302.6 19.9% 0.0% 0.0% 0.0% 3.36sec 9249379 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 mind_flay_mastery 124468 2891453 6419 12.60 25183 52212 94.6 94.6 19.9% 0.0% 0.0% 0.0% 4.66sec 2891453 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.12sec 0 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_death 32379 1744430 3872 2.01 94688 196380 15.1 15.1 20.3% 0.0% 0.0% 0.0% 4.84sec 1744430 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_insanity 129249 3225942 7161 2.49 141989 294034 18.7 18.7 20.0% 0.0% 0.0% 0.0% 23.36sec 3225942 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain ticks -589 4510741 10024 30.89 14754 30535 46.3 231.7 29.9% 0.0% 0.0% 0.0% 9.70sec 4510741 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadow_word_pain_mastery 124464 1400393 3109 9.64 14670 30351 72.5 72.4 29.8% 0.0% 0.0% 0.0% 6.13sec 1400393 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.93sec 0 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 shadowy_apparition 87532 1706055 3787 10.32 18314 36832 78.8 77.5 20.0% 0.0% 0.0% 0.0% 5.66sec 1706055 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch ticks -34914 4049337 8999 26.70 16643 34513 30.3 200.2 20.0% 0.0% 0.0% 0.0% 14.97sec 4049337 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14 vampiric_touch_mastery 124465 1252705 2781 8.35 16496 34191 62.8 62.7 19.7% 0.0% 0.0% 0.0% 7.03sec 1252705 450.48sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend melee 0 1877055 53028 56.49 48962 99078 33.3 33.3 20.5% 0.0% 24.1% 0.0% 11.79sec 1877055 35.40sec
priest_90_pi_swi_no4PT14 priest_90_pi_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.26sec 0 35.40sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague 2944 2809151 6236 2.52 122504 253618 18.9 18.9 19.9% 0.0% 0.0% 0.0% 24.92sec 2809151 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_mastery 124467 1199800 2663 6.44 20433 42377 48.4 48.4 19.9% 0.0% 0.0% 0.0% 9.30sec 1199800 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 devouring_plague_tick ticks -2944 3816521 8481 20.64 20320 42107 18.9 154.8 19.9% 0.0% 0.0% 0.0% 24.92sec 3816521 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.6% 0.0% 0.0% 0.0% 41.72sec 0 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_damage 120696 1635782 3631 1.49 120935 250311 11.2 11.2 19.8% 0.0% 0.0% 0.0% 41.72sec 1635782 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 halo_heal 120696 0 0 31.48 0 0 11.2 236.3 23.0% 0.0% 0.0% 0.0% 41.72sec 47411924 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_blast 8092 5547159 12314 6.30 96763 200633 47.3 47.3 19.8% 0.0% 0.0% 0.0% 9.58sec 5547159 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay ticks -15407 8009548 17799 34.54 25472 52790 116.8 259.0 20.0% 0.0% 0.0% 0.0% 3.80sec 8009548 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_flay_mastery 124468 2506708 5565 10.80 25482 52816 81.1 81.1 19.9% 0.0% 0.0% 0.0% 5.41sec 2506708 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 mind_spike 73510 3635924 8071 4.93 81105 167886 37.0 37.0 19.8% 0.0% 0.0% 0.0% 11.72sec 3635924 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_death 32379 1996126 4431 2.02 108414 224938 15.1 15.1 20.2% 0.0% 0.0% 0.0% 4.85sec 1996126 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain ticks -589 4273593 9497 31.38 14973 31000 39.6 235.3 19.9% 0.0% 0.0% 0.0% 11.35sec 4273593 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadow_word_pain_mastery 124464 1333608 2960 9.78 14986 31042 73.5 73.4 19.8% 0.0% 0.0% 0.0% 6.04sec 1333608 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.87sec 0 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 shadowy_apparition 87532 1272878 2826 7.55 18676 37584 57.7 56.7 20.0% 0.0% 0.0% 0.0% 7.67sec 1272878 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch ticks -34914 3939593 8755 25.56 16932 35112 30.9 191.7 19.9% 0.0% 0.0% 0.0% 14.67sec 3939593 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14 vampiric_touch_mastery 124465 1226182 2722 7.98 16865 34943 60.0 59.9 19.9% 0.0% 0.0% 0.0% 7.33sec 1226182 450.48sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend melee 0 1875641 52954 56.42 48863 98884 33.3 33.3 20.7% 0.0% 23.9% 0.0% 11.80sec 1875641 35.42sec
priest_90_tof_fdcl_no2PT14 priest_90_tof_fdcl_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.27sec 0 35.42sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague 2944 2811267 6241 2.52 122436 253927 18.9 18.9 20.0% 0.0% 0.0% 0.0% 24.91sec 2811267 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_mastery 124467 1204155 2673 6.45 20440 42354 48.5 48.5 20.1% 0.0% 0.0% 0.0% 9.28sec 1204155 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 devouring_plague_tick ticks -2944 3815992 8480 20.64 20318 42092 18.9 154.8 19.9% 0.0% 0.0% 0.0% 24.91sec 3815992 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 20.0% 0.0% 0.0% 0.0% 41.71sec 0 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_damage 120696 1637118 3634 1.49 120932 250494 11.2 11.2 19.8% 0.0% 0.0% 0.0% 41.71sec 1637118 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 halo_heal 120696 0 0 31.51 0 0 11.2 236.6 23.0% 0.0% 0.0% 0.0% 41.71sec 47492518 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_blast 8092 5551907 12325 6.30 96771 200509 47.3 47.3 19.9% 0.0% 0.0% 0.0% 9.58sec 5551907 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay ticks -15407 8006123 17791 34.53 25471 52799 116.8 259.0 19.9% 0.0% 0.0% 0.0% 3.80sec 8006123 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_flay_mastery 124468 2503091 5557 10.78 25482 52818 81.0 80.9 19.9% 0.0% 0.0% 0.0% 5.42sec 2503091 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 mind_spike 73510 3637522 8075 4.93 81091 168113 37.0 37.0 19.8% 0.0% 0.0% 0.0% 11.71sec 3637522 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_death 32379 1998487 4436 2.02 108434 224729 15.1 15.1 20.4% 0.0% 0.0% 0.0% 4.85sec 1998487 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain ticks -589 4647465 10328 31.37 14971 30964 39.6 235.3 29.9% 0.0% 0.0% 0.0% 11.36sec 4647465 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadow_word_pain_mastery 124464 1453761 3227 9.79 14979 31008 73.6 73.5 29.9% 0.0% 0.0% 0.0% 6.03sec 1453761 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.88sec 0 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 shadowy_apparition 87532 1774749 3940 10.54 18674 37589 80.4 79.1 19.9% 0.0% 0.0% 0.0% 5.53sec 1774749 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch ticks -34914 3942054 8760 25.56 16934 35113 30.9 191.7 20.0% 0.0% 0.0% 0.0% 14.67sec 3942054 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14 vampiric_touch_mastery 124465 1223885 2717 7.97 16867 34954 59.9 59.9 19.8% 0.0% 0.0% 0.0% 7.34sec 1223885 450.48sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend melee 0 1870978 52823 56.42 48848 98790 33.3 33.3 20.4% 0.0% 23.9% 0.0% 11.81sec 1870978 35.42sec
priest_90_tof_fdcl_no4PT14 priest_90_tof_fdcl_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.26sec 0 35.42sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague 2944 2671817 5931 2.38 123099 255007 17.9 17.9 19.9% 0.0% 0.0% 0.0% 26.50sec 2671817 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_mastery 124467 1140961 2533 6.09 20555 42575 45.8 45.7 20.0% 0.0% 0.0% 0.0% 9.84sec 1140961 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 devouring_plague_tick ticks -2944 3631600 8070 19.54 20421 42306 17.9 146.5 19.9% 0.0% 0.0% 0.0% 26.50sec 3631600 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 19.7% 0.0% 0.0% 0.0% 41.69sec 0 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_damage 120696 1639622 3640 1.49 120989 250488 11.2 11.2 19.9% 0.0% 0.0% 0.0% 41.69sec 1639622 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 halo_heal 120696 0 0 31.53 0 0 11.2 236.7 23.1% 0.0% 0.0% 0.0% 41.69sec 47559399 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_blast 8092 5198581 11540 5.90 96839 200897 44.3 44.3 19.8% 0.0% 0.0% 0.0% 10.25sec 5198581 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay ticks -15407 9520835 21157 41.03 25491 52833 135.6 307.8 19.9% 0.0% 0.0% 0.0% 3.28sec 9520835 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mind_flay_mastery 124468 2980278 6616 12.83 25490 52854 96.4 96.3 19.9% 0.0% 0.0% 0.0% 4.57sec 2980278 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.82sec 0 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_death 32379 1986704 4410 2.00 108481 225349 15.0 15.0 20.2% 0.0% 0.0% 0.0% 4.87sec 1986704 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain ticks -589 4339266 9643 31.87 14970 31014 43.3 239.0 19.9% 0.0% 0.0% 0.0% 10.36sec 4339266 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadow_word_pain_mastery 124464 1356595 3011 9.95 14976 31057 74.8 74.7 19.8% 0.0% 0.0% 0.0% 5.93sec 1356595 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 shadowy_apparition 87532 1282852 2848 7.62 18684 37575 58.2 57.2 19.8% 0.0% 0.0% 0.0% 7.60sec 1282852 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch ticks -34914 3942170 8760 25.55 16935 35118 30.9 191.7 20.0% 0.0% 0.0% 0.0% 14.68sec 3942170 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14 vampiric_touch_mastery 124465 1226343 2722 7.99 16867 34975 60.0 60.0 19.8% 0.0% 0.0% 0.0% 7.33sec 1226343 450.48sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender melee 0 4719690 40439 55.15 38420 77459 107.3 107.3 20.1% 0.0% 24.0% 0.0% 4.10sec 4719690 116.71sec
priest_90_tof_mb_no2PT14 priest_90_tof_mb_no2PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.23sec 0 116.71sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague 2944 2674430 5937 2.38 123109 254973 17.9 17.9 20.0% 0.0% 0.0% 0.0% 26.50sec 2674430 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_mastery 124467 1142340 2536 6.10 20545 42579 45.9 45.8 20.0% 0.0% 0.0% 0.0% 9.83sec 1142340 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 devouring_plague_tick ticks -2944 3633688 8075 19.54 20419 42324 17.9 146.6 20.0% 0.0% 0.0% 0.0% 26.50sec 3633688 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo 120644 0 0 1.49 0 0 11.2 11.2 20.0% 0.0% 0.0% 0.0% 41.69sec 0 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_damage 120696 1641246 3643 1.49 120976 250509 11.2 11.2 20.0% 0.0% 0.0% 0.0% 41.69sec 1641246 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 halo_heal 120696 0 0 31.53 0 0 11.2 236.8 23.1% 0.0% 0.0% 0.0% 41.69sec 47548097 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_blast 8092 5198065 11539 5.90 96859 200699 44.3 44.3 19.8% 0.0% 0.0% 0.0% 10.25sec 5198065 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay ticks -15407 9517582 21150 41.03 25488 52837 135.6 307.7 19.9% 0.0% 0.0% 0.0% 3.28sec 9517582 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mind_flay_mastery 124468 2975349 6605 12.81 25495 52835 96.3 96.2 19.9% 0.0% 0.0% 0.0% 4.57sec 2975349 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.82sec 0 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_death 32379 1985389 4407 2.00 108446 225000 15.0 15.0 20.2% 0.0% 0.0% 0.0% 4.86sec 1985389 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain ticks -589 4720042 10489 31.86 14970 30962 43.3 239.0 29.9% 0.0% 0.0% 0.0% 10.36sec 4720042 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadow_word_pain_mastery 124464 1478602 3282 9.96 14976 30989 74.9 74.8 29.9% 0.0% 0.0% 0.0% 5.92sec 1478602 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 shadowy_apparition 87532 1788178 3970 10.62 18677 37578 81.0 79.7 19.9% 0.0% 0.0% 0.0% 5.49sec 1788178 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch ticks -34914 3940279 8756 25.55 16932 35123 30.9 191.6 19.9% 0.0% 0.0% 0.0% 14.68sec 3940279 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14 vampiric_touch_mastery 124465 1222160 2713 7.96 16864 34941 59.8 59.8 19.8% 0.0% 0.0% 0.0% 7.35sec 1222160 450.48sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender melee 0 4719445 40443 55.14 38425 77458 107.2 107.2 20.2% 0.0% 24.0% 0.0% 4.10sec 4719445 116.69sec
priest_90_tof_mb_no4PT14 priest_90_tof_mb_no4PT14_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.23sec 0 116.69sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague 2944 2657661 5900 2.37 122863 254370 17.8 17.8 20.0% 0.0% 0.0% 0.0% 26.62sec 2657661 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_mastery 124467 1141491 2534 6.09 20521 42570 45.8 45.7 20.1% 0.0% 0.0% 0.0% 9.83sec 1141491 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 devouring_plague_tick ticks -2944 3613223 8029 19.48 20383 42225 17.8 146.1 19.9% 0.0% 0.0% 0.0% 26.62sec 3613223 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 dispersion 47585 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 20.0% 0.0% 0.0% 0.0% 42.31sec 0 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_damage 120696 1573062 3492 1.44 120431 248930 10.8 10.8 19.7% 0.0% 0.0% 0.0% 42.31sec 1573062 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 halo_heal 120696 0 0 30.47 0 0 10.8 228.8 23.1% 0.0% 0.0% 0.0% 42.31sec 45788779 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_blast 8092 5166535 11469 5.87 96702 200427 44.1 44.1 19.8% 0.0% 0.0% 0.0% 10.27sec 5166535 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay ticks -15407 8806745 19571 37.99 25472 52795 126.3 285.0 19.9% 0.0% 0.0% 0.0% 3.51sec 8806745 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 mind_flay_mastery 124468 2756646 6119 11.88 25473 52799 89.3 89.2 19.9% 0.0% 0.0% 0.0% 4.91sec 2756646 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_death 32379 1961900 4355 1.98 108327 224860 14.8 14.8 20.5% 0.0% 0.0% 0.0% 4.93sec 1961900 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_insanity 129249 3203746 7112 2.43 144431 299494 18.3 18.3 19.9% 0.0% 0.0% 0.0% 23.63sec 3203746 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain ticks -589 4001977 8893 29.38 14979 31050 44.8 220.3 19.8% 0.0% 0.0% 0.0% 9.98sec 4001977 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadow_word_pain_mastery 124464 1247842 2770 9.17 14952 30981 68.9 68.9 19.8% 0.0% 0.0% 0.0% 6.41sec 1247842 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.94sec 0 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 shadowy_apparition 87532 1190250 2642 7.08 18653 37532 53.9 53.2 19.8% 0.0% 0.0% 0.0% 8.17sec 1190250 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch ticks -34914 3923580 8719 25.46 16923 35088 30.7 191.0 19.9% 0.0% 0.0% 0.0% 14.67sec 3923580 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14 vampiric_touch_mastery 124465 1217983 2704 7.93 16850 34938 59.6 59.5 19.9% 0.0% 0.0% 0.0% 7.35sec 1217983 450.48sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend melee 0 1869612 52819 56.43 48833 98816 33.3 33.3 20.5% 0.0% 24.0% 0.0% 11.80sec 1869612 35.40sec
priest_90_tof_swi_no2PT14 priest_90_tof_swi_no2PT14_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.28sec 0 35.40sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague 2944 2656165 5896 2.37 122853 254539 17.8 17.8 19.9% 0.0% 0.0% 0.0% 26.62sec 2656165 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_mastery 124467 1136719 2523 6.08 20523 42549 45.7 45.6 19.9% 0.0% 0.0% 0.0% 9.86sec 1136719 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 devouring_plague_tick ticks -2944 3613257 8029 19.48 20387 42213 17.8 146.1 19.9% 0.0% 0.0% 0.0% 26.62sec 3613257 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 dispersion 47585 0 0 0.03 0 0 0.2 0.2 0.0% 0.0% 0.0% 0.0% nansec 0 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo 120644 0 0 1.44 0 0 10.8 10.8 19.6% 0.0% 0.0% 0.0% 42.32sec 0 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_damage 120696 1575617 3498 1.44 120467 249217 10.8 10.8 19.9% 0.0% 0.0% 0.0% 42.32sec 1575617 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 halo_heal 120696 0 0 30.47 0 0 10.8 228.8 23.1% 0.0% 0.0% 0.0% 42.32sec 45826234 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_blast 8092 5169982 11477 5.87 96721 200437 44.1 44.1 19.8% 0.0% 0.0% 0.0% 10.27sec 5169982 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay ticks -15407 8803514 19563 37.98 25471 52794 126.3 284.9 19.9% 0.0% 0.0% 0.0% 3.51sec 8803514 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 mind_flay_mastery 124468 2752117 6109 11.86 25469 52812 89.1 89.1 19.9% 0.0% 0.0% 0.0% 4.92sec 2752117 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_death 32379 1955626 4341 1.98 108380 224591 14.8 14.8 20.1% 0.0% 0.0% 0.0% 4.93sec 1955626 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_insanity 129249 3213465 7134 2.44 144431 299269 18.3 18.3 20.0% 0.0% 0.0% 0.0% 23.58sec 3213465 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain ticks -589 4351772 9671 29.36 14979 30998 44.8 220.2 29.8% 0.0% 0.0% 0.0% 9.98sec 4351772 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadow_word_pain_mastery 124464 1360280 3020 9.19 14954 30939 69.1 69.0 29.7% 0.0% 0.0% 0.0% 6.40sec 1360280 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.96sec 0 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 shadowy_apparition 87532 1672608 3713 9.95 18652 37519 75.8 74.7 19.9% 0.0% 0.0% 0.0% 5.85sec 1672608 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch ticks -34914 3920682 8713 25.46 16922 35088 30.7 190.9 19.9% 0.0% 0.0% 0.0% 14.67sec 3920682 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14 vampiric_touch_mastery 124465 1221148 2711 7.95 16854 34947 59.8 59.7 19.9% 0.0% 0.0% 0.0% 7.33sec 1221148 450.48sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend melee 0 1868834 52796 56.42 48847 98730 33.3 33.3 20.4% 0.0% 23.9% 0.0% 11.80sec 1868834 35.40sec
priest_90_tof_swi_no4PT14 priest_90_tof_swi_no4PT14_shadowfiend shadowcrawl 63619 0 0 10.08 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.26sec 0 35.40sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%

Charts

http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=548|1:|0|&chxp=1,1,-nan,100&chtt=Fluffy_Pillow DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
Fluffy_Pillow 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.79% 7.79%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.79%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.47% 8.47%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 11.04% 11.04%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:11.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.04% 11.04%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.32% 11.32%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.02% 11.02%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.06% 11.06%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.85% 10.85%

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 1825901.78
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.48
Minimum 355.80
Maximum 548.56
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 21.40%
Distribution Chart

DPS

Sample Data Fluffy_Pillow Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data Fluffy_Pillow Damage Taken Per Second
Count 49992
Mean 1827535.88
Distribution Chart

HPS

Sample Data Fluffy_Pillow Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data Fluffy_Pillow Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 986533477 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="Fluffy_Pillow"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.