close

SimulationCraft 510-9

for World of Warcraft 5.1.0 Live (build level 16357)

Table of Contents

Raid Summary

 

DPS Chart
Raid Event List
0 movement,players_only=1,first=45,cooldown=85,duration=7,last=360

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Sta Int Spi SP AP Exp InvExp Hit InvHit Crit Haste Mastery Wdps WOHdps Armor Dodge Parry BlockR wowhead lootrank
priest_90_di_fdcl - - - 4.93 - 3.92 - - - 3.20 - 2.06 2.30 1.99 - - - - - - wowhead lootrank
priest_90_di_mb - - - 4.81 - 3.88 - - - 2.99 - 1.94 2.06 1.99 - - - - - - wowhead lootrank
priest_90_di_swi - - - 4.89 - 3.94 - - - 3.22 - 1.93 1.84 1.84 - - - - - - wowhead lootrank
priest_90_pi_fdcl - - - 4.95 - 4.04 - - - 3.03 - 2.07 1.88 1.97 - - - - - - wowhead lootrank
priest_90_pi_mb - - - 4.74 - 3.85 - - - 2.96 - 1.97 1.65 1.92 - - - - - - wowhead lootrank
priest_90_pi_swi - - - 4.86 - 3.98 - - - 3.01 - 2.08 1.58 1.89 - - - - - - wowhead lootrank
priest_90_tof_fdcl - - - 5.14 - 4.00 - - - 2.96 - 2.28 2.44 2.17 - - - - - - wowhead lootrank
priest_90_tof_mb - - - 4.88 - 3.87 - - - 2.73 - 2.20 2.08 2.08 - - - - - - wowhead lootrank
priest_90_tof_swi - - - 4.89 - 3.92 - - - 3.04 - 2.19 2.20 1.96 - - - - - - wowhead lootrank

priest_90_di_fdcl : 131191 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131191.0 131191.0 21.97 / 0.02% 4189 / 3.2% 26.8 4739.5 4710.7 Mana 0.72% 46.4 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.93 0.00 3.92 3.20 2.06 2.30 1.99
Normalized 1.00 0.00 0.79 0.65 0.42 0.47 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.93, SpellDamage=3.92, HitRating=3.20, CritRating=2.06, HasteRating=2.30, MasteryRating=1.99 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_fdcl": Intellect=4.93, SpellDamage=3.92, HitRating=0.00, CritRating=2.06, HasteRating=2.30, MasteryRating=1.99 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:339390|242705|192346|179323|96933|96609|81568|49276&chds=0,678780&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++339390++devouring_plague,9482C9,0,0,15|t++242705++halo,9482C9,1,0,15|t++192346++shadow_word_pain,9482C9,2,0,15|t++179323++vampiric_touch,9482C9,3,0,15|t++96933++mind_blast,9482C9,4,0,15|t++96609++shadow_word_death,9482C9,5,0,15|t++81568++mind_spike,4A79D3,6,0,15|t++49276++mind_flay,9482C9,7,0,15&chtt=priest_90_di_fdcl Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,13,12,11,8,8,6,6,5,4,4,3,3,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|mind_spike|mind_flay|devouring_plague_tick|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_di_fdcl Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.93,3.92,3.20,2.30,2.06,1.99|4.90,3.89,3.17,2.26,2.03,1.96|4.96,3.95,3.23,2.33,2.09,2.03&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.93++Int,FFFFFF,0,0,15,0.1,e|t++++3.92++SP,FFFFFF,0,1,15,0.1,e|t++++3.20++Hit,FFFFFF,0,2,15,0.1,e|t++++2.30++Haste,FFFFFF,0,3,15,0.1,e|t++++2.06++Crit,FFFFFF,0,4,15,0.1,e|t++++1.99++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.923&chtt=Scale Factors|priest_90_di_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58665554444453322zywvurrrqqpponmlllllmnnnnmlllkkjjiiiiijjihhggggghgggggggfffffffgggggggggggggggghhggffffggggghhhhiiiiiiijkkkkkjjiihhhggggffffeeedddddeeffffgggggghhhhhhhhhhhhiijjjkklllkkjjjjkkkkkjjiiihhgggghiiiiiihhggggggggggggfffffffffggggggggghhhiiiiiiijjjjjjiiiiiihggfffffeeeeeddddeeeeeeefghhhhhggggggggggggggffeeeeeefffffgggghhhijjjkkkllmmmmmmmnnnmmllllmmmnnnnnnnnnnnnnnnmmmlllkkkjjkkkkkkllkkkkkkkkkkkjjjjjjiiiiiiiiijjjjjkkkllmmmmnnnooooppppppppppppoooooooonnnnnnnnnmmmmmmmmmmmmmmmmnnnnnnnnnnnnnnnnnnnooooooooooooooooooonnnnnnmmmlmmmnnmnmlllmmmmllm&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5971,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=131191|max=219731&chxp=1,1,60,100&chtt=priest_90_di_fdcl DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,16,32,64,96,112,184,344,408,472,680,736,1136,1448,1544,2008,2176,2560,2400,2816,2936,2912,3104,2840,2576,2664,2304,1800,1576,1392,1272,1136,912,680,608,576,344,352,208,200,128,88,48,8,24,8,32,0,8&chds=0,3104&chbh=5&chxt=x&chxl=0:|min=122817|avg=131191|max=140899&chxp=0,1,46,100&chtt=priest_90_di_fdcl DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:27.5,17.0,16.0,13.0,12.1,6.1,4.0,2.9,0.5,0.7&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 123.9s|mind_spike 76.8s|mind_blast 72.0s|shadow_word_pain 58.5s|vampiric_touch 54.5s|devouring_plague 27.7s|shadow_word_death 17.8s|halo 13.0s|shadowfiend 2.4s|waiting 3.2s&chtt=priest_90_di_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_fdcl 131191
devouring_plague 7445 (20874) 5.7% (15.9%) 23.3 19.95sec 402606 339390 118170 244644 143614 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.34 23.34 0.00 0.00 1.1863 0.0000 3351651.38 3351651.38 0.00 339389.82 339389.82
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.64 79.88% 118169.58 107519 143944 118190.19 112309 124415 2203020 2203020 0.00
crit 4.70 20.12% 244643.55 221488 296525 243685.88 0 296525 1148631 1148631 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3206 2.4% 60.4 7.43sec 23893 0 19701 40823 23920 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.41 60.35 0.00 0.00 0.0000 0.0000 1443451.31 1443451.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.29 80.03% 19700.73 17856 23904 19707.10 18850 20829 951383 951383 0.00
crit 12.05 19.97% 40822.81 36784 49242 40837.07 37060 46449 492068 492068 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 10222 7.8% 23.3 19.95sec 197142 0 0 0 0 0.0% 0.0% 0.0% 0.0% 193.0 19652 40717 23844 19.9% 0.0% 32.2%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.34 23.34 192.96 192.96 0.0000 0.7521 4600904.37 4600904.37 0.00 31701.95 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 23.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 154.6 80.10% 19651.60 17856 34469 19656.38 18952 20364 3037352 3037352 0.00
crit 38.4 19.90% 40716.66 36784 71006 40724.59 38647 43943 1563552 1563552 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6996) 0.0% (5.3%) 10.9 42.49sec 287874 242705 0 0 0 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 10.94 0.00 0.00 1.1861 0.0000 0.00 0.00 0.00 242705.43 242705.43
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.72 79.73% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 20.27% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6996 5.3% 10.9 42.49sec 287874 0 118669 245683 143939 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 21.87 0.00 0.00 0.0000 0.0000 3148374.78 3148374.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.52 80.11% 118669.47 109581 139821 118709.74 111731 126491 2079307 2079307 0.00
crit 4.35 19.89% 245682.75 225736 288030 243251.03 0 288030 1069068 1069068 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.49sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.94 114.86 0.00 0.00 0.0000 0.0000 0.00 22717313.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.29 76.87% 0.00 0 0 0.00 0 0 0 13992606 100.00
crit 26.57 23.13% 0.00 0 0 0.00 0 0 0 8724707 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 15508 11.8% 60.8 7.42sec 114790 96933 94658 196136 114789 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.83 60.83 0.00 0.00 1.1842 0.0000 6982490.21 6982490.21 0.00 96933.26 96933.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 48.76 80.16% 94657.52 86183 115909 94680.83 91604 98787 4615576 4615576 0.00
crit 12.07 19.84% 196136.17 177536 238773 196211.99 179346 216309 2366914 2366914 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 10331 (13566) 7.9% (10.3%) 71.7 6.07sec 85174 49276 0 0 0 0.0% 0.0% 0.0% 0.0% 152.1 25190 52208 30570 19.9% 0.0% 24.9%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.69 71.69 152.10 152.10 1.7285 0.7362 4649579.50 4649579.50 0.00 49275.50 49275.50
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 71.69 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 121.8 80.09% 25190.17 22887 30640 25195.57 24334 26291 3068426 3068426 0.00
crit 30.3 19.91% 52208.18 47146 63119 52223.95 48974 58291 1581153 1581153 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3235 2.5% 47.7 8.88sec 30551 0 25182 52200 30565 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.66 47.64 0.00 0.00 0.0000 0.0000 1456197.31 1456197.31 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 38.15 80.08% 25182.09 22887 30640 25190.14 23859 26911 960758 960758 0.00
crit 9.49 19.92% 52199.81 47146 63119 52200.20 47146 63119 495439 495439 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 13902 10.6% 65.0 6.71sec 96285 81568 79394 164407 96284 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 65.05 65.05 0.00 0.00 1.1804 0.0000 6262937.76 6262937.76 0.00 81567.79 81567.79
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 52.12 80.13% 79394.11 72412 97688 79407.68 76029 82925 4138205 4138205 0.00
crit 12.92 19.87% 164406.55 149169 201238 164447.44 149169 190528 2124733 2124733 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 3826 2.9% 14.9 4.92sec 115428 96609 94689 196287 115429 20.4% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.94 14.94 0.00 0.00 1.1948 0.0000 1724272.41 1724272.41 0.00 96608.72 96608.72
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.89 79.59% 94689.42 83662 112752 94771.13 87466 104834 1125743 1125743 0.00
crit 3.05 20.41% 196287.36 172343 232270 189559.04 0 232270 598530 598530 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19053 (25012) 14.5% (19.1%) 49.5 9.10sec 227263 192346 0 0 0 0.0% 0.0% 0.0% 0.0% 443.0 14672 30335 19358 29.9% 0.0% 197.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.54 49.54 443.00 443.00 1.1815 2.0056 8575624.67 8575624.67 0.00 11887.99 192345.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 49.54 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 310.5 70.09% 14672.37 13422 17966 14675.30 14329 15083 4555519 4555519 0.00
crit 132.5 29.91% 30335.46 27649 37009 30341.58 29511 31271 4020106 4020106 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5960 4.5% 138.7 3.21sec 19343 0 14681 30362 19360 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.69 138.57 0.00 0.00 0.0000 0.0000 2682761.21 2682761.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.22 70.16% 14681.24 13422 17966 14684.77 14180 15231 1427337 1427337 0.00
crit 41.35 29.84% 30361.57 27649 37009 30368.89 29049 32230 1255424 1255424 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2250 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5619 4.3% 117.1 3.82sec 21607 0 18309 36822 21987 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.11 115.09 0.00 0.00 0.0000 0.0000 2530439.74 2530439.74 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.22 80.13% 18309.27 16669 22484 18313.43 17857 18854 1688516 1688516 0.00
crit 22.86 19.87% 36821.84 33338 44968 36831.52 34675 40185 841924 841924 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16540 (21705) 12.6% (16.6%) 45.5 9.84sec 214929 179323 0 0 0 0.0% 0.0% 0.0% 0.0% 372.3 16501 34188 20015 19.9% 0.0% 185.5%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.49 45.49 372.29 372.29 1.1986 2.2446 7451259.81 7451259.81 0.00 10984.14 179323.11
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.49 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 298.3 80.13% 16500.85 15001 20366 16504.80 16090 17098 4922609 4922609 0.00
crit 74.0 19.87% 34187.69 30902 41955 34194.88 32739 35769 2528651 2528651 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5164 3.9% 116.2 3.79sec 20016 0 16518 34215 20032 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.23 116.14 0.00 0.00 0.0000 0.0000 2326511.84 2326511.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.08 80.14% 16518.35 15001 20366 16522.69 15943 17091 1537486 1537486 0.00
crit 23.06 19.86% 34214.74 30902 41955 34222.42 31915 36958 789026 789026 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52624 / 4182
melee 52624 3.2% 33.3 11.81sec 55898 55213 48539 98101 55898 20.6% 0.0% 23.8% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.29 33.29 0.00 0.00 1.0124 0.0000 1860953.06 1860953.06 0.00 55212.97 55212.97
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.48 55.52% 48538.65 38145 58728 48561.45 43553 54990 897159 897159 0.00
crit 6.87 20.64% 98101.15 76291 117456 98060.37 0 117456 674009 674009 0.00
glance 7.94 23.84% 36504.25 28609 44046 36518.42 28609 44046 289785 289785 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.24sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1940 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.28%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.1 2.0 16.0sec 14.9sec 8.65% 44.07%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:8.65%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.23% 20.23%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.23%

    Trigger Attempt Success

    • trigger_pct:15.42%
glyph_mind_spike 39.2 25.8 11.2sec 6.7sec 45.65% 74.77%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:29.62%
  • glyph_mind_spike_2:16.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 9.0 36.6sec 20.6sec 43.64% 43.90%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.64%

    Trigger Attempt Success

    • trigger_pct:1.60%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.64% 42.64%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.64%

    Trigger Attempt Success

    • trigger_pct:14.34%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.3sec 10.3sec 9.70% 49.46%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.70%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 43.1 30.1 10.2sec 6.0sec 43.82% 100.00%

Buff details

  • buff initial source:priest_90_di_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:33.07%
  • surge_of_darkness_2:10.75%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.70%

Buff details

  • buff initial source:priest_90_di_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_fdcl
devouring_plague Shadow Orb 23.3 70.0 3.0 3.0 134203.2
halo Mana 10.9 442933.9 40500.0 40500.0 7.1
mind_blast Mana 60.8 296925.1 4881.4 4881.4 23.5
mind_flay Mana 71.7 215059.2 3000.0 3000.0 28.4
shadow_word_death Mana 14.9 116520.8 7800.0 7800.3 14.8
shadow_word_pain Mana 49.5 653909.0 13200.0 13199.9 17.2
vampiric_touch Mana 45.5 409441.0 9000.0 9000.1 23.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.29 127323.70 (6.00%) 3824.43 172305.74 57.51%
Shadow Orbs from Mind Blast Shadow Orb 60.83 60.83 (88.96%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.55 7.55 (11.04%) 1.00 0.00 0.00%
Devouring Plague Health Health 253.31 0.00 (-nan%) 0.00 3517551.63 100.00%
Vampiric Touch Mana Mana 488.43 1629347.57 (76.79%) 3335.89 952813.87 36.90%
mp5_regen Mana 1801.21 365157.02 (17.21%) 202.73 175206.00 32.42%
Resource RPS-Gain RPS-Loss
Mana 4710.69 4739.47
Shadow Orb 0.15 0.16
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 287041.05 230700.00 300000.00
Shadow Orb 1.37 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 32.6%
shadowfiend-Mana Cap 32.6%
lightwell-Mana Cap 32.6%

Procs

Count Interval
Shadowy Recall Extra Tick 362.7 1.2sec
Shadowy Apparition Procced 117.1 3.8sec
Divine Insight Mind Blast CD Reset 51.3 14.9sec
FDCL Mind Spike proc 73.2 6.0sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_di_fdcl Damage Per Second
Count 49992
Mean 131190.99
Minimum 122816.94
Maximum 140899.05
Spread ( max - min ) 18082.10
Range [ ( max - min ) / 2 * 100% ] 6.89%
Standard Deviation 2506.1449
5th Percentile 127180.42
95th Percentile 135557.95
( 95th Percentile - 5th Percentile ) 8377.53
Mean Distribution
Standard Deviation 11.2087
95.00% Confidence Intervall ( 131169.02 - 131212.96 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1401
0.1 Scale Factor Error with Delta=300 53616
0.05 Scale Factor Error with Delta=300 214464
0.01 Scale Factor Error with Delta=300 5361619
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131190.99
Distribution Chart

Damage

Sample Data
Count 49992
Mean 57186456.30
Distribution Chart

DTPS

Sample Data priest_90_di_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 348.28
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.30 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.94 shadow_word_death,if=active_enemies<=5
F 61.00 mind_blast,if=active_enemies<=6&cooldown_react
G 40.87 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 46.79 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.48 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.94 halo,if=talent.halo.enabled
M 16.04 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.10 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 25.07 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 46.57 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 47.52 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 8.67 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTFMRTGGHFHRTRTRQFJRTRTFDFGGJLRWWFHHTQFMRGTRQQQFTGHHRQFTFGLMHGHTFRTRTFGTHHTGFMTRTFJRTGHFLRWWWHFHMTRRRFGTRTHFGHJRTFDFRRGLRHFHGJBRTFMTGHFHJRGTJFRTRTHFGLMRWWWFHRFFMTHQQQQQFGJRRRHGFTRTHFMTGLJHFGJRTHFRTGHFMTGTRHFTFFJMHGJLFFRGHFJJMJRTFHGRTFGHJRQFMTHFJRRGLTHFGFDFFRHTRTBFGHMRGTFHJRTRTEEFGHJLDEEFGFHJDEEHFGJRTEDEFGHRTPEEFGDF9HLEERHGFMRQQPEEFTGFDEEHHR

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_mb : 130077 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
130076.7 130076.7 19.92 / 0.02% 3767 / 2.9% 23.6 5073.2 5045.2 Mana 0.63% 39.7 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.81 0.00 3.88 2.99 1.94 2.06 1.99
Normalized 1.00 0.00 0.81 0.62 0.40 0.43 0.41
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Mastery > Crit
Pawn string
  • ( Pawn: v1: "priest_90_di_mb": Intellect=4.81, SpellDamage=3.88, HitRating=2.99, CritRating=1.94, HasteRating=2.06, MasteryRating=1.99 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_mb": Intellect=4.81, SpellDamage=3.88, HitRating=0.00, CritRating=1.94, HasteRating=2.06, MasteryRating=1.99 )

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:339772|243141|179421|174265|97008|96528|49978&chds=0,679543&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++339772++devouring_plague,9482C9,0,0,15|t++243141++halo,9482C9,1,0,15|t++179421++vampiric_touch,9482C9,2,0,15|t++174265++shadow_word_pain,9482C9,3,0,15|t++97008++mind_blast,9482C9,4,0,15|t++96528++shadow_word_death,9482C9,5,0,15|t++49978++mind_flay,9482C9,6,0,15&chtt=priest_90_di_mb Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,14,12,9,8,6,6,5,5,4,4,3,3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|mind_blast|mindbender: melee|devouring_plague_tick|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_di_mb Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.81,3.88,2.99,2.06,1.99,1.94|4.78,3.85,2.96,2.04,1.97,1.91|4.84,3.91,3.02,2.09,2.02,1.97&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.81++Int,FFFFFF,0,0,15,0.1,e|t++++3.88++SP,FFFFFF,0,1,15,0.1,e|t++++2.99++Hit,FFFFFF,0,2,15,0.1,e|t++++2.06++Haste,FFFFFF,0,3,15,0.1,e|t++++1.99++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.94++Crit,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.781&chtt=Scale Factors|priest_90_di_mb%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:3557877766767555520zyxvusrqppoomlkkkkmnnmlkkjjjiihhgghiijjjjjkklmmmmmmlmmllkjjjjiihhggffffffgggggggfeeeeffffggggghiijkklnooppppoonnmmmllkjiihfeeedddddeeeffffffffghhhhhhhhhhhgghhhiiijiiiiijjjjjkkkkkjjjjiiiiiiiihhhggfffffffffeeedddeeeeffgghhiijkklmnopppppppppponnmlkkjigfeedddddddddddddddeeeegggggghhhhhiijjkkkllkjjjkkkjjjjjiiihhhhhhijjkkkklllmmmmmmmmmmllkjjjjjkkkkklllmmnnnnnnoooooonnnnmmmlllkkkkkkjjjjjjjjjiiiiiiiiiiiijkklmmnopqrstttuuuvvvvuuuttssrrqppooooooonnnnnnnnnnnnnnmmmmmmnoooppqqrrstttttuuuuutttsssrrqqpppoooooooooonnnnmmmmmmllllkkjjjjiiiiihhg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6148,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=130077|max=211568&chxp=1,1,61,100&chtt=priest_90_di_mb DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:32,8,48,16,48,200,168,232,384,696,816,1064,1272,1400,1896,2352,2456,2488,3168,3064,3008,3240,3104,2712,2680,2304,2008,1864,1632,1072,1144,904,760,472,384,280,168,88,112,104,40,40,8,24,8,16,0,0,0,8&chds=0,3240&chbh=5&chxt=x&chxl=0:|min=122579|avg=130077|max=140276&chxp=0,1,42,100&chtt=priest_90_di_mb DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:42.9,15.2,14.5,12.0,5.9,4.0,2.9,1.8,0.6&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 193.1s|mind_blast 68.5s|shadow_word_pain 65.3s|vampiric_touch 54.2s|devouring_plague 26.5s|shadow_word_death 17.8s|halo 13.0s|mindbender 8.3s|waiting 2.8s&chtt=priest_90_di_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_mb 130077
devouring_plague 7126 (20005) 5.5% (15.4%) 22.4 20.93sec 402783 339772 118293 245000 143465 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 0.00 0.00 1.1855 0.0000 3207001.70 3207001.70 0.00 339771.74 339771.74
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.91 80.13% 118293.17 107519 143944 118325.36 112402 124197 2118904 2118904 0.00
crit 4.44 19.87% 245000.06 221488 296525 242802.48 0 296525 1088097 1088097 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3067 2.4% 57.7 7.79sec 23904 0 19722 40868 23932 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.73 57.67 0.00 0.00 0.0000 0.0000 1380053.19 1380053.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.18 80.09% 19721.62 17856 23904 19727.92 18801 20949 910817 910817 0.00
crit 11.48 19.91% 40867.88 36784 49242 40871.47 36784 46564 469236 469236 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9813 7.5% 22.4 20.93sec 197578 0 0 0 0 0.0% 0.0% 0.0% 0.0% 185.0 19678 40754 23875 19.9% 0.0% 30.8%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.35 22.35 184.98 184.98 0.0000 0.7509 4416556.54 4416556.54 0.00 31796.21 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.35 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 148.1 80.09% 19678.42 17856 33774 19683.58 18951 20504 2915287 2915287 0.00
crit 36.8 19.91% 40754.34 36784 69574 40762.35 38649 43942 1501270 1501270 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7051) 0.0% (5.4%) 11.0 42.19sec 288272 243141 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 0.00 0.00 1.1857 0.0000 0.00 0.00 0.00 243141.20 243141.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.80 79.96% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 20.04% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7051 5.4% 11.0 42.19sec 288272 0 118716 245827 144138 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 22.01 0.00 0.00 0.0000 0.0000 3172749.55 3172749.55 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.61 80.00% 118716.40 109581 139821 118761.63 110028 125840 2090596 2090596 0.00
crit 4.40 20.00% 245826.52 225736 288030 243672.87 0 288030 1082154 1082154 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.19sec 0 0 0 0 0 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.01 115.21 0.00 0.00 0.0000 0.0000 0.00 22819086.10 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.46 76.78% 0.00 0 0 0.00 0 0 0 14029320 100.00
crit 26.75 23.22% 0.00 0 0 0.00 0 0 0 8789767 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14759 11.3% 57.8 7.81sec 114962 97008 94648 196019 114962 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.80 57.80 0.00 0.00 1.1851 0.0000 6645141.19 6645141.19 0.00 97007.94 97007.94
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.22 79.96% 94647.95 86183 115909 94670.12 91617 98391 4374601 4374601 0.00
crit 11.58 20.04% 196018.65 177536 238773 196107.85 177536 221218 2270540 2270540 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16325 (21430) 12.6% (16.5%) 108.4 4.07sec 88995 49978 0 0 0 0.0% 0.0% 0.0% 0.0% 240.7 25172 52157 30552 19.9% 0.0% 39.6%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 108.45 108.45 240.66 240.66 1.7807 0.7403 7352725.26 7352725.26 0.00 49978.41 49978.41
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 108.45 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 192.7 80.06% 25171.81 22887 30640 25178.13 24628 25944 4849989 4849989 0.00
crit 48.0 19.94% 52156.93 47146 63119 52172.68 49534 55142 2502737 2502737 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5105 3.9% 75.3 5.79sec 30544 0 25162 52141 30561 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.26 75.22 0.00 0.00 0.0000 0.0000 2298805.17 2298805.17 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.17 79.99% 25162.50 22887 30640 25169.23 24065 26547 1514042 1514042 0.00
crit 15.05 20.01% 52141.14 47146 63119 52158.11 47905 57838 784764 784764 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.81sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1992 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 3819 2.9% 14.9 4.92sec 115334 96528 94725 196441 115335 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.92 14.92 0.00 0.00 1.1948 0.0000 1720812.18 1720812.18 0.00 96528.42 96528.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.90 79.74% 94725.42 83662 112752 94792.36 87081 103548 1126984 1126984 0.00
crit 3.02 20.26% 196441.39 172343 232270 189450.40 0 232270 593828 593828 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19249 (25278) 14.8% (19.4%) 55.3 8.14sec 205858 174265 0 0 0 0.0% 0.0% 0.0% 0.0% 448.2 14665 30322 19330 29.8% 0.0% 197.3%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.26 55.26 448.18 448.18 1.1813 1.9825 8663129.01 8663129.01 0.00 11926.83 174264.96
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.26 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 314.7 70.21% 14664.97 13422 17966 14667.64 14313 15007 4614445 4614445 0.00
crit 133.5 29.79% 30321.75 27649 37009 30327.28 29434 31301 4048684 4048684 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6028 4.6% 140.2 3.18sec 19350 0 14679 30351 19366 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.20 140.09 0.00 0.00 0.0000 0.0000 2712887.64 2712887.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.19 70.09% 14678.61 13422 17966 14681.43 14188 15292 1441296 1441296 0.00
crit 41.90 29.91% 30350.75 27649 37009 30357.76 28912 32038 1271592 1271592 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5638 4.3% 117.4 3.81sec 21617 0 18311 36816 21995 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.42 115.40 0.00 0.00 0.0000 0.0000 2538288.71 2538288.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.43 80.09% 18310.79 16669 22484 18314.61 17878 18857 1692384 1692384 0.00
crit 22.98 19.91% 36816.42 33338 44968 36820.60 34239 39793 845905 845905 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16440 (21586) 12.6% (16.6%) 45.2 9.90sec 215095 179421 0 0 0 0.0% 0.0% 0.0% 0.0% 370.1 16499 34188 20011 19.9% 0.0% 184.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.20 45.20 370.07 370.07 1.1988 2.2446 7405388.30 7405388.30 0.00 10988.28 179421.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.20 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 296.6 80.15% 16498.83 15001 20366 16502.50 16074 16997 4893600 4893600 0.00
crit 73.5 19.85% 34188.44 30902 41955 34196.77 31957 35784 2511788 2511788 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5146 4.0% 115.7 3.81sec 20031 0 16521 34225 20049 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 115.71 115.61 0.00 0.00 0.0000 0.0000 2317800.94 2317800.94 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.57 80.08% 16521.07 15001 20366 16525.76 15999 17123 1529433 1529433 0.00
crit 23.04 19.92% 34224.60 30902 41955 34236.77 31490 37093 788367 788367 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40487 / 10512
melee 40487 8.1% 107.4 4.09sec 43998 41351 38408 77449 43998 20.2% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.43 107.43 0.00 0.00 1.0640 0.0000 4726847.66 4726847.66 0.00 41350.77 41350.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.95 55.80% 38407.59 30516 46982 38415.61 36678 40706 2302473 2302473 0.00
crit 21.69 20.19% 77448.89 61032 93964 77460.82 70760 86998 1679958 1679958 0.00
glance 25.79 24.01% 28859.30 22887 35237 28864.31 26884 31338 744418 744418 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1908 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.33%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 27.0 2.5 16.1sec 14.7sec 10.32% 45.95%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:10.32%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.24% 20.24%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.24%

    Trigger Attempt Success

    • trigger_pct:15.45%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.6sec 20.7sec 43.55% 43.84%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.55%

    Trigger Attempt Success

    • trigger_pct:1.58%
light_of_the_cosmos 9.8 0.0 47.8sec 47.8sec 42.76% 42.76%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.76%

    Trigger Attempt Success

    • trigger_pct:14.16%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.5 0.0 10.3sec 10.3sec 9.69% 49.51%

Buff details

  • buff initial source:priest_90_di_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.69%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.38% 84.09%

Buff details

  • buff initial source:priest_90_di_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_mb
devouring_plague Shadow Orb 22.4 67.1 3.0 3.0 134261.4
halo Mana 11.0 445746.2 40500.0 40500.0 7.1
mind_blast Mana 57.8 261364.3 4521.7 4521.6 25.4
mind_flay Mana 108.4 325348.3 3000.0 3000.0 29.7
shadow_word_death Mana 14.9 116382.2 7800.0 7800.3 14.8
shadow_word_pain Mana 55.3 729453.1 13200.0 13200.0 15.6
vampiric_touch Mana 45.2 406837.4 9000.0 9000.0 23.9
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.43 264672.53 (11.65%) 2463.56 205994.57 43.77%
Shadow Orbs from Mind Blast Shadow Orb 57.80 57.80 (88.47%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.53 7.53 (11.53%) 1.00 0.00 0.00%
Devouring Plague Health Health 242.65 0.00 (-nan%) 0.00 3369564.81 100.00%
Vampiric Touch Mana Mana 485.68 1640313.86 (72.18%) 3377.35 926941.18 36.11%
mp5_regen Mana 1801.21 367492.06 (16.17%) 204.03 172870.97 31.99%
Resource RPS-Gain RPS-Loss
Mana 5045.15 5073.24
Shadow Orb 0.15 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 287344.74 221100.00 300000.00
Shadow Orb 1.28 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 32.1%
shadowfiend-Mana Cap 32.1%
lightwell-Mana Cap 32.1%

Procs

Count Interval
Shadowy Recall Extra Tick 388.6 1.2sec
Shadowy Apparition Procced 117.4 3.8sec
Divine Insight Mind Blast CD Reset 51.9 14.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_di_mb Damage Per Second
Count 49992
Mean 130076.70
Minimum 122578.94
Maximum 140275.52
Spread ( max - min ) 17696.57
Range [ ( max - min ) / 2 * 100% ] 6.80%
Standard Deviation 2272.0936
5th Percentile 126375.34
95th Percentile 133909.66
( 95th Percentile - 5th Percentile ) 7534.33
Mean Distribution
Standard Deviation 10.1619
95.00% Confidence Intervall ( 130056.79 - 130096.62 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1172
0.1 Scale Factor Error with Delta=300 44069
0.05 Scale Factor Error with Delta=300 176277
0.01 Scale Factor Error with Delta=300 4406929
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 130076.70
Distribution Chart

Damage

Sample Data
Count 49992
Mean 53831339.36
Distribution Chart

DTPS

Sample Data priest_90_di_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 298.37
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 6.32 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.92 shadow_word_death,if=active_enemies<=5
F 58.15 mind_blast,if=active_enemies<=6&cooldown_react
G 39.92 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 46.53 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.01 halo,if=talent.halo.enabled
M 16.03 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.49 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 21.44 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 59.30 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 15.34 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHFHLTFMQQFTGGHFHTFMTFHGGFHWWLWWWFHMTHTAFGTFTHGTFHMTGTFLHTGHFTGQFMTFHTGHTFTATGFHLDFWWWHHTFTGTFMHHTGQFTFGLTHHTFGMTATFGFHHTQFGMTFTGHLWFWWWWHHTFMTGQFTFHFGHMAFTGFHLFHMGFTFTGHHTFGMTFTHGHLWWFWAFHMTHFTGTFFGHMTQFHTFGHLGTQFHMTQFTGFHTAGTFHMTFEEHGLTFDEEGHTQFTEDEHGQFTEEGFHMTPEEHFLGA9TEDEFGHTHEEFDFGTEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_di_swi : 131739 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131739.1 131739.1 22.00 / 0.02% 4147 / 3.1% 22.9 5560.5 5523.3 Mana 0.54% 41.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_di_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.89 0.00 3.94 3.22 1.93 1.84 1.84
Normalized 1.00 0.00 0.81 0.66 0.39 0.38 0.38
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Haste = Mastery
Pawn string
  • ( Pawn: v1: "priest_90_di_swi": Intellect=4.89, SpellDamage=3.94, HitRating=3.22, CritRating=1.93, HasteRating=1.84, MasteryRating=1.84 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_di_swi": Intellect=4.89, SpellDamage=3.94, HitRating=0.00, CritRating=1.93, HasteRating=1.84, MasteryRating=1.84 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:339520|241963|180532|166231|156535|96944|96556|50066&chds=0,679040&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++339520++devouring_plague,9482C9,0,0,15|t++241963++halo,9482C9,1,0,15|t++180532++vampiric_touch,9482C9,2,0,15|t++166231++shadow_word_insanity,9482C9,3,0,15|t++156535++shadow_word_pain,9482C9,4,0,15|t++96944++mind_blast,9482C9,5,0,15|t++96556++shadow_word_death,9482C9,6,0,15|t++50066++mind_flay,9482C9,7,0,15&chtt=priest_90_di_swi Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:14,13,11,11,11,8,5,5,4,4,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_blast|shadow_word_insanity|mind_flay|devouring_plague_tick|devouring_plague|halo_damage|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadowfiend: melee|shadow_word_death|devouring_plague_mastery&chtt=priest_90_di_swi Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.89,3.94,3.22,1.93,1.84,1.84|4.86,3.91,3.19,1.90,1.81,1.80|4.92,3.97,3.26,1.96,1.87,1.87&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.89++Int,FFFFFF,0,0,15,0.1,e|t++++3.94++SP,FFFFFF,0,1,15,0.1,e|t++++3.22++Hit,FFFFFF,0,2,15,0.1,e|t++++1.93++Crit,FFFFFF,0,3,15,0.1,e|t++++1.84++Haste,FFFFFF,0,4,15,0.1,e|t++++1.84++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.878&chtt=Scale Factors|priest_90_di_swi%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:686665555765633330yyxvtttsrrrqnnmmmmmnoonmllkkkkkihhiiiiiihhhhhhhhhhhggggggggghhggghhhhhghhhhhhiijjiihhhhhhiiijjjjjkkkkkkklllkkjjiihhhggffffffeeeeeeeefffggggghhhhiihhhhhihhiijjkklmmmmmlllllllmmllkkjjjiihhhhiiijiihhhhhhhhgggggggghhhgghhhhhhhhhhhiiiiiihhiijjjkkkjjjjjjiihhhhggggffffffffffffffggghhhhhggghhhgggggggggggggggggggggghhhiijjkkkkklmmnnnnnnooonnnnnnnoooooooooonnnnnnnnmmllllkkkkklllmmmmmmmmmmmllllkkkkjjjjjjiiijjjjjjkkllmmmnnnoooppqqqqqqqqqqqqqpppppooonnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnooooooopppppppppppooooonnmmmmmmnnonnnnnnnmnmm&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6104,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=131739|max=215819&chxp=1,1,61,100&chtt=priest_90_di_swi DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:24,8,24,48,72,192,208,344,384,616,816,1000,1248,1600,1752,1912,2328,2584,2936,2800,2944,3176,2976,2808,2536,2544,2040,2000,1696,1328,1224,816,728,640,376,360,312,248,112,72,8,48,24,24,0,16,8,8,16,8&chds=0,3176&chbh=5&chxt=x&chxl=0:|min=123627|avg=131739|max=142522&chxp=0,1,43,100&chtt=priest_90_di_swi DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:35.7,15.1,15.0,12.2,8.2,5.8,4.0,2.9,0.5,0.5&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 160.6s|shadow_word_pain 68.1s|mind_blast 67.4s|vampiric_touch 54.9s|shadow_word_insanity 36.9s|devouring_plague 26.1s|shadow_word_death 17.9s|halo 13.0s|shadowfiend 2.4s|waiting 2.4s&chtt=priest_90_di_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_di_swi 131739
devouring_plague 7015 (19680) 5.3% (14.9%) 22.0 21.18sec 402345 339520 118078 244762 143438 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 0.00 0.00 1.1851 0.0000 3158028.40 3158028.40 0.00 339520.22 339520.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.61 79.98% 118077.80 107519 143944 118101.90 112532 124622 2079332 2079332 0.00
crit 4.41 20.02% 244762.28 221488 296525 242271.85 0 296525 1078696 1078696 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 3027 2.3% 57.0 7.88sec 23886 0 19707 40832 23914 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.03 56.97 0.00 0.00 0.0000 0.0000 1362301.84 1362301.84 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.62 80.09% 19707.15 17856 23904 19713.12 18693 21031 899107 899107 0.00
crit 11.34 19.91% 40832.03 36784 49242 40844.71 37226 46751 463195 463195 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 9638 7.3% 22.0 21.18sec 197034 0 0 0 0 0.0% 0.0% 0.0% 0.0% 182.0 19632 40669 23831 20.0% 0.0% 30.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.02 22.02 182.04 182.04 0.0000 0.7520 4338091.79 4338091.79 0.00 31691.04 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 22.02 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 145.7 80.04% 19631.93 17856 31872 19635.95 18725 20782 2860450 2860450 0.00
crit 36.3 19.96% 40669.20 36784 65656 40672.96 37383 44555 1477642 1477642 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (6963) 0.0% (5.3%) 10.9 42.68sec 287197 241963 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.91 10.91 0.00 0.00 1.1870 0.0000 0.00 0.00 0.00 241963.24 241963.24
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.76 80.26% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.15 19.74% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 6963 5.3% 10.9 42.68sec 287197 0 118390 245000 143603 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.91 21.83 0.00 0.00 0.0000 0.0000 3134391.77 3134391.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.48 80.09% 118389.72 109581 139821 118412.20 110842 125088 2069634 2069634 0.00
crit 4.35 19.91% 245000.16 225736 288030 242953.63 0 288030 1064758 1064758 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 10.9 42.68sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 10.91 116.65 0.00 0.00 0.0000 0.0000 0.00 22991446.59 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.72 76.91% 0.00 0 0 0.00 0 0 0 14175479 100.00
crit 26.93 23.09% 0.00 0 0 0.00 0 0 0 8815967 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_di_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 14514 11.0% 56.8 7.95sec 114938 96944 94641 196130 114938 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.85 56.85 0.00 0.00 1.1856 0.0000 6533942.91 6533942.91 0.00 96944.21 96944.21
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.48 80.00% 94641.06 86183 115909 94664.77 90871 98056 4304131 4304131 0.00
crit 11.37 20.00% 196130.12 177536 238773 196226.67 177536 218528 2229812 2229812 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 13604 (17857) 10.3% (13.6%) 90.5 4.87sec 88815 50066 0 0 0 0.0% 0.0% 0.0% 0.0% 200.1 25213 52262 30602 19.9% 0.0% 32.8%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.53 90.53 200.14 200.14 1.7740 0.7383 6124766.60 6124766.60 0.00 50065.92 50065.92
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 90.53 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 160.3 80.08% 25213.03 22887 30640 25219.58 24599 26036 4040893 4040893 0.00
crit 39.9 19.92% 52262.34 47146 63119 52276.36 49503 55833 2083873 2083873 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4253 3.2% 62.6 6.94sec 30606 0 25221 52293 30626 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.58 62.54 0.00 0.00 0.0000 0.0000 1915369.85 1915369.85 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.05 80.04% 25220.97 22887 30640 25228.60 24102 26625 1262430 1262430 0.00
crit 12.49 19.96% 52292.53 47146 63119 52307.42 47146 59924 652940 652940 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 3824 2.9% 14.9 4.91sec 115344 96556 94753 196228 115343 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.95 14.95 0.00 0.00 1.1946 0.0000 1724102.74 1724102.74 0.00 96555.93 96555.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.91 79.71% 94752.79 83662 112752 94831.20 87081 104562 1128920 1128920 0.00
crit 3.03 20.29% 196228.31 172343 232270 188519.78 0 232270 595183 595183 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 13585 10.3% 31.1 13.54sec 196763 166231 162281 335952 196765 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.14 31.14 0.00 0.00 1.1837 0.0000 6126616.76 6126616.76 0.00 166231.19 166231.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 24.95 80.14% 162281.47 148247 199962 162311.57 155157 171168 4049684 4049684 0.00
crit 6.18 19.86% 335952.07 305389 411923 335632.84 0 411923 2076933 2076933 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18037 (23682) 13.7% (18.0%) 57.6 7.81sec 185121 156535 0 0 0 0.0% 0.0% 0.0% 0.0% 419.4 14676 30341 19352 29.9% 0.0% 181.2%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.56 57.56 419.37 419.37 1.1826 1.9460 8115703.21 8115703.21 0.00 12052.09 156534.53
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 57.56 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 294.2 70.15% 14675.72 13422 17966 14678.34 14306 15094 4317286 4317286 0.00
crit 125.2 29.85% 30340.57 27649 37009 30345.76 29475 31327 3798417 3798417 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5645 4.3% 131.3 3.40sec 19354 0 14683 30368 19371 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.25 131.14 0.00 0.00 0.0000 0.0000 2540228.71 2540228.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.95 70.11% 14683.25 13422 17966 14685.89 14261 15267 1350051 1350051 0.00
crit 39.19 29.89% 30367.99 27649 37009 30374.49 28809 32419 1190178 1190178 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.83sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2250 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5477 4.2% 114.1 3.92sec 21609 0 18312 36830 21993 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.13 112.14 0.00 0.00 0.0000 0.0000 2466262.60 2466262.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.85 80.13% 18312.35 16669 22484 18315.92 17835 18875 1645448 1645448 0.00
crit 22.29 19.87% 36830.49 33338 44968 36840.94 34166 40472 820814 820814 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16753 (21991) 12.7% (16.7%) 46.0 9.74sec 215495 180532 0 0 0 0.0% 0.0% 0.0% 0.0% 377.1 16495 34178 20011 19.9% 0.0% 187.4%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.96 45.96 377.08 377.08 1.1937 2.2382 7545695.83 7545695.83 0.00 11019.47 180532.16
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 302.1 80.12% 16495.28 15001 20366 16498.88 16040 17006 4983504 4983504 0.00
crit 75.0 19.88% 34177.63 30902 41955 34184.20 32774 35735 2562192 2562192 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5238 4.0% 117.9 3.74sec 20017 0 16520 34223 20033 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.85 117.76 0.00 0.00 0.0000 0.0000 2359020.69 2359020.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.39 80.16% 16520.07 15001 20366 16524.43 15991 17248 1559371 1559371 0.00
crit 23.37 19.84% 34223.03 30902 41955 34231.87 31871 37331 799649 799649 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52431 / 4166
melee 52431 3.1% 33.3 11.80sec 55702 55007 48480 98074 55702 20.4% 0.0% 24.2% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.29 33.29 0.00 0.00 1.0126 0.0000 1854135.14 1854135.14 0.00 55007.42 55007.42
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.44 55.38% 48480.33 38145 58728 48507.09 43691 54350 893757 893757 0.00
crit 6.79 20.41% 98074.09 76291 117456 97994.10 0 117456 666223 666223 0.00
glance 8.06 24.21% 36504.25 28609 44046 36509.39 0 44046 294155 294155 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1940 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.31%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
divine_insight_shadow 25.4 2.2 17.1sec 15.7sec 9.80% 43.90%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_divine_insight_shadow
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:5.00%
  • default_value:0.00

Stack Uptimes

  • divine_insight_shadow_1:9.80%

Trigger Attempt Success

  • trigger_pct:5.01%

Spelldata details

  • id:124430
  • name:Divine Insight
  • tooltip:Your next Mind Blast spell is instant cast and costs no mana.
  • description:{$@spelldesc109175=|CFFFFFFFFDiscipline:|R When you cast Penance, there is a {$s1=40}% chance your next Power Word: Shield will both ignore and not cause the Weakened Soul effect. |CFFFFFFFFHoly:|R When you cast Greater Heal or Prayer of Healing, there is a {$s1=40}% chance your next Prayer of Mending will not trigger its cooldown, and will jump to each target instantly. |CFFFFFFFFShadow:|R Periodic damage from your Shadow Word: Pain has a 5% chance to reset the cooldown on Mind Blast and cause your next Mind Blast within {$124430d=12 seconds} to be instant cast and cost no mana.}
  • max_stacks:
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.23% 20.23%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.23%

    Trigger Attempt Success

    • trigger_pct:15.21%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.5sec 20.7sec 43.56% 43.86%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.56%

    Trigger Attempt Success

    • trigger_pct:1.62%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.71% 42.71%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.71%

    Trigger Attempt Success

    • trigger_pct:14.32%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.70% 49.49%

Buff details

  • buff initial source:priest_90_di_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.70%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.67%

Buff details

  • buff initial source:priest_90_di_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_di_swi
devouring_plague Shadow Orb 22.0 66.1 3.0 3.0 134115.1
halo Mana 10.9 442007.3 40500.0 40500.1 7.1
mind_blast Mana 56.8 267400.8 4703.9 4703.8 24.4
mind_flay Mana 90.5 271578.2 3000.0 3000.0 29.6
shadow_word_death Mana 14.9 116594.4 7800.0 7800.3 14.8
shadow_word_insanity Mana 31.1 233530.8 7500.0 7500.1 26.2
shadow_word_pain Mana 57.6 759817.3 13200.0 13200.0 14.0
vampiric_touch Mana 46.0 413660.2 9000.0 8999.9 23.9
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.29 141382.37 (5.68%) 4247.41 158198.11 52.81%
Shadow Orbs from Mind Blast Shadow Orb 56.85 56.85 (88.28%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.55 7.55 (11.72%) 1.00 0.00 0.00%
Devouring Plague Health Health 239.00 0.00 (-nan%) 0.00 3318939.78 100.00%
Vampiric Touch Mana Mana 494.84 1930776.14 (77.61%) 3901.82 684988.66 26.19%
mp5_regen Mana 1801.21 415672.32 (16.71%) 230.77 124690.70 23.08%
Resource RPS-Gain RPS-Loss
Mana 5523.26 5560.46
Shadow Orb 0.14 0.15
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 283246.47 203100.00 300000.00
Shadow Orb 1.35 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 23.3%
shadowfiend-Mana Cap 23.3%
lightwell-Mana Cap 23.3%

Procs

Count Interval
Shadowy Recall Extra Tick 368.4 1.2sec
Shadowy Apparition Procced 114.1 3.9sec
Divine Insight Mind Blast CD Reset 48.6 15.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_di_swi Damage Per Second
Count 49992
Mean 131739.09
Minimum 123626.94
Maximum 142522.19
Spread ( max - min ) 18895.24
Range [ ( max - min ) / 2 * 100% ] 7.17%
Standard Deviation 2509.9304
5th Percentile 127662.50
95th Percentile 135956.43
( 95th Percentile - 5th Percentile ) 8293.93
Mean Distribution
Standard Deviation 11.2256
95.00% Confidence Intervall ( 131717.08 - 131761.09 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 13
0.1% Error 1394
0.1 Scale Factor Error with Delta=300 53778
0.05 Scale Factor Error with Delta=300 215113
0.01 Scale Factor Error with Delta=300 5377829
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131739.09
Distribution Chart

Damage

Sample Data
Count 49992
Mean 57444523.71
Distribution Chart

DTPS

Sample Data priest_90_di_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_di_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_di_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 314.37
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 7.22 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.95 shadow_word_death,if=active_enemies<=5
F 57.23 mind_blast,if=active_enemies<=6&cooldown_react
G 44.69 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 47.07 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 31.14 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 10.91 halo,if=talent.halo.enabled
M 14.80 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.47 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 18.83 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 50.20 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 12.88 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTQFTFMIGIGHHFTFTIGFGHHMWWLWWFTIGHFHTFIGMTIFGHHTFTIGLTFIGHHDFTIGQQQQQFTIGHHFMTIGFTLWIGWWFHHTQFMTIGTFGHHTQQQQFTIGLFMHHGTBQFTIGTFTHHIGQFMTIGTFTHLFIGWWWHHFIGMQQQQQQFTQQQQFTHGFHIGMTFTLTHHFGFGMTQFTHHTFGIGTQFMTLHHWWWFIGHFTFMHTIGQFIGHTFTHLIGFIGHMTFTHTIGFBGHTQFMTHFIGLTEEFGHMTFEEHIGTFDEEGHTQFTEDEHGQFLTEEHGQF9MTPEEHIGFTEDEHIFGTEEH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_di_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.22
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_fdcl : 131249 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
131248.6 131248.6 20.30 / 0.02% 3767 / 2.9% 25.4 5008.1 4980.8 Mana 0.44% 44.8 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.95 0.00 4.04 3.03 2.07 1.88 1.97
Normalized 1.00 0.00 0.82 0.61 0.42 0.38 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=4.95, SpellDamage=4.04, HitRating=3.03, CritRating=2.07, HasteRating=1.88, MasteryRating=1.97 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_fdcl": Intellect=4.95, SpellDamage=4.04, HitRating=0.00, CritRating=2.07, HasteRating=1.88, MasteryRating=1.97 )

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:348737|250037|197467|190456|99461|99100|83437|51789&chds=0,697473&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++348737++devouring_plague,9482C9,0,0,15|t++250037++halo,9482C9,1,0,15|t++197467++shadow_word_pain,9482C9,2,0,15|t++190456++vampiric_touch,9482C9,3,0,15|t++99461++shadow_word_death,9482C9,4,0,15|t++99100++mind_blast,9482C9,5,0,15|t++83437++mind_spike,4A79D3,6,0,15|t++51789++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_fdcl Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:16,14,12,10,10,7,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|vampiric_touch_mastery|shadowfiend: melee|shadow_word_death|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_pi_fdcl Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.95,4.04,3.03,2.07,1.97,1.88|4.92,4.01,3.00,2.04,1.94,1.85|4.98,4.07,3.06,2.10,2.00,1.91&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.95++Int,FFFFFF,0,0,15,0.1,e|t++++4.04++SP,FFFFFF,0,1,15,0.1,e|t++++3.03++Hit,FFFFFF,0,2,15,0.1,e|t++++2.07++Crit,FFFFFF,0,3,15,0.1,e|t++++1.97++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.88++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.947&chtt=Scale Factors|priest_90_pi_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6865443322100zyyyvvtsrpoonmmlkjiihhhiiihhggggggggfffgggggfeddcccbbbaaabbbbbbbcdddddcccbbbbbbbbbccccbbbbbcccdddddddddddeefggggggggfffffffeeedcbbbaaaaabccccddddddeeeeeeeeeedddddeeeffggfffffffffggffeeddccbbabcddddddddddddddccccccbaaaaabbccddddeeeffghiiiiiiiiihhhhghggggfeddcccbbbaaaaaaaaaaaabccdddddedddddddccccbbaaZZZZZZaaabbbcccdddefffggggghhhhhhiiiihhgggghhiijjjkkkklllmmmnnnmmmllkkjjiiiiihhhggggffffffffffeeeeeeeeeeeffffffgggghhhhhiiiijjjjjjkkkkkkkjjjjjjjjjjjjjjjjiiiiiiiihhiiiiijjjjjjkkkkllmmmnnnnnnnnnnnnnmmmmlllkkkjjjjjiiiihhhhgggggggghggggggggfgg&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5374,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=131249|max=244208&chxp=1,1,54,100&chtt=priest_90_pi_fdcl DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,16,24,24,40,56,112,168,304,312,520,680,1032,1440,1632,2040,2352,2800,2992,2728,3440,3416,3168,3128,2536,2352,2280,2048,1696,1496,1224,928,792,576,512,336,208,168,168,80,48,72,24,0,0,0,16&chds=0,3440&chbh=5&chxt=x&chxl=0:|min=121975|avg=131249|max=140568&chxp=0,1,50,100&chtt=priest_90_pi_fdcl DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:31.2,18.1,13.2,12.6,12.2,5.0,3.9,2.8,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 140.5s|mind_spike 81.6s|shadow_word_pain 59.4s|mind_blast 56.7s|vampiric_touch 54.7s|devouring_plague 22.5s|shadow_word_death 17.5s|halo 12.7s|shadowfiend 2.4s|waiting 2.0s&chtt=priest_90_pi_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_fdcl 131249
devouring_plague 6147 (17416) 4.7% (13.3%) 19.4 24.00sec 403820 348737 117697 243427 142541 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.42 19.42 0.00 0.00 1.1580 0.0000 2767711.93 2767711.93 0.00 348736.57 348736.57
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.58 80.24% 117696.58 107519 143944 117712.61 111103 126429 1833738 1833738 0.00
crit 3.84 19.76% 243426.85 221488 296525 239685.46 0 296525 933974 933974 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2699 2.1% 51.0 8.83sec 23822 0 19671 40754 23853 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.99 50.92 0.00 0.00 0.0000 0.0000 1214626.48 1214626.48 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 40.82 80.16% 19670.97 17856 23904 19676.49 18707 20643 802994 802994 0.00
crit 10.10 19.84% 40753.52 36784 49242 40766.38 36784 46796 411633 411633 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8571 6.5% 19.4 24.00sec 198725 0 0 0 0 0.0% 0.0% 0.0% 0.0% 162.7 19542 40454 23719 20.0% 0.0% 26.5%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.42 19.42 162.68 162.68 0.0000 0.7336 3858654.57 3858654.57 0.00 32333.29 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 130.2 80.02% 19541.60 17856 23904 19543.68 18624 20581 2543955 2543955 0.00
crit 32.5 19.98% 40453.66 36784 49242 40455.32 38097 43121 1314699 1314699 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7069) 0.0% (5.4%) 11.1 42.05sec 287627 250037 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.06 11.06 0.00 0.00 1.1504 0.0000 0.00 0.00 0.00 250036.84 250036.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.84 79.98% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.21 20.02% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7069 5.4% 11.1 42.05sec 287627 0 118546 245489 143814 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.06 22.12 0.00 0.00 0.0000 0.0000 3180468.63 3180468.63 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 80.10% 118546.27 109581 139821 118604.49 112078 125514 2099841 2099841 0.00
crit 4.40 19.90% 245488.70 225736 288030 243293.52 0 288030 1080628 1080628 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 42.05sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.06 115.71 0.00 0.00 0.0000 0.0000 0.00 22878680.80 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.94 76.86% 0.00 0 0 0.00 0 0 0 14090047 100.00
crit 26.77 23.14% 0.00 0 0 0.00 0 0 0 8788633 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12482 9.5% 48.9 9.25sec 114943 99100 94694 196223 114944 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.90 48.90 0.00 0.00 1.1599 0.0000 5620173.48 5620173.48 0.00 99100.25 99100.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.14 80.06% 94693.52 86183 115909 94719.24 91770 98004 3706660 3706660 0.00
crit 9.75 19.94% 196222.85 177536 238773 196254.85 0 224177 1913513 1913513 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 12314 (16158) 9.4% (12.3%) 83.6 5.27sec 86997 51789 0 0 0 0.0% 0.0% 0.0% 0.0% 180.2 25321 52515 30770 20.0% 0.0% 28.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.61 83.61 180.17 180.17 1.6798 0.7045 5543888.54 5543888.54 0.00 51788.93 51788.93
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 83.61 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 144.1 79.96% 25321.36 22887 30640 25328.41 24478 26293 3648170 3648170 0.00
crit 36.1 20.04% 52515.19 47146 63119 52530.47 49138 56060 1895718 1895718 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3844 2.9% 56.3 7.68sec 30724 0 25315 52530 30739 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.31 56.28 0.00 0.00 0.0000 0.0000 1730073.73 1730073.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.07 80.07% 25315.08 22887 30640 25320.62 23853 27024 1140858 1140858 0.00
crit 11.22 19.93% 52530.25 47146 63119 52551.23 47146 59985 589216 589216 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 15118 11.5% 70.7 6.19sec 96340 83437 79515 164725 96339 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.69 70.69 0.00 0.00 1.1547 0.0000 6809838.24 6809838.24 0.00 83436.52 83436.52
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 56.73 80.25% 79514.92 72412 97688 79526.66 76079 83243 4510773 4510773 0.00
crit 13.96 19.75% 164724.64 149169 201238 164760.49 151687 180473 2299066 2299066 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
power_infusion 0 0.0% 4.3 120.96sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3866 2.9% 15.1 4.87sec 115318 99461 94730 196589 115319 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.11 15.11 0.00 0.00 1.1595 0.0000 1742352.47 1742352.47 0.00 99460.70 99460.70
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.06 79.79% 94730.45 83662 112752 94806.54 87197 104096 1142007 1142007 0.00
crit 3.05 20.21% 196588.92 172343 232270 189853.69 0 232270 600346 600346 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19840 (26055) 15.1% (19.9%) 51.7 8.72sec 226895 197467 0 0 0 0.0% 0.0% 0.0% 0.0% 461.3 14682 30356 19357 29.8% 0.0% 197.7%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.68 51.68 461.29 461.29 1.1490 1.9303 8929365.86 8929365.86 0.00 12346.47 197466.64
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 51.68 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 323.7 70.17% 14682.25 13422 17966 14685.12 14301 15052 4752580 4752580 0.00
crit 137.6 29.83% 30356.11 27649 37009 30362.13 29488 31291 4176786 4176786 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6215 4.7% 144.4 3.09sec 19375 0 14710 30419 19391 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 144.37 144.25 0.00 0.00 0.0000 0.0000 2797190.77 2797190.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 101.26 70.20% 14709.78 13422 17966 14713.06 14181 15226 1489550 1489550 0.00
crit 42.99 29.80% 30418.90 27649 37009 30425.52 29048 32312 1307640 1307640 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2216 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5739 4.4% 119.4 3.75sec 21647 0 18334 36873 22030 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.41 117.33 0.00 0.00 0.0000 0.0000 2584800.18 2584800.18 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.93 80.06% 18333.68 16669 22484 18338.00 17845 18956 1722154 1722154 0.00
crit 23.40 19.94% 36872.92 33338 44968 36885.81 34553 40091 862646 862646 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17632 (23148) 13.4% (17.6%) 47.2 9.50sec 221069 190456 0 0 0 0.0% 0.0% 0.0% 0.0% 396.0 16538 34264 20053 19.8% 0.0% 190.2%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 395.95 395.95 1.1608 2.1638 7940047.44 7940047.44 0.00 11436.26 190456.36
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 317.4 80.17% 16538.00 15001 20366 16541.54 16076 17000 5249715 5249715 0.00
crit 78.5 19.83% 34263.82 30902 41955 34270.85 32662 35886 2690332 2690332 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5516 4.2% 123.8 3.57sec 20066 0 16551 34282 20082 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.78 123.68 0.00 0.00 0.0000 0.0000 2483819.34 2483819.34 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.05 80.08% 16550.61 15001 20366 16555.14 15922 17230 1639283 1639283 0.00
crit 24.63 19.92% 34282.24 30902 41955 34291.22 32027 37036 844536 844536 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52825 / 4197
melee 52825 3.2% 33.3 11.78sec 56004 55438 48674 98500 56005 20.5% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.35 33.35 0.00 0.00 1.0102 0.0000 1867496.05 1867496.05 0.00 55438.34 55438.34
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.53 55.57% 48674.07 38145 58728 48695.61 43794 54446 901962 901962 0.00
crit 6.83 20.50% 98499.63 76291 117456 98497.28 80873 117456 673198 673198 0.00
glance 7.98 23.93% 36632.08 28609 44046 36650.05 0 44046 292337 292337 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.21sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1307 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.92%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.24% 20.24%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.24%

    Trigger Attempt Success

    • trigger_pct:15.28%
glyph_mind_spike 39.2 31.5 11.3sec 6.2sec 51.75% 76.73%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.94%
  • glyph_mind_spike_2:19.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.4 36.3sec 20.2sec 44.44% 44.85%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.44%

    Trigger Attempt Success

    • trigger_pct:1.60%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.75% 42.75%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.75%

    Trigger Attempt Success

    • trigger_pct:14.24%
power_infusion 4.3 0.0 120.9sec 121.0sec 18.58% 20.68%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.78% 49.39%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 47.3 30.5 9.3sec 5.7sec 42.19% 100.00%

Buff details

  • buff initial source:priest_90_pi_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.70%
  • surge_of_darkness_2:9.49%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.47%

Buff details

  • buff initial source:priest_90_pi_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_fdcl
devouring_plague Shadow Orb 19.4 58.3 3.0 3.0 134607.3
halo Mana 11.1 420036.2 37986.2 37986.2 7.6
mind_blast Mana 48.9 422807.3 8647.2 8647.2 13.3
mind_flay Mana 83.6 238503.4 2852.6 2852.5 30.5
shadow_word_death Mana 15.1 113463.4 7509.4 7509.6 15.4
shadow_word_pain Mana 51.7 652398.9 12623.2 12623.2 18.0
vampiric_touch Mana 47.2 408594.2 8665.4 8665.4 25.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.35 115820.38 (5.16%) 3473.33 184290.02 61.41%
Shadow Orbs from Mind Blast Shadow Orb 48.90 48.90 (86.48%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.65 7.65 (13.52%) 1.00 0.00 0.00%
Devouring Plague Health Health 213.60 0.00 (-nan%) 0.00 2966217.67 100.00%
Vampiric Touch Mana Mana 519.63 1756669.97 (78.30%) 3380.60 990080.11 36.05%
mp5_regen Mana 1801.21 371003.84 (16.54%) 205.97 169359.19 31.34%
Resource RPS-Gain RPS-Loss
Mana 4980.80 5008.13
Shadow Orb 0.13 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 287689.63 225000.00 300000.00
Shadow Orb 1.29 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 31.5%
shadowfiend-Mana Cap 31.5%
lightwell-Mana Cap 31.5%

Procs

Count Interval
Shadowy Recall Extra Tick 375.1 1.2sec
Shadowy Apparition Procced 119.4 3.7sec
FDCL Mind Spike proc 77.9 5.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_pi_fdcl Damage Per Second
Count 49992
Mean 131248.64
Minimum 121975.18
Maximum 140567.54
Spread ( max - min ) 18592.36
Range [ ( max - min ) / 2 * 100% ] 7.08%
Standard Deviation 2315.9619
5th Percentile 127660.12
95th Percentile 135193.74
( 95th Percentile - 5th Percentile ) 7533.62
Mean Distribution
Standard Deviation 10.3581
95.00% Confidence Intervall ( 131228.34 - 131268.94 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1196
0.1 Scale Factor Error with Delta=300 45787
0.05 Scale Factor Error with Delta=300 183149
0.01 Scale Factor Error with Delta=300 4578745
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 131248.64
Distribution Chart

Damage

Sample Data
Count 49992
Mean 57203011.65
Distribution Chart

DTPS

Sample Data priest_90_pi_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 336.48
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.26 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.11 shadow_word_death,if=active_enemies<=5
F 49.15 mind_blast,if=active_enemies<=6&cooldown_react
G 40.52 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 48.04 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 18.57 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.06 halo,if=talent.halo.enabled
M 15.16 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.34 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.10 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 52.12 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 53.61 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 11.16 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFTRTFGGHHJMRQFRTRTFTHGGHRLWWWWFHMTHRRFGRTRFHRGHRTFMTGTJFJHLRRGHFTGFMTHTHGFRTCTRTFGHJRWLRFMWHTFTHTGJRFHRJGJRFMHJJRGFHJLRRTFBGHRTQFMTGHRTFTGHTFTHGRLWWWWWRFHMTRHFTGTCFGHRTHFMJRGLTFHTGRHQFTFGHMRTGHFRRTFGHLRRWFHHMTFTGRTFGHHRTFMTRTGFLHGHJRQFRTFMBCGHHRGFTRTRQFTRTEDEFGHGHJEEFLMRTPEEFGHHTGEDEFRTPEEFHGH9JDEEFGJLRRTEDEFHHGTEE

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_mb : 129054 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
129054.2 129054.2 17.22 / 0.01% 3212 / 2.5% 21.9 5417.4 5390.7 Mana 0.33% 37.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.74 0.00 3.85 2.96 1.97 1.65 1.92
Normalized 1.00 0.00 0.81 0.62 0.42 0.35 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.00 0.02 0.03 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=4.74, SpellDamage=3.85, HitRating=2.96, CritRating=1.97, HasteRating=1.65, MasteryRating=1.92 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_mb": Intellect=4.74, SpellDamage=3.85, HitRating=0.00, CritRating=1.97, HasteRating=1.65, MasteryRating=1.92 )

Charts

http://9.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:352550|251103|190934|171322|99637|98733|52246&chds=0,705100&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++352550++devouring_plague,9482C9,0,0,15|t++251103++halo,9482C9,1,0,15|t++190934++vampiric_touch,9482C9,2,0,15|t++171322++shadow_word_pain,9482C9,3,0,15|t++99637++shadow_word_death,9482C9,4,0,15|t++98733++mind_blast,9482C9,5,0,15|t++52246++mind_flay,9482C9,6,0,15&chtt=priest_90_pi_mb Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,16,15,9,9,7,6,5,5,5,5,5,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_blast|mindbender: melee|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|mind_flay_mastery|shadowy_apparition|devouring_plague|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_mb Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.74,3.85,2.96,1.97,1.92,1.65|4.72,3.82,2.93,1.95,1.89,1.62|4.77,3.87,2.98,1.99,1.94,1.67&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.74++Int,FFFFFF,0,0,15,0.1,e|t++++3.85++SP,FFFFFF,0,1,15,0.1,e|t++++2.96++Hit,FFFFFF,0,2,15,0.1,e|t++++1.97++Crit,FFFFFF,0,3,15,0.1,e|t++++1.92++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.65++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.702&chtt=Scale Factors|priest_90_pi_mb%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:57677766555442223zzyxvtsqpnnmlkiiihgiigfedccdddddddddffghffghiijjhhhgffeefeeegggffffddccccccddccbbZXXYYYZZabcddeeffghhjllmmlllkjjihhgggfeeedccccdcccdcddeddddedddedcbbbcccccddddeefffeddeefffffeeeeddeeeeeeffggfeddccdcccbbaZYYYYXWWXXXYZZabcdeggijkkmoppppqqqqponlkjjiihhgedccccbbbbaaaaaaZZZZZZZaaaZZZaabcdeeffgggghggggggggggfeeddcccddefgghhhiiiiiiiiiiiihggfedddeefghhijjklmmnnnooooponnmmlkkkjjihhhhgggggfffffffffeeeeeeeeeefghhijkllmnnnooooppppppooonnnmmllkkklkkkkkkjjjjjjjjiiiiiihhhijjklmmnoppqrssttuuvvuuuttsrrqpoonmmllkkkjjjjiiiihhhhghgggggfffffffffffff&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5556,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=129054|max=232261&chxp=1,1,56,100&chtt=priest_90_pi_mb DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,8,24,48,40,80,96,128,256,304,544,904,1296,1320,1424,1960,2272,2776,2696,3240,3216,3280,3096,2696,2920,2576,2256,2096,2000,1376,1208,1064,696,512,480,312,216,168,160,96,24,56,32,8,0,8,0,0,0,8&chds=0,3280&chbh=5&chxt=x&chxl=0:|min=122149|avg=129054|max=137881&chxp=0,1,44,100&chtt=priest_90_pi_mb DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:47.4,15.5,12.1,11.4,4.6,3.9,2.8,1.8,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 213.6s|shadow_word_pain 69.7s|vampiric_touch 54.4s|mind_blast 51.3s|devouring_plague 20.6s|shadow_word_death 17.5s|halo 12.7s|mindbender 8.0s|waiting 1.5s&chtt=priest_90_pi_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_mb 129054
devouring_plague 5705 (16132) 4.4% (12.5%) 17.8 26.50sec 407812 352550 118728 245810 144200 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 17.81 0.00 0.00 1.1568 0.0000 2568482.74 2568482.74 0.00 352550.04 352550.04
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.24 79.96% 118728.00 107519 143944 118762.94 110379 127659 1690895 1690895 0.00
crit 3.57 20.04% 245809.97 221488 296525 240483.59 0 296525 877588 877588 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2494 1.9% 46.8 9.64sec 24009 0 19789 41020 24040 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.78 46.72 0.00 0.00 0.0000 0.0000 1123109.26 1123109.26 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.36 79.97% 19788.81 17856 23904 19795.73 18758 20889 739341 739341 0.00
crit 9.36 20.03% 41019.52 36784 49242 41031.10 36784 47457 383768 383768 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7933 6.1% 17.8 26.50sec 200559 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.2 19734 40839 23945 20.0% 0.0% 24.3%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 17.81 149.19 149.19 0.0000 0.7340 3572349.11 3572349.11 0.00 32624.19 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.81 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.4 80.05% 19734.45 17856 23904 19739.90 18911 20703 2356809 2356809 0.00
crit 29.8 19.95% 40838.70 36784 49242 40847.90 38322 44085 1215540 1215540 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7112) 0.0% (5.5%) 11.1 41.84sec 288063 251103 0 0 0 19.7% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.11 11.11 0.00 0.00 1.1473 0.0000 0.00 0.00 0.00 251103.07 251103.07
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.92 80.34% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.18 19.66% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7112 5.5% 11.1 41.84sec 288063 0 118579 245404 144033 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.11 22.21 0.00 0.00 0.0000 0.0000 3199304.27 3199304.27 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.75 79.93% 118578.76 109581 139821 118637.15 111820 127222 2105323 2105323 0.00
crit 4.46 20.07% 245403.99 225736 288030 243297.13 0 288030 1093981 1093981 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.84sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.11 116.75 0.00 0.00 0.0000 0.0000 0.00 23086370.03 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.76 76.88% 0.00 0 0 0.00 0 0 0 14223360 100.00
crit 26.99 23.12% 0.00 0 0 0.00 0 0 0 8863010 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11238 8.7% 44.0 10.31sec 114993 98733 94760 196259 114992 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.03 44.03 0.00 0.00 1.1647 0.0000 5063106.07 5063106.07 0.00 98732.59 98732.59
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.25 80.07% 94759.66 86183 115909 94783.94 91396 98218 3340532 3340532 0.00
crit 8.78 19.93% 196258.80 177536 238773 196354.81 177536 238773 1722574 1722574 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18864 (24773) 14.6% (19.2%) 123.5 3.59sec 90374 52246 0 0 0 0.0% 0.0% 0.0% 0.0% 276.8 25279 52422 30698 20.0% 0.0% 43.7%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.47 123.47 276.80 276.80 1.7298 0.7116 8496959.16 8496959.16 0.00 52246.38 52246.38
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 123.47 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 221.5 80.04% 25278.70 22887 30640 25286.24 24684 25883 5600166 5600166 0.00
crit 55.3 19.96% 52422.13 47146 63119 52440.88 50063 54897 2896793 2896793 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5908 4.6% 86.8 5.06sec 30673 0 25275 52414 30692 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.76 86.70 0.00 0.00 0.0000 0.0000 2661144.22 2661144.22 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 69.40 80.04% 25274.83 22887 30640 25281.73 24332 26819 1754017 1754017 0.00
crit 17.31 19.96% 52413.91 47146 63119 52436.26 48282 58341 907127 907127 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.78sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1540 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
power_infusion 0 0.0% 4.3 121.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.29 4.29 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.29 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3864 3.0% 15.1 4.87sec 115546 99637 94771 196885 115544 20.3% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.07 15.07 0.00 0.00 1.1597 0.0000 1741747.42 1741747.42 0.00 99636.60 99636.60
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.01 79.66% 94771.01 83662 112752 94838.81 86789 103703 1137950 1137950 0.00
crit 3.07 20.34% 196885.49 172343 232270 190335.75 0 232270 603797 603797 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 20196 (26540) 15.6% (20.6%) 60.7 7.41sec 196584 171322 0 0 0 0.0% 0.0% 0.0% 0.0% 469.9 14669 30330 19340 29.8% 0.0% 197.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.75 60.75 469.87 469.87 1.1475 1.8960 9087249.98 9087249.98 0.00 12432.00 171321.84
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.75 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 329.7 70.17% 14669.05 13422 17966 14671.29 14309 15054 4836787 4836787 0.00
crit 140.1 29.83% 30330.07 27649 37009 30335.10 29466 31375 4250463 4250463 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6344 4.9% 147.2 3.03sec 19389 0 14700 30404 19405 30.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.22 147.10 0.00 0.00 0.0000 0.0000 2854396.32 2854396.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 103.03 70.04% 14700.20 13422 17966 14702.76 14252 15203 1514518 1514518 0.00
crit 44.07 29.96% 30403.58 27649 37009 30409.70 29026 32091 1339879 1339879 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5778 4.5% 120.3 3.72sec 21634 0 18334 36883 22014 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 120.26 118.19 0.00 0.00 0.0000 0.0000 2601688.19 2601688.19 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.74 80.16% 18334.16 16669 22484 18337.72 17883 18818 1737040 1737040 0.00
crit 23.44 19.84% 36882.54 33338 44968 36892.52 34698 39271 864648 864648 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17587 (23085) 13.6% (17.9%) 46.9 9.56sec 221842 190934 0 0 0 0.0% 0.0% 0.0% 0.0% 394.3 16550 34297 20087 19.9% 0.0% 189.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 46.86 394.26 394.26 1.1619 2.1630 7919487.49 7919487.49 0.00 11458.31 190934.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.86 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 315.7 80.07% 16550.20 15001 20366 16553.68 16084 17042 5224664 5224664 0.00
crit 78.6 19.93% 34296.73 30902 41955 34305.31 32908 35763 2694824 2694824 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5499 4.3% 123.3 3.59sec 20083 0 16559 34308 20100 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.28 123.18 0.00 0.00 0.0000 0.0000 2475916.60 2475916.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.60 80.05% 16558.80 15001 20366 16563.17 15950 17185 1632688 1632688 0.00
crit 24.58 19.95% 34307.76 30902 41955 34318.04 32068 37235 843229 843229 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40569 / 10533
melee 40569 8.2% 107.5 4.09sec 44065 41420 38464 77560 44065 20.2% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.49 107.49 0.00 0.00 1.0639 0.0000 4736697.17 4736697.17 0.00 41419.54 41419.54
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.83 55.66% 38463.56 30516 46982 38469.19 36517 40750 2301277 2301277 0.00
crit 21.74 20.22% 77559.54 61032 93964 77558.73 70684 84394 1686055 1686055 0.00
glance 25.92 24.12% 28906.32 22887 35237 28909.16 26177 31381 749365 749365 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1249 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 10.99%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.24% 20.24%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.24%

    Trigger Attempt Success

    • trigger_pct:15.34%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.3 36.3sec 20.2sec 44.36% 44.80%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.36%

    Trigger Attempt Success

    • trigger_pct:1.59%
light_of_the_cosmos 9.9 0.0 47.7sec 47.7sec 42.87% 42.87%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.87%

    Trigger Attempt Success

    • trigger_pct:14.27%
power_infusion 4.3 0.0 121.1sec 121.0sec 18.56% 20.93%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.78% 49.42%

Buff details

  • buff initial source:priest_90_pi_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.38% 83.94%

Buff details

  • buff initial source:priest_90_pi_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_mb
devouring_plague Shadow Orb 17.8 53.4 3.0 3.0 135937.2
halo Mana 11.1 420064.7 37822.4 37822.3 7.6
mind_blast Mana 44.0 380763.9 8647.9 8647.9 13.3
mind_flay Mana 123.5 354144.8 2868.4 2868.4 31.5
shadow_word_death Mana 15.1 113224.6 7510.9 7511.2 15.4
shadow_word_pain Mana 60.7 765607.6 12603.4 12603.5 15.6
vampiric_touch Mana 46.9 406336.3 8671.4 8671.4 25.6
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.49 266012.94 (10.96%) 2474.69 204910.00 43.51%
Shadow Orbs from Mind Blast Shadow Orb 44.03 44.03 (85.24%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.63 7.63 (14.76%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.91 0.00 (-nan%) 0.00 2720502.44 100.00%
Vampiric Touch Mana Mana 517.44 1787188.91 (73.60%) 3453.93 947900.53 34.66%
mp5_regen Mana 1801.21 374901.16 (15.44%) 208.14 165461.87 30.62%
Resource RPS-Gain RPS-Loss
Mana 5390.66 5417.38
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 287961.31 230700.00 300000.00
Shadow Orb 1.22 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 30.7%
shadowfiend-Mana Cap 30.7%
lightwell-Mana Cap 30.7%

Procs

Count Interval
Shadowy Recall Extra Tick 403.7 1.1sec
Shadowy Apparition Procced 120.3 3.7sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_pi_mb Damage Per Second
Count 49992
Mean 129054.18
Minimum 122149.40
Maximum 137880.74
Spread ( max - min ) 15731.33
Range [ ( max - min ) / 2 * 100% ] 6.09%
Standard Deviation 1964.1452
5th Percentile 125935.04
95th Percentile 132358.94
( 95th Percentile - 5th Percentile ) 6423.90
Mean Distribution
Standard Deviation 8.7846
95.00% Confidence Intervall ( 129036.96 - 129071.40 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 889
0.1 Scale Factor Error with Delta=300 32932
0.05 Scale Factor Error with Delta=300 131731
0.01 Scale Factor Error with Delta=300 3293296
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 129054.18
Distribution Chart

Damage

Sample Data
Count 49992
Mean 53364940.83
Distribution Chart

DTPS

Sample Data priest_90_pi_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 282.24
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 4.29 power_infusion,if=talent.power_infusion.enabled
D 4.09 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.07 shadow_word_death,if=active_enemies<=5
F 44.82 mind_blast,if=active_enemies<=6&cooldown_react
G 39.82 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 47.78 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.11 halo,if=talent.halo.enabled
M 13.73 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.57 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.00 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 64.13 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.93 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFTFHMGGHTFTFHTHGGWLWWWWFMHTAHFGTQFGHTHTFMGTLTFHGTHTFTGTHFMTGHTACTFTGLTWWWWWWWFHHTFGMTHHFGTFGLTHHTFGMATQFTGHHTFTGTFMTGHHLWWWWWFHTFHGTHFACGMTFHTGTLTHFTGTHTFMTGHTFTGHTFTHGLWWWAWWFHMTHQFTGTFGHTHFMTLGTFHTGTHTFTGTACFHMTGTHTFTLEEGHFMTHEEGQFTPEDEHFGHTPEEGFMTEEHFAGHL9EDEFGTEEFHHMGTPEEFT

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_pi_swi : 130878 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
130877.6 130877.6 19.84 / 0.02% 3700 / 2.8% 21.7 5835.0 5797.6 Mana 0.27% 40.1 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_pi_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.86 0.00 3.98 3.01 2.08 1.58 1.89
Normalized 1.00 0.00 0.82 0.62 0.43 0.32 0.39
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery > Haste
Pawn string
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=4.86, SpellDamage=3.98, HitRating=3.01, CritRating=2.08, HasteRating=1.58, MasteryRating=1.89 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_pi_swi": Intellect=4.86, SpellDamage=3.98, HitRating=0.00, CritRating=2.08, HasteRating=1.58, MasteryRating=1.89 )

Charts

http://4.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:350191|249905|190657|168638|157764|99503|98564|52885&chds=0,700382&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++350191++devouring_plague,9482C9,0,0,15|t++249905++halo,9482C9,1,0,15|t++190657++vampiric_touch,9482C9,2,0,15|t++168638++shadow_word_insanity,9482C9,3,0,15|t++157764++shadow_word_pain,9482C9,4,0,15|t++99503++shadow_word_death,9482C9,5,0,15|t++98564++mind_blast,9482C9,6,0,15|t++52885++mind_flay,9482C9,7,0,15&chtt=priest_90_pi_swi Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,13,11,9,6,6,5,4,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|shadow_word_insanity|mind_blast|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadowfiend: melee|shadow_word_death|devouring_plague_mastery&chtt=priest_90_pi_swi Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.86,3.98,3.01,2.08,1.89,1.58|4.83,3.95,2.98,2.05,1.86,1.55|4.89,4.00,3.04,2.11,1.92,1.60&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.86++Int,FFFFFF,0,0,15,0.1,e|t++++3.98++SP,FFFFFF,0,1,15,0.1,e|t++++3.01++Hit,FFFFFF,0,2,15,0.1,e|t++++2.08++Crit,FFFFFF,0,3,15,0.1,e|t++++1.89++Mastery,FFFFFF,0,4,15,0.1,e|t++++1.58++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.840&chtt=Scale Factors|priest_90_pi_swi%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:6765443322210zyyyuutsroonnmlkkjihhhhiihfedbcdccdddddddeeeccdeeefdcccbaaZZaaaacddddddddddddddeeddddaaaZaaabccdeffggghgghijjiihggeeedcbbbaaabaaaabbbbcccddddddddddddccbbbcbcbbcddefgghhhggffgggggggffefeeeeeeeefffffeedeedddcbaaZZZZZZZZaZacccdeefffghhijjiiijkjjiihggfggggffeeededccbbbbbbbbbbaaaabbbbbbbbbbcccccccbbbbbaaaabbbbcbbbbbbbcdeefgghhhhiiiiiiiiiiihgggffgghiijjkkllmmmnnnnnnmmmlkkjiiiiiiihhhhggghggggfffffffeeeeeeefffffffgghhhhhhhhhhiiijjjjjkkkkkkkkkkkkkkkjjjjjjiiiiiiihhhhhhhiiiijjjkkkklllmmnnnnooooooonnnnnmmmlllkkkkjjjjiiihhhhggggghhhhhhhiiiiijjjk&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5378,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=130878|max=243354&chxp=1,1,54,100&chtt=priest_90_pi_swi DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,48,16,112,176,144,320,392,528,728,1208,1320,1424,1864,2088,2088,2440,2736,2904,3000,3008,2600,2944,2480,2408,2312,1912,1672,1584,1312,928,656,504,496,376,376,264,216,120,64,88,24,16,32,40,0,0,8&chds=0,3008&chbh=5&chxt=x&chxl=0:|min=123321|avg=130878|max=139961&chxp=0,1,45,100&chtt=priest_90_pi_swi DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:40.3,15.7,12.1,11.4,8.1,4.6,3.9,2.8,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 181.6s|shadow_word_pain 70.6s|vampiric_touch 54.7s|mind_blast 51.5s|shadow_word_insanity 36.3s|devouring_plague 20.7s|shadow_word_death 17.5s|halo 12.8s|shadowfiend 2.4s|waiting 1.2s&chtt=priest_90_pi_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_pi_swi 130878
devouring_plague 5688 (16061) 4.3% (12.3%) 17.8 26.33sec 405331 350191 118269 244808 143562 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.85 17.85 0.00 0.00 1.1575 0.0000 2562314.73 2562314.73 0.00 350191.22 350191.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.28 80.01% 118268.83 107519 143944 118297.64 108810 125184 1689053 1689053 0.00
crit 3.57 19.99% 244808.28 221488 296525 240140.23 0 296525 873262 873262 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2485 1.9% 46.6 9.67sec 23999 0 19752 40945 24031 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.64 46.58 0.00 0.00 0.0000 0.0000 1119348.64 1119348.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 37.17 79.81% 19751.84 17856 23904 19757.08 18704 20919 734259 734259 0.00
crit 9.41 20.19% 40944.92 36784 49242 40961.41 36784 49242 385089 385089 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 7888 6.0% 17.8 26.33sec 199060 0 0 0 0 0.0% 0.0% 0.0% 0.0% 149.1 19642 40657 23834 19.9% 0.0% 24.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.85 17.85 149.07 149.07 0.0000 0.7368 3552937.12 3552937.12 0.00 32345.59 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.85 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 119.3 80.05% 19641.96 17856 23904 19647.27 18866 20678 2344090 2344090 0.00
crit 29.7 19.95% 40656.69 36784 49242 40664.30 37918 44307 1208847 1208847 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7082) 0.0% (5.4%) 11.1 42.03sec 287704 249905 0 0 0 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 11.07 0.00 0.00 1.1513 0.0000 0.00 0.00 0.00 249905.10 249905.10
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.85 79.95% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.22 20.05% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7082 5.4% 11.1 42.03sec 287704 0 118475 245320 143850 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.07 22.15 0.00 0.00 0.0000 0.0000 3186289.98 3186289.98 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.72 79.99% 118475.04 109581 139821 118521.05 111597 126384 2099206 2099206 0.00
crit 4.43 20.01% 245319.51 225736 288030 243777.91 0 288030 1087084 1087084 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 42.03sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.07 116.50 0.00 0.00 0.0000 0.0000 0.00 22993485.07 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.69 76.99% 0.00 0 0 0.00 0 0 0 14198475 100.00
crit 26.81 23.01% 0.00 0 0 0.00 0 0 0 8795010 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_pi_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11276 8.6% 44.2 10.27sec 114948 98564 94722 196169 114948 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.20 44.20 0.00 0.00 1.1662 0.0000 5080891.88 5080891.88 0.00 98564.32 98564.32
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.39 80.06% 94721.92 86183 115909 94748.02 91516 98286 3352070 3352070 0.00
crit 8.81 19.94% 196168.62 177536 238773 196261.93 177536 226375 1728821 1728821 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 16243 (21331) 12.4% (16.3%) 105.9 4.18sec 90693 52885 0 0 0 0.0% 0.0% 0.0% 0.0% 237.3 25349 52575 30811 20.1% 0.0% 37.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 105.89 105.89 237.33 237.33 1.7149 0.7048 7312278.90 7312278.90 0.00 52885.25 52885.25
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 105.89 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 189.7 79.94% 25349.43 22887 30640 25357.97 24723 26114 4809312 4809312 0.00
crit 47.6 20.06% 52575.35 47146 63119 52594.49 50162 55766 2502967 2502967 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5088 3.9% 74.4 5.88sec 30784 0 25353 52579 30802 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.42 74.38 0.00 0.00 0.0000 0.0000 2290888.90 2290888.90 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 59.49 79.99% 25353.03 22887 30640 25361.35 24203 26541 1508278 1508278 0.00
crit 14.88 20.01% 52578.77 47146 63119 52606.18 47776 58267 782611 782611 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
power_infusion 0 0.0% 4.3 121.01sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.30 4.30 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 4.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:120.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.power_infusion.enabled
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
shadow_word_death 3862 3.0% 15.1 4.87sec 115372 99503 94795 196476 115372 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.09 15.09 0.00 0.00 1.1595 0.0000 1741105.89 1741105.89 0.00 99503.14 99503.14
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 12.04 79.76% 94794.54 83662 112752 94871.92 87298 106124 1141073 1141073 0.00
crit 3.05 20.24% 196476.48 172343 232270 189605.34 0 232270 600033 600033 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 13569 10.4% 31.2 13.20sec 196139 168638 161797 334708 196141 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.21 31.21 0.00 0.00 1.1631 0.0000 6121216.85 6121216.85 0.00 168637.85 168637.85
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.01 80.14% 161796.64 148247 199962 161795.38 155152 168823 4046550 4046550 0.00
crit 6.20 19.86% 334708.31 305389 411923 334117.62 0 411923 2074667 2074667 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18850 (24751) 14.4% (18.9%) 61.3 7.32sec 181530 157764 0 0 0 0.0% 0.0% 0.0% 0.0% 438.2 14678 30346 19353 29.8% 0.0% 181.8%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.34 61.34 438.23 438.23 1.1507 1.8685 8481016.28 8481016.28 0.00 12519.78 157763.91
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 61.34 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 307.5 70.16% 14677.51 13422 17966 14680.24 14297 15069 4512919 4512919 0.00
crit 130.8 29.84% 30345.82 27649 37009 30351.87 29448 31331 3968097 3968097 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5901 4.5% 137.0 3.26sec 19376 0 14705 30420 19391 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 137.00 136.89 0.00 0.00 0.0000 0.0000 2654591.53 2654591.53 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 96.07 70.18% 14705.24 13422 17966 14708.50 14250 15457 1412746 1412746 0.00
crit 40.82 29.82% 30419.98 27649 37009 30427.92 28821 32504 1241846 1241846 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.91sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2232 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5602 4.3% 116.5 3.84sec 21640 0 18333 36900 22025 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.54 114.51 0.00 0.00 0.0000 0.0000 2522063.46 2522063.46 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 91.73 80.11% 18332.64 16669 22484 18336.59 17756 18863 1681721 1681721 0.00
crit 22.77 19.89% 36900.42 33338 44968 36909.49 34698 39653 840342 840342 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17637 (23151) 13.5% (17.7%) 47.1 9.51sec 221133 190657 0 0 0 0.0% 0.0% 0.0% 0.0% 395.7 16544 34275 20072 19.9% 0.0% 190.3%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.15 47.15 395.73 395.73 1.1599 2.1660 7942975.14 7942975.14 0.00 11433.69 190657.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 47.15 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 317.0 80.11% 16544.30 15001 20366 16548.40 16115 17013 5244738 5244738 0.00
crit 78.7 19.89% 34274.90 30902 41955 34283.58 32943 35910 2698237 2698237 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5514 4.2% 123.7 3.58sec 20069 0 16552 34291 20086 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 123.71 123.61 0.00 0.00 0.0000 0.0000 2482728.16 2482728.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.98 80.08% 16551.65 15001 20366 16556.28 15936 17130 1638278 1638278 0.00
crit 24.63 19.92% 34291.16 30902 41955 34304.34 32082 37040 844450 844450 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52774 / 4192
melee 52774 3.2% 33.3 11.78sec 55936 55369 48639 98417 55937 20.5% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.34 33.34 0.00 0.00 1.0103 0.0000 1865000.79 1865000.79 0.00 55369.20 55369.20
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.47 55.39% 48639.30 38145 58728 48662.10 43850 53948 898281 898281 0.00
crit 6.83 20.49% 98416.54 76291 117456 98466.86 0 117456 672434 672434 0.00
glance 8.04 24.12% 36599.71 28609 44046 36615.39 0 44046 294286 294286 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.19sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1313 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.03%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.24% 20.24%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.24%

    Trigger Attempt Success

    • trigger_pct:15.43%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.5 9.3 36.3sec 20.2sec 44.39% 44.82%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:44.39%

    Trigger Attempt Success

    • trigger_pct:1.63%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.76% 42.76%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.76%

    Trigger Attempt Success

    • trigger_pct:14.18%
power_infusion 4.3 0.0 120.9sec 121.0sec 18.58% 20.54%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • power_infusion_1:18.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Spell casting speed increased by {$s1=20}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses the Priest with power, increasing spell casting speed by {$s1=20}% and reducing the mana cost of all spells by {$s2=20}%. Lasts {$d=20 seconds}.
  • max_stacks:
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.1sec 10.1sec 9.78% 49.42%

Buff details

  • buff initial source:priest_90_pi_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.78%

Trigger Attempt Success

  • trigger_pct:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.45%

Buff details

  • buff initial source:priest_90_pi_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_pi_swi
devouring_plague Shadow Orb 17.8 53.5 3.0 3.0 135110.2
halo Mana 11.1 420728.3 37989.4 37989.4 7.6
mind_blast Mana 44.2 382438.4 8652.2 8652.2 13.3
mind_flay Mana 105.9 302605.3 2857.8 2857.8 31.7
shadow_word_death Mana 15.1 113338.1 7510.0 7510.2 15.4
shadow_word_insanity Mana 31.2 225805.2 7235.6 7235.4 27.1
shadow_word_pain Mana 61.3 774407.9 12624.1 12624.2 14.4
vampiric_touch Mana 47.1 408937.5 8673.7 8673.7 25.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.34 126262.26 (4.84%) 3786.93 173812.14 57.92%
Shadow Orbs from Mind Blast Shadow Orb 44.20 44.20 (85.27%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.63 7.63 (14.73%) 1.00 0.00 0.00%
Devouring Plague Health Health 195.65 0.00 (-nan%) 0.00 2716963.02 100.00%
Vampiric Touch Mana Mana 519.34 2060991.35 (78.92%) 3968.46 684241.45 24.92%
mp5_regen Mana 1801.21 424142.65 (16.24%) 235.48 116220.37 21.51%
Resource RPS-Gain RPS-Loss
Mana 5797.59 5835.03
Shadow Orb 0.12 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 283139.24 198900.00 300000.00
Shadow Orb 1.29 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 21.7%
shadowfiend-Mana Cap 21.7%
lightwell-Mana Cap 21.7%

Procs

Count Interval
Shadowy Recall Extra Tick 381.5 1.2sec
Shadowy Apparition Procced 116.5 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_pi_swi Damage Per Second
Count 49992
Mean 130877.64
Minimum 123321.35
Maximum 139961.42
Spread ( max - min ) 16640.07
Range [ ( max - min ) / 2 * 100% ] 6.36%
Standard Deviation 2263.8735
5th Percentile 127326.98
95th Percentile 134726.77
( 95th Percentile - 5th Percentile ) 7399.79
Mean Distribution
Standard Deviation 10.1252
95.00% Confidence Intervall ( 130857.80 - 130897.49 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1149
0.1 Scale Factor Error with Delta=300 43750
0.05 Scale Factor Error with Delta=300 175003
0.01 Scale Factor Error with Delta=300 4375099
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 130877.64
Distribution Chart

Damage

Sample Data
Count 49992
Mean 57050647.48
Distribution Chart

DTPS

Sample Data priest_90_pi_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_pi_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_pi_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 300.69
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 4.30 power_infusion,if=talent.power_infusion.enabled
D 4.46 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.09 shadow_word_death,if=active_enemies<=5
F 45.07 mind_blast,if=active_enemies<=6&cooldown_react
G 44.33 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 48.01 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 31.21 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.07 halo,if=talent.halo.enabled
M 13.39 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.52 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 6.21 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 56.01 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 17.01 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

CDFGGHHLTFTFHGGHMTFTFHIGHGTWLWWWWFMTHHTIFGTIFGTHHTFGMTLTIFGHHTQFIGTFIGHHMTFCIGTLQFIGWWWWWHFHIGMTQFTHTHFGIGTQFMLHTHFIGIBGTQFTHTHFIGIGMTQFTHLTHTIGWIGWWFTHTHFMTIGIGCFTHTHFLTIGTIGFMTHTHTFTIGIGFTHTHTFMTIGIGFLWWWWWHFHTIGTFTHGHFMTIGTFTLTHHIFGIGTQFMTBCTHHIFGIGTQFTEDEFHGHGLEEFMTPEEHFHIGIEDEFGTPEEFHHI9GDPEEIFGLTEDEFHHIGTEEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_pi_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.12
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_fdcl : 130660 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
130659.6 130659.6 20.48 / 0.02% 3874 / 3.0% 24.5 5157.1 5125.5 Mana 0.43% 43.3 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_fdcl Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 5.14 0.00 4.00 2.96 2.28 2.44 2.17
Normalized 1.00 0.00 0.78 0.58 0.44 0.47 0.42
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste > Crit > Mastery
Pawn string
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=5.14, SpellDamage=4.00, HitRating=2.96, CritRating=2.28, HasteRating=2.44, MasteryRating=2.17 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_fdcl": Intellect=5.14, SpellDamage=4.00, HitRating=0.00, CritRating=2.28, HasteRating=2.44, MasteryRating=2.17 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:348167|249165|193791|184253|110696|99223|83539|50093&chds=0,696335&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,4A79D3,9482C9&chm=t++348167++devouring_plague,9482C9,0,0,15|t++249165++halo,9482C9,1,0,15|t++193791++shadow_word_pain,9482C9,2,0,15|t++184253++vampiric_touch,9482C9,3,0,15|t++110696++shadow_word_death,9482C9,4,0,15|t++99223++mind_blast,9482C9,5,0,15|t++83539++mind_spike,4A79D3,6,0,15|t++50093++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_fdcl Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,12,10,9,7,6,5,5,5,4,3,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_spike|mind_blast|mind_flay|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|shadow_word_death|shadowfiend: melee|mind_flay_mastery|devouring_plague_mastery&chtt=priest_90_tof_fdcl Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:5.14,4.00,2.96,2.44,2.28,2.17|5.11,3.97,2.93,2.41,2.25,2.14|5.17,4.03,2.99,2.47,2.31,2.20&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++5.14++Int,FFFFFF,0,0,15,0.1,e|t++++4.00++SP,FFFFFF,0,1,15,0.1,e|t++++2.96++Hit,FFFFFF,0,2,15,0.1,e|t++++2.44++Haste,FFFFFF,0,3,15,0.1,e|t++++2.28++Crit,FFFFFF,0,4,15,0.1,e|t++++2.17++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,6.178&chtt=Scale Factors|priest_90_tof_fdcl%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:58654332122120011yxwutqqqpqpponlkjjiijkkkkjkkkkkjjjjjjkkkjhgggfgffeedeeeeeeeeefggggggfeeeeeeeefffggffeffffggghhggggggggghiiiiiiiihhggggggfffedccbbbbbbcddeeffffgghiihhhhhhggghhiiijjkkkjiiijjjjkkjiihggfffeeeghhhhhhggfffffffeeeeedccccccddefffffgggghhiiiiihhiiiiihhhhhhhgffeeeeeeddddccccccdddddfggggggggggggffffeeeedddddddeeefffgghhhiijkkkllllmmnnnnnnnoonnmmmnnnooooppooooooooppooooonnmmmmmmmmmnmmmmmmmmmmmmmmmmmmmmlllmmmmmmnnnnooopppqqqrrrssssttttuuuuuutttttttttttttttssssssrrrrrrrrrrrrqqqqrqrrrrrrrrssssstttuuuuuuuttttttttttsssrrrrqqqpppppppooooooonnnnn&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.5969,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=130660|max=218911&chxp=1,1,60,100&chtt=priest_90_tof_fdcl DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,0,0,16,24,40,64,112,104,192,360,608,856,1104,1448,1632,2008,2744,2800,3008,3264,3512,3440,3480,3336,3216,2264,2336,1808,1504,1104,920,760,648,368,304,168,120,88,72,64,16,16,24,8,8,8,0,8&chds=0,3512&chbh=5&chxt=x&chxl=0:|min=121197|avg=130660|max=141409&chxp=0,1,47,100&chtt=priest_90_tof_fdcl DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:30.9,17.7,13.3,12.8,12.2,5.1,4.0,2.9,0.5,0.4&chds=0,100&chdls=ffffff&chco=9482C9,4A79D3,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 139.0s|mind_spike 79.9s|shadow_word_pain 59.7s|mind_blast 57.8s|vampiric_touch 55.2s|devouring_plague 23.1s|shadow_word_death 17.9s|halo 13.1s|shadowfiend 2.4s|waiting 1.9s&chtt=priest_90_tof_fdcl Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_fdcl 130660
devouring_plague 6393 (17826) 4.9% (13.6%) 19.3 24.36sec 415798 348167 123017 254799 149094 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.30 19.30 0.00 0.00 1.1943 0.0000 2877677.33 2877677.33 0.00 348167.35 348167.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 15.48 80.21% 123016.70 107519 165536 123037.21 114850 134671 1904449 1904449 0.00
crit 3.82 19.79% 254798.75 221488 341004 250674.35 0 341004 973229 973229 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2737 2.1% 49.5 9.09sec 24897 0 20499 42483 24926 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.49 49.44 0.00 0.00 0.0000 0.0000 1232246.69 1232246.69 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.48 79.86% 20499.45 17856 27490 20503.53 19120 22052 809350 809350 0.00
crit 9.95 20.14% 42483.01 36784 56629 42493.27 36784 54087 422897 422897 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8697 6.7% 19.3 24.36sec 202858 0 0 0 0 0.0% 0.0% 0.0% 0.0% 158.1 20409 42270 24771 20.0% 0.0% 26.7%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.30 19.30 158.06 158.06 0.0000 0.7596 3915333.39 3915333.39 0.00 32609.30 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 19.30 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 126.5 80.05% 20409.35 17856 27490 20411.67 19551 21302 2582224 2582224 0.00
crit 31.5 19.95% 42270.44 36784 56629 42275.84 39301 45727 1333110 1333110 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7237) 0.0% (5.5%) 11.0 42.16sec 295486 249165 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 11.02 0.00 0.00 1.1859 0.0000 0.00 0.00 0.00 249164.75 249164.75
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.82 80.01% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.99% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7237 5.5% 11.0 42.16sec 295486 0 121703 252213 147741 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.02 22.04 0.00 0.00 0.0000 0.0000 3256583.29 3256583.29 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.64 80.05% 121702.99 109581 160794 121739.88 112123 131370 2147349 2147349 0.00
crit 4.40 19.95% 252213.23 225736 331235 250179.50 0 331235 1109234 1109234 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.16sec 0 0 0 0 0 23.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.02 115.32 0.00 0.00 0.0000 0.0000 0.00 23380202.64 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 88.62 76.85% 0.00 0 0 0.00 0 0 0 14393567 100.00
crit 26.70 23.15% 0.00 0 0 0.00 0 0 0 8986636 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_fdcl
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 12733 9.7% 48.7 9.29sec 117829 99223 97217 201509 117830 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.66 48.66 0.00 0.00 1.1875 0.0000 5733728.44 5733728.44 0.00 99223.49 99223.49
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 39.04 80.24% 97217.19 86183 133296 97239.19 93498 101679 3795756 3795756 0.00
crit 9.62 19.76% 201509.03 177536 274589 201551.33 177536 239378 1937973 1937973 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 11776 (15464) 9.0% (11.8%) 80.0 5.49sec 87073 50093 0 0 0 0.0% 0.0% 0.0% 0.0% 171.1 25530 52932 30987 19.9% 0.0% 28.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.96 79.96 171.10 171.10 1.7382 0.7367 5301813.06 5301813.06 0.00 50093.45 50093.45
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 79.96 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 137.0 80.09% 25529.84 22887 35236 25532.78 24602 26470 3498194 3498194 0.00
crit 34.1 19.91% 52932.01 47146 72586 52940.30 49574 57134 1803619 1803619 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 3688 2.8% 53.5 8.00sec 31011 0 25541 52943 31027 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.54 53.51 0.00 0.00 0.0000 0.0000 1660325.16 1660325.16 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 42.80 79.98% 25540.54 22887 35236 25545.09 24043 27627 1093071 1093071 0.00
crit 10.71 20.02% 52943.29 47146 72586 52944.80 47146 62954 567254 567254 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mind_spike 14808 11.3% 67.6 6.47sec 98667 83539 81384 168652 98667 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.62 67.62 0.00 0.00 1.1811 0.0000 6671438.35 6671438.35 0.00 83539.17 83539.17
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 54.22 80.20% 81384.09 72412 112341 81397.39 77232 85480 4413028 4413028 0.00
crit 13.39 19.80% 168652.06 149169 231423 168687.97 151477 192920 2258411 2258411 0.00
DPS Timeline Chart

Action details: mind_spike

Static Values
  • id:73510
  • school:shadowfrost
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&buff.surge_of_darkness.react=2
Spelldata
  • id:73510
  • name:Mind Spike
  • school:shadowfrost
  • tooltip:
  • description:Blasts the target for {$73510s1=12311 to 12383} Shadowfrost damage, but extinguishes your Shadow damage-over-time effects from the target in the process.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.304000
  • base_dd_min:1303.81
  • base_dd_max:1376.17
shadow_word_death 4392 3.4% 15.0 4.90sec 132267 110696 108829 225858 132269 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.97 14.97 0.00 0.00 1.1949 0.0000 1980023.33 1980023.33 0.00 110696.22 110696.22
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.97 79.97% 108829.04 83662 129665 108919.63 100236 119503 1302878 1302878 0.00
crit 3.00 20.03% 225857.52 172343 267111 217359.86 0 267111 677146 677146 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19562 (25702) 15.0% (19.7%) 50.5 8.92sec 228878 193791 0 0 0 0.0% 0.0% 0.0% 0.0% 444.8 15020 31063 19798 29.8% 0.0% 197.5%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.55 50.55 444.78 444.78 1.1811 1.9999 8805791.74 8805791.74 0.00 12188.45 193791.19
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 50.55 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 312.3 70.22% 15020.14 13422 20660 15021.44 14631 15449 4690996 4690996 0.00
crit 132.5 29.78% 31063.31 27649 42560 31065.95 29962 32340 4114796 4114796 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6141 4.7% 139.0 3.21sec 19879 0 15082 31208 19896 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 139.02 138.90 0.00 0.00 0.0000 0.0000 2763542.44 2763542.44 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 97.43 70.15% 15081.54 13422 20660 15083.82 14399 15809 1469461 1469461 0.00
crit 41.47 29.85% 31208.08 27649 42560 31214.89 29462 33598 1294082 1294082 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.80sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2247 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5766 4.4% 117.1 3.82sec 22170 0 18785 37784 22556 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.12 115.12 0.00 0.00 0.0000 0.0000 2596699.40 2596699.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.27 80.15% 18785.27 16669 25856 18787.37 18193 19451 1733338 1733338 0.00
crit 22.85 19.85% 37784.35 33338 51713 37791.98 34581 42046 863361 863361 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17167 (22563) 13.1% (17.3%) 46.1 9.72sec 220557 184253 0 0 0 0.0% 0.0% 0.0% 0.0% 377.7 16882 34996 20475 19.8% 0.0% 187.7%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.08 46.08 377.68 377.68 1.1970 2.2388 7732768.86 7732768.86 0.00 11283.19 184253.28
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 302.8 80.17% 16882.25 15001 23421 16883.57 16444 17545 5111498 5111498 0.00
crit 74.9 19.83% 34996.09 30902 48248 35000.62 32974 36882 2621271 2621271 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5396 4.1% 118.1 3.74sec 20585 0 16973 35168 20601 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.05 117.96 0.00 0.00 0.0000 0.0000 2430089.37 2430089.37 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.44 80.06% 16972.92 15001 23421 16976.15 16196 17814 1602871 1602871 0.00
crit 23.52 19.94% 35167.71 30902 48248 35175.87 32650 39133 827218 827218 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52462 / 4168
melee 52462 3.2% 33.3 11.80sec 55745 55041 48529 98065 55745 20.4% 0.0% 24.1% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.27 33.27 0.00 0.00 1.0128 0.0000 1854923.83 1854923.83 0.00 55040.62 55040.62
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.47 55.51% 48529.47 38145 58728 48546.62 43526 54594 896382 896382 0.00
crit 6.79 20.42% 98064.86 76291 117456 98008.00 0 117456 666220 666220 0.00
glance 8.01 24.07% 36493.21 28609 44046 36515.96 30327 44046 292321 292321 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1938 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.16%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.7sec 107.7sec 20.21% 20.21%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.21%

    Trigger Attempt Success

    • trigger_pct:15.33%
glyph_mind_spike 38.3 29.3 11.5sec 6.5sec 50.47% 75.30%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_glyph_mind_spike
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • glyph_mind_spike_1:31.93%
  • glyph_mind_spike_2:18.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:81292
  • name:Glyph of Mind Spike
  • tooltip:Reduces the cast time of your Mind Blast by {$s1=50}%.
  • description:When you deal damage with Mind Spike, the cast time of your next Mind Blast is reduced by {$33371s1=50}% lasting {$d=9 seconds}. This effect can stack up to {$u=2} times.
  • max_stacks:2
  • duration:9.00
  • cooldown:0.00
  • default_chance:101.00%
jade_serpent_potion 1.0 0.0 421.0sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.8 36.6sec 20.7sec 43.44% 43.68%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.44%

    Trigger Attempt Success

    • trigger_pct:1.62%
light_of_the_cosmos 9.8 0.0 48.0sec 48.0sec 42.61% 42.61%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.61%

    Trigger Attempt Success

    • trigger_pct:14.27%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.72% 49.45%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.72%

Trigger Attempt Success

  • trigger_pct:100.00%
surge_of_darkness 45.7 28.7 9.6sec 5.9sec 41.64% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_surge_of_darkness
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:0.00

Stack Uptimes

  • surge_of_darkness_1:32.32%
  • surge_of_darkness_2:9.32%

Trigger Attempt Success

  • trigger_pct:15.02%

Spelldata details

  • id:87160
  • name:Surge of Darkness
  • tooltip:Your next Mind Spike will not consume your damage-over-time effects, is instant cast, costs no mana, and deals 50% additional damage.
  • description:Periodic damage from your Vampiric Touch has a 15% chance to cause your next Mind Spike to not consume your damage-over-time effects, become instant cast, cost no mana, and deal 50% additional damage. Limit 2 charges.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
twist_of_fate 1.1 144.6 14.7sec 0.6sec 18.48% 100.00%

Buff details

  • buff initial source:priest_90_tof_fdcl
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.71%

Buff details

  • buff initial source:priest_90_tof_fdcl_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_fdcl
devouring_plague Shadow Orb 19.3 57.9 3.0 3.0 138598.6
halo Mana 11.0 446355.4 40500.0 40500.0 7.3
mind_blast Mana 48.7 437951.5 9000.0 9000.0 13.1
mind_flay Mana 80.0 239872.3 3000.0 3000.0 29.0
shadow_word_death Mana 15.0 116769.1 7800.0 7800.3 17.0
shadow_word_pain Mana 50.5 667242.0 13200.0 13200.1 17.3
vampiric_touch Mana 46.1 414702.7 9000.0 9000.0 24.5
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.28 132263.04 (5.73%) 3974.84 167212.32 55.84%
Shadow Orbs from Mind Blast Shadow Orb 48.66 48.66 (86.54%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.57 7.57 (13.46%) 1.00 0.00 0.00%
Devouring Plague Health Health 207.50 0.00 (-nan%) 0.00 2881420.47 100.00%
Vampiric Touch Mana Mana 495.63 1786430.83 (77.38%) 3604.33 833497.97 31.81%
mp5_regen Mana 1801.21 389987.38 (16.89%) 216.51 150375.65 27.83%
Resource RPS-Gain RPS-Loss
Mana 5125.53 5157.08
Shadow Orb 0.12 0.13
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 285785.89 205200.00 300000.00
Shadow Orb 1.33 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 28.0%
shadowfiend-Mana Cap 28.0%
lightwell-Mana Cap 28.0%

Procs

Count Interval
Shadowy Recall Extra Tick 359.8 1.2sec
Shadowy Apparition Procced 117.1 3.8sec
FDCL Mind Spike proc 74.4 5.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_tof_fdcl Damage Per Second
Count 49992
Mean 130659.57
Minimum 121197.17
Maximum 141409.10
Spread ( max - min ) 20211.93
Range [ ( max - min ) / 2 * 100% ] 7.73%
Standard Deviation 2336.1904
5th Percentile 126900.66
95th Percentile 134649.11
( 95th Percentile - 5th Percentile ) 7748.45
Mean Distribution
Standard Deviation 10.4486
95.00% Confidence Intervall ( 130639.09 - 130680.04 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1228
0.1 Scale Factor Error with Delta=300 46590
0.05 Scale Factor Error with Delta=300 186363
0.01 Scale Factor Error with Delta=300 4659079
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 130659.57
Distribution Chart

Damage

Sample Data
Count 49992
Mean 56958060.84
Distribution Chart

DTPS

Sample Data priest_90_tof_fdcl Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_fdcl Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_fdcl Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 325.24
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.27 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.97 shadow_word_death,if=active_enemies<=5
F 48.92 mind_blast,if=active_enemies<=6&cooldown_react
G 40.86 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 47.42 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 17.72 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.02 halo,if=talent.halo.enabled
M 15.04 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.30 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 9.54 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 49.90 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.59 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 9.68 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFRTFMGGHHJRQFTQFTRRHHTGFGLMWWTFTHHTFGRTGRFHHMTFTRGLTRFGHHTRQFMTRTRGFTGHHRFTRTRQFLMGRRRFGHHJRTFTGFMHGHRRTFTLTFGHHJGRBFMTJRRQFRTGHHQFGTFMLJRHHGFRWWWHRQFTFHMRGTHGFRTHFLTRGHFGMJRRHQFTHFGTGRHFMTLHQFRWGRWWWFHTFHMTGTFGHTHFLRRTGHFGMTHFTRTBQFGHRGRRHFMJRLREEFHGRTGEDEFHJRTPEEFHJGMJEEFGHRLTEDEFHR9GRREEFGHMRRPEEFHTGPEDEF

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_fdcl"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..0.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_mb : 128250 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
128249.9 128249.9 17.13 / 0.01% 3189 / 2.5% 21.1 5582.5 5550.4 Mana 0.38% 36.6 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_mb Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.88 0.00 3.87 2.73 2.20 2.08 2.08
Normalized 1.00 0.00 0.79 0.56 0.45 0.43 0.43
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.02 0.00 0.02 0.03 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Crit > Mastery = Haste
Pawn string
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.88, SpellDamage=3.87, HitRating=2.73, CritRating=2.20, HasteRating=2.08, MasteryRating=2.08 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_mb": Intellect=4.88, SpellDamage=3.87, HitRating=0.00, CritRating=2.20, HasteRating=2.08, MasteryRating=2.08 )

Charts

http://4.chart.apis.google.com/chart?chs=550x240&cht=bhg&chf=bg,s,333333&chd=t:353679|248978|184769|165949|110989|98904|50995&chds=0,707358&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++353679++devouring_plague,9482C9,0,0,15|t++248978++halo,9482C9,1,0,15|t++184769++vampiric_touch,9482C9,2,0,15|t++165949++shadow_word_pain,9482C9,3,0,15|t++110989++shadow_word_death,9482C9,4,0,15|t++98904++mind_blast,9482C9,5,0,15|t++50995++mind_flay,9482C9,6,0,15&chtt=priest_90_tof_mb Damage Per Execute Time&&chts=dddddd,18 http://5.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:17,15,14,10,9,7,6,5,5,5,5,5,4,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|mind_flay|vampiric_touch|mind_blast|mindbender: melee|devouring_plague_tick|halo_damage|shadow_word_pain_mastery|devouring_plague|shadowy_apparition|mind_flay_mastery|vampiric_touch_mastery|shadow_word_death|devouring_plague_mastery&chtt=priest_90_tof_mb Damage Sources&chts=dddddd,18
http://7.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.88,3.87,2.73,2.20,2.08,2.08|4.86,3.85,2.71,2.17,2.06,2.05|4.91,3.90,2.76,2.22,2.11,2.10&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.88++Int,FFFFFF,0,0,15,0.1,e|t++++3.87++SP,FFFFFF,0,1,15,0.1,e|t++++2.73++Hit,FFFFFF,0,2,15,0.1,e|t++++2.20++Crit,FFFFFF,0,3,15,0.1,e|t++++2.08++Mastery,FFFFFF,0,4,15,0.1,e|t++++2.08++Haste,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.868&chtt=Scale Factors|priest_90_tof_mb%20Damage%20Per%20Second&chts=dddddd,18 http://8.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:366786655354644451zzyxvusqqpppplljjihjjjhgfggggghgggghijkkjjklmnnmllkjiiijiiiijkjjijhhggffgggggffedbaabcddefgghhiijjkllnpqqoonnmlljjiihgffffeccddeeeffeffffffggffgggfeeeddeeffghiijjjjihijjjjjjjiiiiiihiiijkkkjiiihhgggffeddcbbaZZYYZZaabcccefghijlmmopqqqqqqqqpponmllkjihgfeeeeeeddddddddddcccccdddccccddeffghiijkklkkkkkllllmlkjiihgghhhiklmmmnnnnnooooopponnmkkjiijjkllmmnooppqqrrrrssssrrqppoooonnnnnnnnnnmmmmmmmmmmmmmmmmlllmnoopqrstuvwxxxxyyzz000zzyyyxxwwvvvvvvvvvuuuuuuuuuutttsssrrrrrssttuuvvwwxyyzzz0011110000zzyxxwvvuuutttttttsssrrrqqqqqqqqqprqqqqqqqqqrr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6203,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=128250|max=206770&chxp=1,1,62,100&chtt=priest_90_tof_mb DPS Timeline&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:8,0,8,8,32,64,88,64,184,256,328,480,704,952,1312,1592,1608,1928,2424,2584,3128,3096,3000,3224,3096,2848,2472,2624,2192,1696,1440,1424,1288,968,640,576,472,352,240,184,56,112,88,56,24,16,32,16,0,8&chds=0,3224&chbh=5&chxt=x&chxl=0:|min=121151|avg=128250|max=136215&chxp=0,1,47,100&chtt=priest_90_tof_mb DPS Distribution&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:46.5,15.8,12.0,11.6,4.7,4.0,2.9,1.8,0.4&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 209.4s|shadow_word_pain 71.1s|vampiric_touch 54.2s|mind_blast 52.4s|devouring_plague 21.1s|shadow_word_death 17.9s|halo 13.2s|mindbender 8.3s|waiting 1.7s&chtt=priest_90_tof_mb Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_mb 128250
devouring_plague 5947 (16585) 4.6% (12.9%) 17.7 26.86sec 421657 353679 124437 257673 151204 20.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.71 17.71 0.00 0.00 1.1923 0.0000 2678179.44 2678179.44 0.00 353679.12 353679.12
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.15 79.91% 124437.11 107519 165536 124463.55 114957 134982 1761334 1761334 0.00
crit 3.56 20.09% 257673.26 221488 341004 252041.23 0 341004 916846 916846 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2540 2.0% 45.5 9.90sec 25120 0 20713 42939 25152 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.53 45.47 0.00 0.00 0.0000 0.0000 1143616.40 1143616.40 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.39 80.03% 20712.94 17856 27490 20719.36 19392 22540 753672 753672 0.00
crit 9.08 19.97% 42939.16 36784 56629 42963.24 36784 56629 389944 389944 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8098 6.3% 17.7 26.86sec 205890 0 0 0 0 0.0% 0.0% 0.0% 0.0% 145.4 20654 42771 25076 20.0% 0.0% 24.4%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.71 17.71 145.43 145.43 0.0000 0.7568 3646846.22 3646846.22 0.00 33133.57 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.71 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.3 80.00% 20653.82 17856 27490 20659.38 19568 21821 2403032 2403032 0.00
crit 29.1 20.00% 42770.55 36784 56629 42778.41 39302 47530 1243814 1243814 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7281) 0.0% (5.7%) 11.1 41.84sec 295294 248978 0 0 0 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 11.09 0.00 0.00 1.1861 0.0000 0.00 0.00 0.00 248978.35 248978.35
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.89 80.15% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.85% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7281 5.7% 11.1 41.84sec 295294 0 121620 251966 147645 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.09 22.18 0.00 0.00 0.0000 0.0000 3275310.21 3275310.21 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.75 80.03% 121620.15 109581 160794 121672.42 113689 129741 2159226 2159226 0.00
crit 4.43 19.97% 251965.59 225736 331235 249708.23 0 331235 1116084 1116084 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.1 41.84sec 0 0 0 0 0 23.1% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.09 116.41 0.00 0.00 0.0000 0.0000 0.00 23577996.42 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.47 76.85% 0.00 0 0 0.00 0 0 0 14519871 100.00
crit 26.95 23.15% 0.00 0 0 0.00 0 0 0 9058125 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_mb
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11506 9.0% 43.8 10.35sec 118235 98904 97373 201980 118234 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.85 43.85 0.00 0.00 1.1955 0.0000 5184275.84 5184275.84 0.00 98904.47 98904.47
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.10 80.06% 97373.07 86183 133296 97390.19 93150 101190 3418072 3418072 0.00
crit 8.74 19.94% 201980.00 177536 274589 202025.06 0 241934 1766203 1766203 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 18058 (23700) 14.1% (18.5%) 116.8 3.78sec 91387 50995 0 0 0 0.0% 0.0% 0.0% 0.0% 262.0 25595 53064 31056 19.9% 0.0% 43.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.83 116.83 261.96 261.96 1.7921 0.7406 8135306.67 8135306.67 0.00 50994.56 50994.56
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.83 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 209.9 80.12% 25595.37 22887 35236 25598.72 24989 26302 5372112 5372112 0.00
crit 52.1 19.88% 53063.78 47146 72586 53074.59 50588 56038 2763195 2763195 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 5641 4.4% 81.9 5.33sec 31025 0 25583 53064 31044 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.91 81.86 0.00 0.00 0.0000 0.0000 2541220.71 2541220.71 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 65.59 80.13% 25582.88 22887 35236 25587.56 24522 26856 1677956 1677956 0.00
crit 16.27 19.87% 53064.48 47146 72586 53075.33 48279 59174 863264 863264 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
mindbender 0 0.0% 6.9 60.79sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.91 6.91 0.00 0.00 1.1990 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 6.91 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: mindbender

Static Values
  • id:123040
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:60.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:123040
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Creates a Mindbender to attack the target. Caster receives ${{$m2=92}/{$m3=63}}.2% mana when the Mindbender attacks. Lasts {$d=15 seconds}. Replaces Shadowfiend.
shadow_word_death 4406 3.4% 15.0 4.90sec 132620 110989 108955 226135 132619 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.97 14.97 0.00 0.00 1.1949 0.0000 1985705.90 1985705.90 0.00 110989.09 110989.09
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.95 79.80% 108954.82 83662 129665 109041.20 99961 118902 1301918 1301918 0.00
crit 3.02 20.20% 226135.41 172343 267111 217503.51 0 267111 683788 683788 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_pain 19972 (26238) 15.6% (20.4%) 60.2 7.47sec 195996 165949 0 0 0 0.0% 0.0% 0.0% 0.0% 453.9 15008 31039 19798 29.9% 0.0% 197.6%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.24 60.24 453.94 453.94 1.1811 1.9605 8986990.19 8986990.19 0.00 12284.64 165948.86
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.24 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 318.3 70.12% 15008.07 13422 20660 15008.99 14669 15479 4777149 4777149 0.00
crit 135.6 29.88% 31039.07 27649 42560 31041.40 29821 32177 4209841 4209841 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 6266 4.9% 141.9 3.14sec 19868 0 15070 31172 19884 29.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.92 141.80 0.00 0.00 0.0000 0.0000 2819607.32 2819607.32 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 99.41 70.10% 15069.53 13422 20660 15071.36 14438 15723 1497985 1497985 0.00
crit 42.40 29.90% 31171.87 27649 42560 31175.58 28690 33326 1321622 1321622 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowy_apparition 5809 4.5% 118.0 3.79sec 22175 0 18786 37769 22561 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 117.97 115.95 0.00 0.00 0.0000 0.0000 2615937.09 2615937.09 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.89 80.11% 18786.33 16669 25856 18788.22 18159 19354 1745006 1745006 0.00
crit 23.06 19.89% 37768.76 33338 51713 37769.55 34770 41833 870931 870931 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 16903 (22216) 13.2% (17.3%) 45.4 9.87sec 220653 184769 0 0 0 0.0% 0.0% 0.0% 0.0% 371.6 16899 35029 20491 19.8% 0.0% 185.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.36 45.36 371.64 371.64 1.1942 2.2419 7615198.68 7615198.68 0.00 11279.00 184769.26
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 45.36 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 298.0 80.19% 16898.72 15001 23421 16900.11 16463 17439 5036006 5036006 0.00
crit 73.6 19.81% 35028.67 30902 48248 35030.42 33339 36829 2579193 2579193 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5313 4.1% 116.2 3.80sec 20594 0 16986 35207 20612 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.22 116.11 0.00 0.00 0.0000 0.0000 2393382.73 2393382.73 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 93.00 80.10% 16985.71 15001 23421 16988.59 16261 17751 1579753 1579753 0.00
crit 23.11 19.90% 35207.23 30902 48248 35214.65 32357 38795 813630 813630 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - mindbender 40475 / 10510
melee 40475 8.2% 107.5 4.09sec 43982 41340 38420 77435 43982 20.1% 0.0% 24.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 107.46 107.46 0.00 0.00 1.0639 0.0000 4726282.72 4726282.72 0.00 41339.68 41339.68
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.05 55.88% 38420.41 30516 46982 38428.95 36521 40844 2307004 2307004 0.00
crit 21.63 20.13% 77434.86 61032 93964 77449.96 70856 85237 1674821 1674821 0.00
glance 25.78 23.99% 28872.49 22887 35237 28877.87 26519 31118 744458 744458 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:0.800000
  • base_dd_min:1678.93
  • base_dd_max:1678.93
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 23.4 19.20sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.42 23.42 0.00 0.00 1.1907 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 23.42 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.26%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.23% 20.23%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.23%

    Trigger Attempt Success

    • trigger_pct:15.53%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.4 9.0 36.4sec 20.5sec 43.75% 44.02%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.75%

    Trigger Attempt Success

    • trigger_pct:1.62%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.73% 42.73%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.73%

    Trigger Attempt Success

    • trigger_pct:14.25%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.73% 49.46%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.73%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.1 145.3 14.5sec 0.6sec 18.49% 100.00%

Buff details

  • buff initial source:priest_90_tof_mb
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
mindbender-shadowcrawl 23.4 0.0 19.2sec 19.2sec 85.38% 84.12%

Buff details

  • buff initial source:priest_90_tof_mb_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:85.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_mb
devouring_plague Shadow Orb 17.7 53.1 3.0 3.0 140552.0
halo Mana 11.1 449213.0 40500.0 40499.9 7.3
mind_blast Mana 43.8 394626.2 9000.0 9000.0 13.1
mind_flay Mana 116.8 350484.0 3000.0 3000.0 30.5
shadow_word_death Mana 15.0 116792.8 7800.0 7800.3 17.0
shadow_word_pain Mana 60.2 795149.0 13200.0 13199.9 14.8
vampiric_touch Mana 45.4 408231.4 9000.0 9000.0 24.5
Resource Gains Type Count Total Average Overflow
mindbender Mana 107.46 289747.76 (11.59%) 2696.33 181029.38 38.45%
Shadow Orbs from Mind Blast Shadow Orb 43.85 43.85 (85.28%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.57 7.57 (14.72%) 1.00 0.00 0.00%
Devouring Plague Health Health 190.90 0.00 (-nan%) 0.00 2650944.96 100.00%
Vampiric Touch Mana Mana 487.76 1812311.84 (72.49%) 3715.59 765891.04 29.71%
mp5_regen Mana 1801.21 398010.67 (15.92%) 220.97 142352.36 26.34%
Resource RPS-Gain RPS-Loss
Mana 5550.43 5582.46
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 285571.78 230100.00 300000.00
Shadow Orb 1.28 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 26.4%
shadowfiend-Mana Cap 26.4%
lightwell-Mana Cap 26.4%

Procs

Count Interval
Shadowy Recall Extra Tick 385.2 1.2sec
Shadowy Apparition Procced 118.0 3.8sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_tof_mb Damage Per Second
Count 49992
Mean 128249.87
Minimum 121150.69
Maximum 136215.34
Spread ( max - min ) 15064.65
Range [ ( max - min ) / 2 * 100% ] 5.87%
Standard Deviation 1954.4089
5th Percentile 125174.74
95th Percentile 131552.93
( 95th Percentile - 5th Percentile ) 6378.19
Mean Distribution
Standard Deviation 8.7411
95.00% Confidence Intervall ( 128232.74 - 128267.00 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 892
0.1 Scale Factor Error with Delta=300 32607
0.05 Scale Factor Error with Delta=300 130429
0.01 Scale Factor Error with Delta=300 3260727
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 128249.87
Distribution Chart

Damage

Sample Data
Count 49992
Mean 53021577.39
Distribution Chart

DTPS

Sample Data priest_90_tof_mb Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_mb Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_mb Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 274.61
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 6.91 mindbender,if=talent.mindbender.enabled
B 0.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.12 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 14.97 shadow_word_death,if=active_enemies<=5
F 44.74 mind_blast,if=active_enemies<=6&cooldown_react
G 39.89 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 46.50 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 0.00 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.09 halo,if=talent.halo.enabled
M 13.59 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.68 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 8.72 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 61.03 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 20.35 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTFTQFMGGHHTFTFTGGHHWWLWWWFHMTHAFGTGFHTHTFGMTLTHFGTHTFTGTHQFGMHTAFTGTHLWWWWWFHHTQFGMTFGHHTQFTGLTFGHHMTAQFTGTFHHGTQFMTGFHLWWWWHFHTFGMTHGHFATFGTLHTHFGMTFTGHTHFGTQFMTGHHLWWWAWFHTHFGTGFHMTHTFTGLTFGHTHTFMGTAHFGTHTFTEDEGFHGHLEETFMTEEGFHHGTEDEFTEAEF9GHGHDEEFLTPEDEFGHHTG

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_mb"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..1.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

priest_90_tof_swi : 130777 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR RPS Out RPS In Primary Resource Waiting APM Active Skill
130776.8 130776.8 20.66 / 0.02% 3857 / 2.9% 21.0 6022.4 5977.4 Mana 0.29% 38.9 100.0% 100%
Origin http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html
Talents http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
Glyphs
  • dark_binding
  • mind_spike
  • inner_sanctum
Professions
  • engineering: 600
  • blacksmithing: 600
Scale Factors for priest_90_tof_swi Damage Per Second
Int Spi SP Hit Crit Haste Mastery
Scale Factors 4.89 0.00 3.92 3.04 2.19 2.20 1.96
Normalized 1.00 0.00 0.80 0.62 0.45 0.45 0.40
Scale Deltas 1000 1000 1000 -1000 1000 1000 1000
Error 0.03 0.00 0.03 0.03 0.03 0.03 0.03
Gear Ranking
Optimizers
Ranking
  • Int > SP > Hit > Haste = Crit > Mastery
Pawn string
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.89, SpellDamage=3.92, HitRating=3.04, CritRating=2.19, HasteRating=2.20, MasteryRating=1.96 )
Zero hit/exp
  • ( Pawn: v1: "priest_90_tof_swi": Intellect=4.89, SpellDamage=3.92, HitRating=0.00, CritRating=2.19, HasteRating=2.20, MasteryRating=1.96 )

Charts

http://9.chart.apis.google.com/chart?chs=550x270&cht=bhg&chf=bg,s,333333&chd=t:349789|248840|186392|169275|153069|110971|98648|51252&chds=0,699578&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chm=t++349789++devouring_plague,9482C9,0,0,15|t++248840++halo,9482C9,1,0,15|t++186392++vampiric_touch,9482C9,2,0,15|t++169275++shadow_word_insanity,9482C9,3,0,15|t++153069++shadow_word_pain,9482C9,4,0,15|t++110971++shadow_word_death,9482C9,5,0,15|t++98648++mind_blast,9482C9,6,0,15|t++51252++mind_flay,9482C9,7,0,15&chtt=priest_90_tof_swi Damage Per Execute Time&&chts=dddddd,18 http://0.chart.apis.google.com/chart?chs=550x275&cht=p&chf=bg,s,333333&chd=t:15,14,12,11,9,6,6,5,5,4,4,4,3,3,2&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9&chl=shadow_word_pain|vampiric_touch|mind_flay|shadow_word_insanity|mind_blast|devouring_plague_tick|halo_damage|devouring_plague|shadow_word_pain_mastery|shadowy_apparition|vampiric_touch_mastery|mind_flay_mastery|shadow_word_death|shadowfiend: melee|devouring_plague_mastery&chtt=priest_90_tof_swi Damage Sources&chts=dddddd,18
http://2.chart.apis.google.com/chart?chs=525x240&cht=bhg&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chd=t1:4.89,3.92,3.04,2.20,2.19,1.96|4.86,3.89,3.01,2.17,2.17,1.93|4.92,3.95,3.07,2.23,2.22,1.99&chco=FFFFFF&chm=E,FF0000,1:0,,1:20|t++++4.89++Int,FFFFFF,0,0,15,0.1,e|t++++3.92++SP,FFFFFF,0,1,15,0.1,e|t++++3.04++Hit,FFFFFF,0,2,15,0.1,e|t++++2.20++Haste,FFFFFF,0,3,15,0.1,e|t++++2.19++Crit,FFFFFF,0,4,15,0.1,e|t++++1.96++Mastery,FFFFFF,0,5,15,0.1,e&chds=-0.010,5.875&chtt=Scale Factors|priest_90_tof_swi%20Damage%20Per%20Second&chts=dddddd,18 http://3.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:5765543324322zyzzxwvvussrqqppqnnmmmllmlkjhfghhiijjghhiiijihiiiijiggfeddcdedeefhhhhiiiihhhhhhihhhhhfeddeeffghhijkkjklkkkllmmkjjihggfedccbabddddcddeeefffgggggghhgggggffeeeeeefghijklmmmmlkkkkkkklljiiiiihhhhiiijjjjjihhhhhgfeddccbbbbcccccdeeffggghiijjjkjjjjjjjjjiihhhhhhhhggggggggffffffffeeeedddeeeeeeeeeeffgggffffggffffggghhhgggggghijjklmmmmnoooppppppqpponnmmmnnoopppppqqqqqqqqqqpppoonnmmmmnnnoooooooppoooonnnnnnnmmmmmmmmmmmnnoopqqqrrrrrsstttuuuuvvvvvvvvvvvvvvuuuttttttttssssssssrrrrrrrrrrrrrrrrrrsssssttttuuuuuuuuuuuuuuuuuuutttttsssrrrqqrrrsrqrrrqqqqqqqr&chco=FDD017&chds=0,60&chm=h,FF0000,0,0.6093,0.4&chxt=x,y&chxl=0:|0|sec=551|1:|0|avg=130777|max=214636&chxp=1,1,61,100&chtt=priest_90_tof_swi DPS Timeline&chts=dddddd,18 http://6.chart.apis.google.com/chart?chs=525x185&cht=bvs&chf=bg,s,333333&chg=100,100&chxs=0,ffffff|1,ffffff&chd=t:16,16,8,24,48,56,40,240,296,344,456,640,912,1216,1392,1704,1864,2000,2328,2776,2896,3016,2720,2864,2880,2616,2640,2048,2200,1792,1488,1432,1192,848,776,528,512,288,248,208,192,72,24,40,24,16,32,8,8,8&chds=0,3016&chbh=5&chxt=x&chxl=0:|min=122733|avg=130777|max=140091&chxp=0,1,46,100&chtt=priest_90_tof_swi DPS Distribution&chts=dddddd,18 http://1.chart.apis.google.com/chart?chs=525x275&cht=p&chf=bg,s,333333&chd=t:39.1,16.0,12.1,11.7,8.4,4.7,4.0,2.9,0.5,0.3&chds=0,100&chdls=ffffff&chco=9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,9482C9,ffffff&chl=mind_flay 176.2s|shadow_word_pain 72.0s|vampiric_touch 54.7s|mind_blast 52.8s|shadow_word_insanity 37.7s|devouring_plague 21.2s|shadow_word_death 17.9s|halo 13.1s|shadowfiend 2.4s|waiting 1.3s&chtt=priest_90_tof_swi Spent Time&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
priest_90_tof_swi 130777
devouring_plague 5923 (16462) 4.5% (12.6%) 17.8 26.43sec 416950 349789 123650 256120 150030 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.78 17.78 0.00 0.00 1.1920 0.0000 2668051.81 2668051.81 0.00 349788.77 349788.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 14.24 80.09% 123650.21 107519 165536 123665.65 115062 134181 1761033 1761033 0.00
crit 3.54 19.91% 256119.82 221488 341004 250191.84 0 341004 907018 907018 0.00
DPS Timeline Chart

Action details: devouring_plague

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Direct Damage
  • may_crit:true
  • direct_power_mod:0.783000
  • base_dd_min:1642.20
  • base_dd_max:1642.20
devouring_plague_mastery 2519 1.9% 45.4 9.92sec 24995 0 20624 42742 25026 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: devouring_plague_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.39 45.33 0.00 0.00 0.0000 0.0000 1134440.60 1134440.60 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 36.31 80.10% 20624.08 17856 27490 20631.08 19323 22585 748832 748832 0.00
crit 9.02 19.90% 42741.87 36784 56629 42749.43 0 55358 385609 385609 0.00
DPS Timeline Chart

Action details: devouring_plague_mastery

Static Values
  • id:124467
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124467
  • name:Devouring Plague
  • school:shadow
  • tooltip:$@spellaura2944
  • description:{$@spelldesc2944=Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.130000
  • base_dd_min:273.87
  • base_dd_max:273.87
devouring_plague_tick 8020 6.1% 17.8 26.43sec 203128 0 0 0 0 0.0% 0.0% 0.0% 0.0% 145.2 20496 42450 24871 19.9% 0.0% 24.6%

Stats details: devouring_plague_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.78 17.78 145.24 145.24 0.0000 0.7620 3612329.85 3612329.85 0.00 32637.31 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.78 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 116.3 80.07% 20495.89 17856 27490 20499.03 19477 21531 2383641 2383641 0.00
crit 28.9 19.93% 42449.81 36784 56629 42455.57 38947 47279 1228688 1228688 0.00
DPS Timeline Chart

Action details: devouring_plague_tick

Static Values
  • id:2944
  • school:shadow
  • resource:shadow_orb
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:1.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:2944
  • name:Devouring Plague
  • school:shadow
  • tooltip:Causes $w2 damage every {$t1=0} seconds, healing the caster.
  • description:Consumes all of the caster's Shadow Orbs to deal {$s4=8252} Shadow damage and an additional {$s5=1371} Shadow damage every {$t2=1} sec for {$d=6 seconds}. Also heals the caster for ${{$m3=100}/100}% of their maximum health when it deals periodic damage. Damage and healing increased based on the number of Shadow Orbs consumed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.130000
  • base_td:273.87
  • num_ticks:6
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
halo 0 (7230) 0.0% (5.5%) 11.0 42.27sec 295460 248840 0 0 0 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 11.01 0.00 0.00 1.1874 0.0000 0.00 0.00 0.00 248840.05 248840.05
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 8.81 80.03% 0.00 0 0 0.00 0 0 0 0 0.00
crit 2.20 19.97% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: halo

Static Values
  • id:120644
  • school:shadow
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:40500.0
  • cooldown:40.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.halo.enabled
Spelldata
  • id:120644
  • name:Halo
  • school:shadow
  • tooltip:
  • description:Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.
halo_damage 7230 5.5% 11.0 42.27sec 295460 0 121637 251901 147729 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.01 22.02 0.00 0.00 0.0000 0.0000 3253085.97 3253085.97 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 17.61 79.97% 121637.06 109581 160794 121670.83 112889 131397 2141970 2141970 0.00
crit 4.41 20.03% 251901.20 225736 331235 250880.96 0 331235 1111116 1111116 0.00
DPS Timeline Chart

Action details: halo_damage

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:1.950000
  • base_dd_min:15162.27
  • base_dd_max:25270.45
halo_heal 0 0.0% 11.0 42.27sec 0 0 0 0 0 23.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: halo_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 11.01 116.65 0.00 0.00 0.0000 0.0000 0.00 23597402.11 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.76 76.95% 0.00 0 0 0.00 0 0 0 14561122 100.00
crit 26.89 23.05% 0.00 0 0 0.00 0 0 0 9036280 100.00
HPS Timeline Chart

Action details: halo_heal

Static Values
  • id:120696
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:priest_90_tof_swi
  • harmful:true
  • if_expr:
Spelldata
  • id:120696
  • name:Halo
  • school:shadow
  • tooltip:
  • description:{$@spelldesc120644=Creates a ring of Shadow energy around you that quickly expands and grows in power, up to 30 yds away. Deals up to {$120696s2=31622 to 41730} Shadow damage to enemies, and up to {$120696s1=52704 to 69551} healing to allies, with the greatest effect at 25 yds.}
Direct Damage
  • may_crit:true
  • direct_power_mod:3.250000
  • base_dd_min:25270.45
  • base_dd_max:42117.42
mind_blast 11554 8.8% 44.1 10.29sec 118080 98648 97370 201785 118081 19.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.08 44.08 0.00 0.00 1.1970 0.0000 5205451.60 5205451.60 0.00 98647.89 98647.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 35.34 80.17% 97370.02 86183 133296 97388.19 93103 102198 3441059 3441059 0.00
crit 8.74 19.83% 201785.14 177536 274589 201796.12 0 240056 1764393 1764393 0.00
DPS Timeline Chart

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:8.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=6&cooldown_react
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target for {$s1=18885 to 19038} Shadow damage and generates {$s2=1} Shadow $LOrb:Orbs;.
Direct Damage
  • may_crit:true
  • direct_power_mod:1.917000
  • base_dd_min:2703.23
  • base_dd_max:2856.11
mind_flay 15272 (20054) 11.7% (15.3%) 98.8 4.48sec 91414 51252 0 0 0 0.0% 0.0% 0.0% 0.0% 220.6 25657 53201 31169 20.0% 0.0% 36.1%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.79 98.79 220.63 220.63 1.7836 0.7373 6876987.57 6876987.57 0.00 51251.69 51251.69
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 98.79 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 176.5 79.99% 25657.41 22887 35236 25660.36 24958 26472 4528033 4528033 0.00
crit 44.2 20.01% 53200.79 47146 72586 53210.86 50246 56365 2348955 2348955 0.00
DPS Timeline Chart

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:3000.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every {$t1=1} sec.
  • description:Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.500000
  • base_td:1049.33
  • num_ticks:3
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
mind_flay_mastery 4782 3.7% 69.2 6.31sec 31150 0 25662 53205 31171 20.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: mind_flay_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.15 69.11 0.00 0.00 0.0000 0.0000 2154071.88 2154071.88 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 55.28 80.00% 25661.54 22887 35236 25664.98 24147 27102 1418666 1418666 0.00
crit 13.82 20.00% 53204.83 47146 72586 53217.84 47843 61561 735405 735405 0.00
DPS Timeline Chart

Action details: mind_flay_mastery

Static Values
  • id:124468
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124468
  • name:Mind Flay
  • school:shadow
  • tooltip:$@spellaura15407
  • description:{$@spelldesc15407=Assault the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}{$?s120585=false}[. Each time Mind Flay deals damage the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.500000
  • base_dd_min:1049.33
  • base_dd_max:1049.33
shadow_word_death 4418 3.4% 15.0 4.89sec 132572 110971 108963 225893 132568 20.2% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.03 15.03 0.00 0.00 1.1947 0.0000 1991927.48 1991927.48 0.00 110970.89 110970.89
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 11.99 79.81% 108963.38 83662 129665 109055.31 99964 119502 1306651 1306651 0.00
crit 3.03 20.19% 225893.47 172343 267111 218368.70 0 267111 685276 685276 0.00
DPS Timeline Chart

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7800.0
  • cooldown:8.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:active_enemies<=5
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s2=18018} Shadow damage to the target{$?s15407=true}[ and grants a Shadow Orb][]. Only usable on enemies that have less than 20% health.{$?s15407=true}[ If the target does not die, the cooldown is reset, but this additional Shadow Word: Death does not grant a Shadow Orb. This effect has a {$95652d=6 seconds} cooldown.][]
Direct Damage
  • may_crit:true
  • direct_power_mod:1.876000
  • base_dd_min:2182.60
  • base_dd_max:2182.60
shadow_word_insanity 14149 10.8% 31.8 13.28sec 200674 169275 165471 342698 200672 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 31.80 31.80 0.00 0.00 1.1855 0.0000 6382173.36 6382173.36 0.00 169274.95 169274.95
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 25.49 80.14% 165470.65 148247 229957 165468.38 156173 178481 4217241 4217241 0.00
crit 6.32 19.86% 342697.59 305389 473711 342023.32 0 451980 2164933 2164933 0.00
DPS Timeline Chart

Action details: shadow_word_insanity

Static Values
  • id:129249
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:7500.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:talent.power_word_solace.enabled&active_enemies<=5
Spelldata
  • id:129249
  • name:Shadow Word: Insanity
  • school:shadow
  • tooltip:
  • description:Consumes your Shadow Word: Pain to deal {$s1=27440 to 27604} Shadow damage to the target. Only usable while Shadow Word: Pain has less than ${$589T*2/1000}.3 sec remaining.
Direct Damage
  • may_crit:true
  • direct_power_mod:2.900000
  • base_dd_min:2960.89
  • base_dd_max:3125.21
shadow_word_pain 18641 (24481) 14.2% (18.7%) 60.8 7.38sec 181035 153069 0 0 0 0.0% 0.0% 0.0% 0.0% 423.0 15034 31088 19829 29.9% 0.0% 181.4%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.84 60.84 423.01 423.01 1.1827 1.9314 8387755.65 8387755.65 0.00 12391.09 153068.83
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 60.84 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 296.7 70.14% 15034.27 13422 20660 15035.67 14619 15450 4460345 4460345 0.00
crit 126.3 29.86% 31088.41 27649 42560 31091.34 30009 32365 3927410 3927410 0.00
DPS Timeline Chart

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:13200.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:miss_react&(!ticking|ticks_remain<=1)
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$w1 Shadow damage every {$t1=3} seconds.
  • description:A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • tick_power_mod:0.293000
  • base_td:623.30
  • num_ticks:7
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
shadow_word_pain_mastery 5840 4.5% 132.2 3.37sec 19875 0 15079 31201 19891 29.8% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadow_word_pain_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.19 132.08 0.00 0.00 0.0000 0.0000 2627230.78 2627230.78 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 92.66 70.15% 15079.25 13422 20660 15080.99 14444 15735 1397197 1397197 0.00
crit 39.42 29.85% 31201.15 27649 42560 31207.05 29410 33470 1230034 1230034 0.00
DPS Timeline Chart

Action details: shadow_word_pain_mastery

Static Values
  • id:124464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.10
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124464
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:$@spellaura589
  • description:{$@spelldesc589=A word of darkness that causes {$s1=623} Shadow damage instantly, and an additional ${$o1-{$m1=5}} Shadow damage over {$d=18 seconds}.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.293000
  • base_dd_min:623.30
  • base_dd_max:623.30
shadowfiend 0 0.0% 2.0 180.89sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 2.00 0.00 0.00 1.2248 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 2.00 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:180.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:talent.mindbender.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Creates a shadowy fiend to attack the target. Caster receives {$34650s1=3}% mana when the Shadowfiend attacks. Lasts {$d=12 seconds}.
shadowy_apparition 5632 4.3% 114.4 3.91sec 22178 0 18785 37799 22571 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowy_apparition

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.35 112.36 0.00 0.00 0.0000 0.0000 2536122.89 2536122.89 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 89.99 80.09% 18784.60 16669 25856 18786.57 18197 19452 1690401 1690401 0.00
crit 22.37 19.91% 37798.91 33338 51713 37802.22 34758 41940 845722 845722 0.00
DPS Timeline Chart

Action details: shadowy_apparition

Static Values
  • id:87532
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:3.5000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:
Spelldata
  • id:87532
  • name:Shadowy Apparition
  • school:shadow
  • tooltip:
  • description:{$@spelldesc78203=When you deal critical periodic damage with your Shadow Word: Pain, you have a {$s1=100}% chance to summon a shadow version of yourself which will slowly move towards a target which is afflicted by your Shadow Word: Pain. Once reaching the target, it will instantly deal $?a15473[${({$87532m1=1}+$SPS*0.375*1.2+1)}][${({$87532m1=1}+$SPS*0.375)}] Shadow damage. You can have up to {$78203s2=3} Shadowy Apparitions active at a time.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.375000
  • base_dd_min:393.50
  • base_dd_max:393.50
vampiric_touch 17207 (22628) 13.2% (17.3%) 46.1 9.72sec 221206 186392 0 0 0 0.0% 0.0% 0.0% 0.0% 378.4 16885 34997 20486 19.9% 0.0% 187.8%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.08 46.08 378.39 378.39 1.1868 2.2351 7751533.20 7751533.20 0.00 11320.35 186392.18
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 46.08 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
Tick Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 303.2 80.12% 16885.34 15001 23421 16886.37 16371 17505 5119009 5119009 0.00
crit 75.2 19.88% 34996.61 30902 48248 34998.84 33255 36764 2632524 2632524 0.00
DPS Timeline Chart

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:9000.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy2
  • harmful:true
  • if_expr:(!ticking|remains<cast_time+tick_time)&miss_react
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every {$t2=3} sec., granting the Priest {$s1=2}% mana.
  • description:Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • tick_power_mod:0.346000
  • base_td:61.91
  • num_ticks:6
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
vampiric_touch_mastery 5421 4.1% 118.6 3.72sec 20587 0 16979 35203 20604 19.9% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: vampiric_touch_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 118.59 118.50 0.00 0.00 0.0000 0.0000 2441509.77 2441509.77 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 94.93 80.11% 16979.03 15001 23421 16982.03 16319 17773 1611788 1611788 0.00
crit 23.57 19.89% 35203.38 30902 48248 35204.73 32150 39110 829721 829721 0.00
DPS Timeline Chart

Action details: vampiric_touch_mastery

Static Values
  • id:124465
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Spelldata
  • id:124465
  • name:Vampiric Touch
  • school:shadow
  • tooltip:$@spellaura34914
  • description:{$@spelldesc34914=Causes $34914o2 Shadow damage over {$34914d=15 seconds}. Each time Vampiric Touch deals damage the caster gains {$s1=2}% of maximum mana.}
Direct Damage
  • may_crit:true
  • direct_power_mod:0.346000
  • base_dd_min:61.91
  • base_dd_max:61.91
pet - shadowfiend 52476 / 4169
melee 52476 3.2% 33.3 11.80sec 55728 55048 48484 98036 55727 20.4% 0.0% 23.9% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.29 33.29 0.00 0.00 1.0124 0.0000 1855219.97 1855219.97 0.00 55047.77 55047.77
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
hit 18.55 55.71% 48483.89 38145 58728 48506.80 43133 54350 899168 899168 0.00
crit 6.79 20.41% 98035.61 76291 117456 97969.32 0 117456 665983 665983 0.00
glance 7.95 23.89% 36478.77 28609 44046 36496.15 0 44046 290069 290069 0.00
DPS Timeline Chart

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:0.00
  • base_execute_time:1.50
  • base_crit:0.00
  • target:enemy1
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • direct_power_mod:1.000000
  • base_dd_min:2098.66
  • base_dd_max:2098.66
Weapon
  • normalized:false
  • weapon_power_mod:0.071429
  • weapon_multiplier:0.00
shadowcrawl 0 0.0% 5.9 74.22sec 0 0 0 0 0 0.0% 0.0% 0.0% 0.0% 0.0 0 0 0 0.0% 0.0% 0.0%

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.94 5.94 0.00 0.00 1.1939 0.0000 0.00 0.00 0.00 0.00 0.00
Direct Results Count Pct Mean Min Max Average per Iteration Average Min Average Max Actual Amount Total Amount Overkill %
none 5.94 100.00% 0.00 0 0 0.00 0 0 0 0 0.00
DPS Timeline Chart

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • cooldown:6.00
  • base_execute_time:0.00
  • base_crit:0.00
  • target:enemy1
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
bloodlust 1.0 0.0 0.0sec 0.0sec 9.01% 11.23%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • bloodlust_1:9.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Melee, ranged, and spell haste increased by {$s1=30}%.
  • description:Increases melee, ranged, and spell haste by {$s1=30}% for all party and raid members. Lasts {$d=40 seconds}. Allies receiving this effect will become Sated and be unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
essence_of_terror 4.6 0.0 107.8sec 107.8sec 20.22% 20.22%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_essence_of_terror
  • max_stacks:1
  • duration:20.00
  • cooldown:105.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:haste_rating
    • amount:7796.00

    Stack Uptimes

    • essence_of_terror_1:20.22%

    Trigger Attempt Success

    • trigger_pct:15.53%
jade_serpent_potion 1.0 0.0 421.1sec 0.0sec 10.14% 10.14%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_serpent_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:4000.00

    Stack Uptimes

    • jade_serpent_potion_1:10.14%

    Trigger Attempt Success

    • trigger_pct:100.00%
jade_spirit 12.3 8.9 36.7sec 20.7sec 43.45% 43.72%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_jade_spirit
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:1650.00
    • stat:spirit
    • amount:750.00

    Stack Uptimes

    • jade_spirit_1:43.45%

    Trigger Attempt Success

    • trigger_pct:1.65%
light_of_the_cosmos 9.8 0.0 47.9sec 47.9sec 42.66% 42.66%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_light_of_the_cosmos
  • max_stacks:1
  • duration:20.00
  • cooldown:45.00
  • default_chance:15.00%
  • default_value:0.00

    • Stat Buff details

    • stat:intellect
    • amount:3653.00

    Stack Uptimes

    • light_of_the_cosmos_1:42.66%

    Trigger Attempt Success

    • trigger_pct:14.29%
raid_movement 4.0 0.0 85.0sec 85.0sec 6.31% 6.31%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:7.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • raid_movement_1:6.31%

Trigger Attempt Success

  • trigger_pct:100.00%
shadow_word_death_reset_cooldown 7.6 0.0 10.2sec 10.2sec 9.75% 49.41%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_shadow_word_death_reset_cooldown
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadow_word_death_reset_cooldown_1:9.75%

Trigger Attempt Success

  • trigger_pct:100.00%
twist_of_fate 1.1 144.7 14.9sec 0.6sec 18.62% 100.00%

Buff details

  • buff initial source:priest_90_tof_swi
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • twist_of_fate_1:18.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After damaging or healing a target below {$s1=20}% health, you deal {$123254s1=15}% increased damage and healing for {$123254d=10 seconds}.
  • max_stacks:
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
shadowfiend-shadowcrawl 5.9 0.0 74.2sec 74.2sec 83.37% 78.70%

Buff details

  • buff initial source:priest_90_tof_swi_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • shadowcrawl_1:83.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
priest_90_tof_swi
devouring_plague Shadow Orb 17.8 53.4 3.0 3.0 138983.0
halo Mana 11.0 445914.7 40500.0 40500.0 7.3
mind_blast Mana 44.1 396756.0 9000.0 9000.0 13.1
mind_flay Mana 98.8 296375.5 3000.0 3000.0 30.5
shadow_word_death Mana 15.0 117200.9 7800.0 7800.2 17.0
shadow_word_insanity Mana 31.8 238525.2 7500.0 7499.9 26.8
shadow_word_pain Mana 60.8 803151.4 13200.0 13200.0 13.7
vampiric_touch Mana 46.1 414714.2 9000.0 9000.0 24.6
Resource Gains Type Count Total Average Overflow
shadowfiend Mana 33.29 150380.02 (5.59%) 4517.20 149235.02 49.81%
Shadow Orbs from Mind Blast Shadow Orb 44.08 44.08 (85.29%) 1.00 0.00 0.00%
Shadow Orbs from Shadow Word: Death Shadow Orb 7.60 7.60 (14.71%) 1.00 0.00 0.00%
Devouring Plague Health Health 190.57 0.00 (-nan%) 0.00 2646432.37 100.00%
Vampiric Touch Mana Mana 496.88 2097543.55 (77.91%) 4221.39 528270.05 20.12%
mp5_regen Mana 1801.21 444463.54 (16.51%) 246.76 95899.49 17.75%
Resource RPS-Gain RPS-Loss
Mana 5977.40 6022.35
Shadow Orb 0.11 0.12
Combat End Resource Mean Min Max
Health 462887.00 462887.00 462887.00
Mana 279748.92 188400.00 300000.00
Shadow Orb 1.34 0.00 3.00
Resource Gains Chart Resource Gains Chart
Resource Timeline Chart Resource Timeline Chart Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 17.9%
shadowfiend-Mana Cap 17.9%
lightwell-Mana Cap 17.9%

Procs

Count Interval
Shadowy Recall Extra Tick 365.0 1.2sec
Shadowy Apparition Procced 114.4 3.9sec

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data priest_90_tof_swi Damage Per Second
Count 49992
Mean 130776.83
Minimum 122733.16
Maximum 140091.22
Spread ( max - min ) 17358.06
Range [ ( max - min ) / 2 * 100% ] 6.64%
Standard Deviation 2356.4869
5th Percentile 127044.53
95th Percentile 134757.96
( 95th Percentile - 5th Percentile ) 7713.43
Mean Distribution
Standard Deviation 10.5394
95.00% Confidence Intervall ( 130756.18 - 130797.49 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1247
0.1 Scale Factor Error with Delta=300 47403
0.05 Scale Factor Error with Delta=300 189615
0.01 Scale Factor Error with Delta=300 4740386
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 130776.83
Distribution Chart

Damage

Sample Data
Count 49992
Mean 57022672.40
Distribution Chart

DTPS

Sample Data priest_90_tof_swi Damage Taken Per Second
Count 49992
Mean 0.00
Distribution Chart

HPS

Sample Data priest_90_tof_swi Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data priest_90_tof_swi Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 291.73
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 flask,type=warm_sun
1 0.00 food,type=mogu_fish_stew
2 0.00 power_word_fortitude,if=!aura.stamina.up
3 0.00 inner_fire
4 0.00 shadowform
5 0.00 snapshot_stats
6 0.00 jade_serpent_potion
7 0.00 mindbender,if=talent.mindbender.enabled
8 0.00 shadowfiend,if=!talent.mindbender.enabled
Default action list
# count action,conditions
9 1.00 jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
A 0.00 mindbender,if=talent.mindbender.enabled
B 2.00 shadowfiend,if=!talent.mindbender.enabled
C 0.00 power_infusion,if=talent.power_infusion.enabled
D 4.52 devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
E 15.03 shadow_word_death,if=active_enemies<=5
F 44.97 mind_blast,if=active_enemies<=6&cooldown_react
G 44.54 shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
H 46.70 vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
I 31.80 shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
J 0.00 mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
K 0.00 vampiric_embrace,if=shadow_orb=3&health.pct<=40
L 11.01 halo,if=talent.halo.enabled
M 13.26 devouring_plague,if=shadow_orb=3&ticks_remain<=1
N 0.00 cascade_damage,if=talent.cascade.enabled
O 0.00 divine_star,if=talent.divine_star.enabled
P 1.71 wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
Q 7.21 wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
R 0.00 mind_spike,if=buff.surge_of_darkness.react
S 0.00 mind_sear,chain=1,interrupt=1,if=active_enemies>=3
T 51.68 mind_flay,chain=1,interrupt=1
U 0.00 shadow_word_death,moving=1
V 0.00 mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
W 16.30 shadow_word_pain,moving=1
X 0.00 dispersion

Sample Sequence

DFGGHHLTQFTIFGHGHMTQFTFHGHTIGWWLWWFMTHHTFGTIFGTHHTFIGMTIFGLHHTFIGTFIGHHMTFIGTIGWWLWWFHHIGTFMTIFGHHIGTQFTIFGHHBGLDFTFGHHTIGQFMTQFWWWWIGHFHLTFTIGHGHFMTFTIGHHGFTLTQFMTIGHHIFGTQFTIGHHTIGWWWFLMTFHHIGTFGTHFHIGMTFIGLTFHHIGTBTFIGMTHFHIGTEEQFIGMTEEHFHIGLEDEFIGTEEFHHGMTEEFIGT9TEDEFHHGLTEEFGMTEEFH

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 135 129 80
Agility 147 140 80
Stamina 22606 20551 20474
Intellect 20094 17772 16723
Spirit 4499 4499 4282
Health 462887 434117 0
Mana 300000 300000 0
Shadow Orb 3 3 0
Spell Power 34230 26203 8441
Spell Hit 15.01% 15.01% 823
Spell Crit 21.73% 15.81% 4534
Spell Haste 25.96% 19.96% 8483
ManaReg per Second 1200 1200 0
Attack Power 138 119 0
Melee Hit 15.01% 15.01% 823
Melee Crit 15.92% 10.91% 4534
Melee Haste 19.96% 19.96% 8483
Swing Speed 31.96% 19.96% 8483
Expertise 0.00% 0.00% 0
Armor 23848 14905 14905
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 31.28% 22.28% 2625

Gear

Source Slot Average Item Level: 509.88
Local Head xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
Local Neck korvens_ambersealed_beetle,id=86976,reforge=spi_haste
Local Shoulders guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
Shirt empty
Local Chest guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
Local Waist belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
Local Legs guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
Local Feet boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
Local Wrists cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
Local Hands guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
Local Finger1 watersoul_signet,id=90511,reforge=haste_crit
Local Finger2 fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
Local Trinket1 essence_of_terror,id=87175
Local Trinket2 light_of_the_cosmos,id=87065
Local Back cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
Local Main Hand regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
Local Off Hand fan_of_fiery_winds,id=89425,enchant=165int
Unknown empty
Tabard empty

Talents

Level
15 Void Tendrils Psyfiend Dominate Mind
30 Body and Soul Angelic Feather Phantasm
45 From Darkness, Comes Light Mindbender Power Word: Solace
60 Desperate Prayer Spectral Guise Angelic Bulwark
75 Twist of Fate Power Infusion Divine Insight
90 Cascade Divine Star Halo

Profile

#!./simc

priest="priest_90_tof_swi"
origin="http://mop.chardev.org/profile/75-Priest_Shadow_T14H_test2.html"
level=90
race=troll
spec=shadow
role=spell
position=back
professions=engineering=600/blacksmithing=600
talents=http://us.battle.net/wow/en/tool/talent-calculator#Xb!..2.02
glyphs=dark_binding/mind_spike/inner_sanctum

actions.precombat=flask,type=warm_sun
actions.precombat+=/food,type=mogu_fish_stew
actions.precombat+=/power_word_fortitude,if=!aura.stamina.up
actions.precombat+=/inner_fire
actions.precombat+=/shadowform
actions.precombat+=/snapshot_stats
actions.precombat+=/jade_serpent_potion
actions.precombat+=/mindbender,if=talent.mindbender.enabled
actions.precombat+=/shadowfiend,if=!talent.mindbender.enabled

actions=jade_serpent_potion,if=buff.bloodlust.react|target.time_to_die<=40
actions+=/mindbender,if=talent.mindbender.enabled
actions+=/shadowfiend,if=!talent.mindbender.enabled
actions+=/power_infusion,if=talent.power_infusion.enabled
actions+=/devouring_plague,if=shadow_orb=3&(cooldown.mind_blast.remains<1.5|(target.health.pct<20&cooldown.shadow_word_death.remains<1.5))
actions+=/shadow_word_death,if=active_enemies<=5
actions+=/mind_blast,if=active_enemies<=6&cooldown_react
actions+=/shadow_word_pain,cycle_targets=1,max_cycle_targets=8,if=miss_react&(!ticking|ticks_remain<=1)
actions+=/vampiric_touch,cycle_targets=1,max_cycle_targets=8,if=(!ticking|remains<cast_time+tick_time)&miss_react
actions+=/shadow_word_insanity,cycle_targets=1,if=talent.power_word_solace.enabled&active_enemies<=5
actions+=/mind_spike,if=active_enemies<=6&buff.surge_of_darkness.react=2
actions+=/vampiric_embrace,if=shadow_orb=3&health.pct<=40
actions+=/halo,if=talent.halo.enabled
actions+=/devouring_plague,if=shadow_orb=3&ticks_remain<=1
actions+=/cascade_damage,if=talent.cascade.enabled
actions+=/divine_star,if=talent.divine_star.enabled
actions+=/wait,sec=cooldown.shadow_word_death.remains,if=target.health.pct<20&cooldown.shadow_word_death.remains<0.5
actions+=/wait,sec=cooldown.mind_blast.remains,if=cooldown.mind_blast.remains<0.5
actions+=/mind_spike,if=buff.surge_of_darkness.react
actions+=/mind_sear,chain=1,interrupt=1,if=active_enemies>=3
actions+=/mind_flay,chain=1,interrupt=1
actions+=/shadow_word_death,moving=1
actions+=/mind_blast,moving=1,if=buff.divine_insight_shadow.react&cooldown_react
actions+=/shadow_word_pain,moving=1
actions+=/dispersion

head=xarils_hood_of_intoxicating_vapors,id=86970,gems=burning_primal_80int_160haste_180mastery,reforge=mastery_crit
neck=korvens_ambersealed_beetle,id=86976,reforge=spi_haste
shoulders=guardian_serpent_shoulderguards,id=87123,gems=80int_160spi_60int,enchant=200int_100crit,reforge=mastery_crit
back=cloak_of_overwhelming_corruption,id=90512,enchant=180int,reforge=mastery_spi
chest=guardian_serpent_raiment,id=87122,gems=80int_160haste_80int_160haste_180haste,enchant=80all
wrists=cuffs_of_the_corrupted_waters,id=90510,gems=160int,enchant=180int,reforge=mastery_haste
hands=guardian_serpent_gloves,id=87119,gems=160int,enchant=170haste,addon=synapse_springs_mark_ii,reforge=spi_crit
waist=belt_of_malleable_amber,id=86981,gems=80int_160crit_80int_160spi_160int_120haste,reforge=haste_crit
legs=guardian_serpent_leggings,id=87121,gems=160int_60int,enchant=285int_165crit,reforge=mastery_spi
feet=boots_of_the_blowing_wind,id=86959,gems=80int_160crit_60haste,enchant=140mastery,reforge=spi_crit
finger1=watersoul_signet,id=90511,reforge=haste_crit
finger2=fragment_of_fear_made_flesh,id=86949,reforge=hit_haste
trinket1=essence_of_terror,id=87175
trinket2=light_of_the_cosmos,id=87065
main_hand=regails_crackling_dagger,id=90513,gems=80int_160spirit_60crit,enchant=jade_spirit,reforge=mastery_haste
off_hand=fan_of_fiery_winds,id=89425,enchant=165int

# Gear Summary
# gear_strength=80
# gear_agility=80
# gear_stamina=20474
# gear_intellect=16723
# gear_spirit=4282
# gear_spell_power=8441
# gear_hit_rating=823
# gear_crit_rating=4534
# gear_haste_rating=8483
# gear_mastery_rating=2625
# gear_armor=14905
# meta_gem=burning_primal
# tier14_2pc_caster=1
# tier14_4pc_caster=1
# hands=guardian_serpent_gloves,heroic=1,addon=synapse_springs_mark_ii
# main_hand=regails_crackling_dagger,heroic=1,weapon=dagger_1.80speed_2515min_4671max,enchant=jade_spirit
initial_shadow_orbs=3

Simulation & Raid Information

Iterations: 50000
Threads: 8
Confidence: 95.00%
Fight Length: 351 - 552 ( 450.4 )

Performance:
Total Events Processed: 1419822728
Max Event Queue: 189
Sim Seconds: 22521406
CPU Seconds: 2702.8800
Speed Up: 8332

Settings:
World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 37 ms ( stddev = 9 ms )

Simulation Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Standard Deviation 54.3982
5th Percentile 366.64
95th Percentile 535.52
( 95th Percentile - 5th Percentile ) 168.88
Mean Distribution
Standard Deviation 0.2433
95.00% Confidence Intervall ( 449.95 - 450.90 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 560
0.1% Error 56029
0.1 Scale Factor Error with Delta=300 25
0.05 Scale Factor Error with Delta=300 101
0.01 Scale Factor Error with Delta=300 2526
Distribution Chart
Timeline Distribution Chart Gear Chart
DPET Chart DPET Chart DPET Chart DPET Chart

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
priest_90_di_fdcl priest_90_di_fdcl devouring_plague 2944 3351651 7441 3.11 118170 244644 23.3 23.3 20.1% 0.0% 0.0% 0.0% 19.95sec 3351651 450.43sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_mastery 124467 1443451 3205 8.04 19701 40823 60.4 60.3 20.0% 0.0% 0.0% 0.0% 7.43sec 1443451 450.43sec
priest_90_di_fdcl priest_90_di_fdcl devouring_plague_tick ticks -2944 4600904 10224 25.73 19652 40717 23.3 193.0 19.9% 0.0% 0.0% 0.0% 19.95sec 4600904 450.43sec
priest_90_di_fdcl priest_90_di_fdcl halo 120644 0 0 1.46 0 0 10.9 10.9 20.3% 0.0% 0.0% 0.0% 42.49sec 0 450.43sec
priest_90_di_fdcl priest_90_di_fdcl halo_damage 120696 3148375 6990 2.91 118669 245683 10.9 21.9 19.9% 0.0% 0.0% 0.0% 42.49sec 3148375 450.43sec
priest_90_di_fdcl priest_90_di_fdcl halo_heal 120696 0 0 15.30 0 0 10.9 114.9 23.1% 0.0% 0.0% 0.0% 42.49sec 22717313 450.43sec
priest_90_di_fdcl priest_90_di_fdcl mind_blast 8092 6982490 15502 8.10 94658 196136 60.8 60.8 19.8% 0.0% 0.0% 0.0% 7.42sec 6982490 450.43sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay ticks -15407 4649580 10332 20.28 25190 52208 71.7 152.1 19.9% 0.0% 0.0% 0.0% 6.07sec 4649580 450.43sec
priest_90_di_fdcl priest_90_di_fdcl mind_flay_mastery 124468 1456197 3233 6.35 25182 52200 47.7 47.6 19.9% 0.0% 0.0% 0.0% 8.88sec 1456197 450.43sec
priest_90_di_fdcl priest_90_di_fdcl mind_spike 73510 6262938 13904 8.66 79394 164407 65.0 65.0 19.9% 0.0% 0.0% 0.0% 6.71sec 6262938 450.43sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_death 32379 1724272 3828 1.99 94689 196287 14.9 14.9 20.4% 0.0% 0.0% 0.0% 4.92sec 1724272 450.43sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain ticks -589 8575625 19057 59.07 14672 30335 49.5 443.0 29.9% 0.0% 0.0% 0.0% 9.10sec 8575625 450.43sec
priest_90_di_fdcl priest_90_di_fdcl shadow_word_pain_mastery 124464 2682761 5956 18.46 14681 30362 138.7 138.6 29.8% 0.0% 0.0% 0.0% 3.21sec 2682761 450.43sec
priest_90_di_fdcl priest_90_di_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.79sec 0 450.43sec
priest_90_di_fdcl priest_90_di_fdcl shadowy_apparition 87532 2530440 5618 15.33 18309 36822 117.1 115.1 19.9% 0.0% 0.0% 0.0% 3.82sec 2530440 450.43sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch ticks -34914 7451260 16558 49.64 16501 34188 45.5 372.3 19.9% 0.0% 0.0% 0.0% 9.84sec 7451260 450.43sec
priest_90_di_fdcl priest_90_di_fdcl vampiric_touch_mastery 124465 2326512 5165 15.47 16518 34215 116.2 116.1 19.9% 0.0% 0.0% 0.0% 3.79sec 2326512 450.43sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend melee 0 1860953 52559 56.42 48539 98101 33.3 33.3 20.6% 0.0% 23.8% 0.0% 11.81sec 1860953 35.41sec
priest_90_di_fdcl priest_90_di_fdcl_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.24sec 0 35.41sec
priest_90_di_mb priest_90_di_mb devouring_plague 2944 3207002 7120 2.98 118293 245000 22.4 22.4 19.9% 0.0% 0.0% 0.0% 20.93sec 3207002 450.43sec
priest_90_di_mb priest_90_di_mb devouring_plague_mastery 124467 1380053 3064 7.68 19722 40868 57.7 57.7 19.9% 0.0% 0.0% 0.0% 7.79sec 1380053 450.43sec
priest_90_di_mb priest_90_di_mb devouring_plague_tick ticks -2944 4416557 9815 24.66 19678 40754 22.4 185.0 19.9% 0.0% 0.0% 0.0% 20.93sec 4416557 450.43sec
priest_90_di_mb priest_90_di_mb halo 120644 0 0 1.47 0 0 11.0 11.0 20.0% 0.0% 0.0% 0.0% 42.19sec 0 450.43sec
priest_90_di_mb priest_90_di_mb halo_damage 120696 3172750 7044 2.93 118716 245827 11.0 22.0 20.0% 0.0% 0.0% 0.0% 42.19sec 3172750 450.43sec
priest_90_di_mb priest_90_di_mb halo_heal 120696 0 0 15.35 0 0 11.0 115.2 23.2% 0.0% 0.0% 0.0% 42.19sec 22819086 450.43sec
priest_90_di_mb priest_90_di_mb mind_blast 8092 6645141 14753 7.70 94648 196019 57.8 57.8 20.0% 0.0% 0.0% 0.0% 7.81sec 6645141 450.43sec
priest_90_di_mb priest_90_di_mb mind_flay ticks -15407 7352725 16339 32.09 25172 52157 108.4 240.7 19.9% 0.0% 0.0% 0.0% 4.07sec 7352725 450.43sec
priest_90_di_mb priest_90_di_mb mind_flay_mastery 124468 2298805 5104 10.02 25162 52141 75.3 75.2 20.0% 0.0% 0.0% 0.0% 5.79sec 2298805 450.43sec
priest_90_di_mb priest_90_di_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.81sec 0 450.43sec
priest_90_di_mb priest_90_di_mb shadow_word_death 32379 1720812 3820 1.99 94725 196441 14.9 14.9 20.3% 0.0% 0.0% 0.0% 4.92sec 1720812 450.43sec
priest_90_di_mb priest_90_di_mb shadow_word_pain ticks -589 8663129 19251 59.76 14665 30322 55.3 448.2 29.8% 0.0% 0.0% 0.0% 8.14sec 8663129 450.43sec
priest_90_di_mb priest_90_di_mb shadow_word_pain_mastery 124464 2712888 6023 18.66 14679 30351 140.2 140.1 29.9% 0.0% 0.0% 0.0% 3.18sec 2712888 450.43sec
priest_90_di_mb priest_90_di_mb shadowy_apparition 87532 2538289 5635 15.37 18311 36816 117.4 115.4 19.9% 0.0% 0.0% 0.0% 3.81sec 2538289 450.43sec
priest_90_di_mb priest_90_di_mb vampiric_touch ticks -34914 7405388 16456 49.34 16499 34188 45.2 370.1 19.9% 0.0% 0.0% 0.0% 9.90sec 7405388 450.43sec
priest_90_di_mb priest_90_di_mb vampiric_touch_mastery 124465 2317801 5146 15.40 16521 34225 115.7 115.6 19.9% 0.0% 0.0% 0.0% 3.81sec 2317801 450.43sec
priest_90_di_mb priest_90_di_mb_mindbender melee 0 4726848 40458 55.17 38408 77449 107.4 107.4 20.2% 0.0% 24.0% 0.0% 4.09sec 4726848 116.83sec
priest_90_di_mb priest_90_di_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.20sec 0 116.83sec
priest_90_di_swi priest_90_di_swi devouring_plague 2944 3158028 7011 2.93 118078 244762 22.0 22.0 20.0% 0.0% 0.0% 0.0% 21.18sec 3158028 450.43sec
priest_90_di_swi priest_90_di_swi devouring_plague_mastery 124467 1362302 3024 7.59 19707 40832 57.0 57.0 19.9% 0.0% 0.0% 0.0% 7.88sec 1362302 450.43sec
priest_90_di_swi priest_90_di_swi devouring_plague_tick ticks -2944 4338092 9640 24.27 19632 40669 22.0 182.0 20.0% 0.0% 0.0% 0.0% 21.18sec 4338092 450.43sec
priest_90_di_swi priest_90_di_swi halo 120644 0 0 1.45 0 0 10.9 10.9 19.7% 0.0% 0.0% 0.0% 42.68sec 0 450.43sec
priest_90_di_swi priest_90_di_swi halo_damage 120696 3134392 6959 2.91 118390 245000 10.9 21.8 19.9% 0.0% 0.0% 0.0% 42.68sec 3134392 450.43sec
priest_90_di_swi priest_90_di_swi halo_heal 120696 0 0 15.54 0 0 10.9 116.7 23.1% 0.0% 0.0% 0.0% 42.68sec 22991447 450.43sec
priest_90_di_swi priest_90_di_swi mind_blast 8092 6533943 14506 7.57 94641 196130 56.8 56.8 20.0% 0.0% 0.0% 0.0% 7.95sec 6533943 450.43sec
priest_90_di_swi priest_90_di_swi mind_flay ticks -15407 6124767 13611 26.69 25213 52262 90.5 200.1 19.9% 0.0% 0.0% 0.0% 4.87sec 6124767 450.43sec
priest_90_di_swi priest_90_di_swi mind_flay_mastery 124468 1915370 4252 8.33 25221 52293 62.6 62.5 20.0% 0.0% 0.0% 0.0% 6.94sec 1915370 450.43sec
priest_90_di_swi priest_90_di_swi shadow_word_death 32379 1724103 3828 1.99 94753 196228 14.9 14.9 20.3% 0.0% 0.0% 0.0% 4.91sec 1724103 450.43sec
priest_90_di_swi priest_90_di_swi shadow_word_insanity 129249 6126617 13602 4.15 162281 335952 31.1 31.1 19.9% 0.0% 0.0% 0.0% 13.54sec 6126617 450.43sec
priest_90_di_swi priest_90_di_swi shadow_word_pain ticks -589 8115703 18035 55.92 14676 30341 57.6 419.4 29.9% 0.0% 0.0% 0.0% 7.81sec 8115703 450.43sec
priest_90_di_swi priest_90_di_swi shadow_word_pain_mastery 124464 2540229 5640 17.47 14683 30368 131.3 131.1 29.9% 0.0% 0.0% 0.0% 3.40sec 2540229 450.43sec
priest_90_di_swi priest_90_di_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.83sec 0 450.43sec
priest_90_di_swi priest_90_di_swi shadowy_apparition 87532 2466263 5475 14.94 18312 36830 114.1 112.1 19.9% 0.0% 0.0% 0.0% 3.92sec 2466263 450.43sec
priest_90_di_swi priest_90_di_swi vampiric_touch ticks -34914 7545696 16768 50.28 16495 34178 46.0 377.1 19.9% 0.0% 0.0% 0.0% 9.74sec 7545696 450.43sec
priest_90_di_swi priest_90_di_swi vampiric_touch_mastery 124465 2359021 5237 15.69 16520 34223 117.9 117.8 19.8% 0.0% 0.0% 0.0% 3.74sec 2359021 450.43sec
priest_90_di_swi priest_90_di_swi_shadowfiend melee 0 1854135 52372 56.41 48480 98074 33.3 33.3 20.4% 0.0% 24.2% 0.0% 11.80sec 1854135 35.40sec
priest_90_di_swi priest_90_di_swi_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.20sec 0 35.40sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague 2944 2767712 6145 2.59 117697 243427 19.4 19.4 19.8% 0.0% 0.0% 0.0% 24.00sec 2767712 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_mastery 124467 1214626 2697 6.78 19671 40754 51.0 50.9 19.8% 0.0% 0.0% 0.0% 8.83sec 1214626 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl devouring_plague_tick ticks -2944 3858655 8575 21.69 19542 40454 19.4 162.7 20.0% 0.0% 0.0% 0.0% 24.00sec 3858655 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl halo 120644 0 0 1.47 0 0 11.1 11.1 20.0% 0.0% 0.0% 0.0% 42.05sec 0 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_damage 120696 3180469 7061 2.95 118546 245489 11.1 22.1 19.9% 0.0% 0.0% 0.0% 42.05sec 3180469 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl halo_heal 120696 0 0 15.41 0 0 11.1 115.7 23.1% 0.0% 0.0% 0.0% 42.05sec 22878681 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_blast 8092 5620173 12477 6.51 94694 196223 48.9 48.9 19.9% 0.0% 0.0% 0.0% 9.25sec 5620173 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay ticks -15407 5543889 12320 24.02 25321 52515 83.6 180.2 20.0% 0.0% 0.0% 0.0% 5.27sec 5543889 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_flay_mastery 124468 1730074 3841 7.50 25315 52530 56.3 56.3 19.9% 0.0% 0.0% 0.0% 7.68sec 1730074 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl mind_spike 73510 6809838 15119 9.42 79515 164725 70.7 70.7 19.7% 0.0% 0.0% 0.0% 6.19sec 6809838 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 120.96sec 0 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_death 32379 1742352 3868 2.01 94730 196589 15.1 15.1 20.2% 0.0% 0.0% 0.0% 4.87sec 1742352 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain ticks -589 8929366 19843 61.51 14682 30356 51.7 461.3 29.8% 0.0% 0.0% 0.0% 8.72sec 8929366 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl shadow_word_pain_mastery 124464 2797191 6210 19.22 14710 30419 144.4 144.3 29.8% 0.0% 0.0% 0.0% 3.09sec 2797191 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl shadowy_apparition 87532 2584800 5739 15.63 18334 36873 119.4 117.3 19.9% 0.0% 0.0% 0.0% 3.75sec 2584800 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch ticks -34914 7940047 17645 52.79 16538 34264 47.2 396.0 19.8% 0.0% 0.0% 0.0% 9.50sec 7940047 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl vampiric_touch_mastery 124465 2483819 5514 16.48 16551 34282 123.8 123.7 19.9% 0.0% 0.0% 0.0% 3.57sec 2483819 450.43sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend melee 0 1867496 52757 56.52 48674 98500 33.3 33.3 20.5% 0.0% 23.9% 0.0% 11.78sec 1867496 35.40sec
priest_90_pi_fdcl priest_90_pi_fdcl_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.21sec 0 35.40sec
priest_90_pi_mb priest_90_pi_mb devouring_plague 2944 2568483 5702 2.37 118728 245810 17.8 17.8 20.0% 0.0% 0.0% 0.0% 26.50sec 2568483 450.43sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_mastery 124467 1123109 2493 6.22 19789 41020 46.8 46.7 20.0% 0.0% 0.0% 0.0% 9.64sec 1123109 450.43sec
priest_90_pi_mb priest_90_pi_mb devouring_plague_tick ticks -2944 3572349 7939 19.89 19734 40839 17.8 149.2 20.0% 0.0% 0.0% 0.0% 26.50sec 3572349 450.43sec
priest_90_pi_mb priest_90_pi_mb halo 120644 0 0 1.48 0 0 11.1 11.1 19.7% 0.0% 0.0% 0.0% 41.84sec 0 450.43sec
priest_90_pi_mb priest_90_pi_mb halo_damage 120696 3199304 7103 2.96 118579 245404 11.1 22.2 20.1% 0.0% 0.0% 0.0% 41.84sec 3199304 450.43sec
priest_90_pi_mb priest_90_pi_mb halo_heal 120696 0 0 15.55 0 0 11.1 116.7 23.1% 0.0% 0.0% 0.0% 41.84sec 23086370 450.43sec
priest_90_pi_mb priest_90_pi_mb mind_blast 8092 5063106 11241 5.87 94760 196259 44.0 44.0 19.9% 0.0% 0.0% 0.0% 10.31sec 5063106 450.43sec
priest_90_pi_mb priest_90_pi_mb mind_flay ticks -15407 8496959 18882 36.91 25279 52422 123.5 276.8 20.0% 0.0% 0.0% 0.0% 3.59sec 8496959 450.43sec
priest_90_pi_mb priest_90_pi_mb mind_flay_mastery 124468 2661144 5908 11.55 25275 52414 86.8 86.7 20.0% 0.0% 0.0% 0.0% 5.06sec 2661144 450.43sec
priest_90_pi_mb priest_90_pi_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.78sec 0 450.43sec
priest_90_pi_mb priest_90_pi_mb power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.01sec 0 450.43sec
priest_90_pi_mb priest_90_pi_mb shadow_word_death 32379 1741747 3867 2.01 94771 196885 15.1 15.1 20.3% 0.0% 0.0% 0.0% 4.87sec 1741747 450.43sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain ticks -589 9087250 20194 62.65 14669 30330 60.7 469.9 29.8% 0.0% 0.0% 0.0% 7.41sec 9087250 450.43sec
priest_90_pi_mb priest_90_pi_mb shadow_word_pain_mastery 124464 2854396 6337 19.59 14700 30404 147.2 147.1 30.0% 0.0% 0.0% 0.0% 3.03sec 2854396 450.43sec
priest_90_pi_mb priest_90_pi_mb shadowy_apparition 87532 2601688 5776 15.74 18334 36883 120.3 118.2 19.8% 0.0% 0.0% 0.0% 3.72sec 2601688 450.43sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch ticks -34914 7919487 17599 52.57 16550 34297 46.9 394.3 19.9% 0.0% 0.0% 0.0% 9.56sec 7919487 450.43sec
priest_90_pi_mb priest_90_pi_mb vampiric_touch_mastery 124465 2475917 5497 16.41 16559 34308 123.3 123.2 20.0% 0.0% 0.0% 0.0% 3.59sec 2475917 450.43sec
priest_90_pi_mb priest_90_pi_mb_mindbender melee 0 4736697 40543 55.20 38464 77560 107.5 107.5 20.2% 0.0% 24.1% 0.0% 4.09sec 4736697 116.83sec
priest_90_pi_mb priest_90_pi_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.20sec 0 116.83sec
priest_90_pi_swi priest_90_pi_swi devouring_plague 2944 2562315 5689 2.38 118269 244808 17.8 17.8 20.0% 0.0% 0.0% 0.0% 26.33sec 2562315 450.43sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_mastery 124467 1119349 2485 6.20 19752 40945 46.6 46.6 20.2% 0.0% 0.0% 0.0% 9.67sec 1119349 450.43sec
priest_90_pi_swi priest_90_pi_swi devouring_plague_tick ticks -2944 3552937 7895 19.88 19642 40657 17.8 149.1 19.9% 0.0% 0.0% 0.0% 26.33sec 3552937 450.43sec
priest_90_pi_swi priest_90_pi_swi halo 120644 0 0 1.48 0 0 11.1 11.1 20.1% 0.0% 0.0% 0.0% 42.03sec 0 450.43sec
priest_90_pi_swi priest_90_pi_swi halo_damage 120696 3186290 7074 2.95 118475 245320 11.1 22.1 20.0% 0.0% 0.0% 0.0% 42.03sec 3186290 450.43sec
priest_90_pi_swi priest_90_pi_swi halo_heal 120696 0 0 15.52 0 0 11.1 116.5 23.0% 0.0% 0.0% 0.0% 42.03sec 22993485 450.43sec
priest_90_pi_swi priest_90_pi_swi mind_blast 8092 5080892 11280 5.89 94722 196169 44.2 44.2 19.9% 0.0% 0.0% 0.0% 10.27sec 5080892 450.43sec
priest_90_pi_swi priest_90_pi_swi mind_flay ticks -15407 7312279 16250 31.64 25349 52575 105.9 237.3 20.1% 0.0% 0.0% 0.0% 4.18sec 7312279 450.43sec
priest_90_pi_swi priest_90_pi_swi mind_flay_mastery 124468 2290889 5086 9.91 25353 52579 74.4 74.4 20.0% 0.0% 0.0% 0.0% 5.88sec 2290889 450.43sec
priest_90_pi_swi priest_90_pi_swi power_infusion 10060 0 0 0.57 0 0 4.3 4.3 0.0% 0.0% 0.0% 0.0% 121.01sec 0 450.43sec
priest_90_pi_swi priest_90_pi_swi shadow_word_death 32379 1741106 3865 2.01 94795 196476 15.1 15.1 20.2% 0.0% 0.0% 0.0% 4.87sec 1741106 450.43sec
priest_90_pi_swi priest_90_pi_swi shadow_word_insanity 129249 6121217 13590 4.16 161797 334708 31.2 31.2 19.9% 0.0% 0.0% 0.0% 13.20sec 6121217 450.43sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain ticks -589 8481016 18847 58.43 14678 30346 61.3 438.2 29.8% 0.0% 0.0% 0.0% 7.32sec 8481016 450.43sec
priest_90_pi_swi priest_90_pi_swi shadow_word_pain_mastery 124464 2654592 5893 18.24 14705 30420 137.0 136.9 29.8% 0.0% 0.0% 0.0% 3.26sec 2654592 450.43sec
priest_90_pi_swi priest_90_pi_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.91sec 0 450.43sec
priest_90_pi_swi priest_90_pi_swi shadowy_apparition 87532 2522063 5599 15.25 18333 36900 116.5 114.5 19.9% 0.0% 0.0% 0.0% 3.84sec 2522063 450.43sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch ticks -34914 7942975 17651 52.76 16544 34275 47.1 395.7 19.9% 0.0% 0.0% 0.0% 9.51sec 7942975 450.43sec
priest_90_pi_swi priest_90_pi_swi vampiric_touch_mastery 124465 2482728 5512 16.47 16552 34291 123.7 123.6 19.9% 0.0% 0.0% 0.0% 3.58sec 2482728 450.43sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend melee 0 1865001 52694 56.52 48639 98417 33.3 33.3 20.5% 0.0% 24.1% 0.0% 11.78sec 1865001 35.39sec
priest_90_pi_swi priest_90_pi_swi_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.19sec 0 35.39sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague 2944 2877677 6389 2.57 123017 254799 19.3 19.3 19.8% 0.0% 0.0% 0.0% 24.36sec 2877677 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_mastery 124467 1232247 2736 6.59 20499 42483 49.5 49.4 20.1% 0.0% 0.0% 0.0% 9.09sec 1232247 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl devouring_plague_tick ticks -2944 3915333 8701 21.07 20409 42270 19.3 158.1 20.0% 0.0% 0.0% 0.0% 24.36sec 3915333 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl halo 120644 0 0 1.47 0 0 11.0 11.0 20.0% 0.0% 0.0% 0.0% 42.16sec 0 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_damage 120696 3256583 7230 2.94 121703 252213 11.0 22.0 20.0% 0.0% 0.0% 0.0% 42.16sec 3256583 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl halo_heal 120696 0 0 15.36 0 0 11.0 115.3 23.2% 0.0% 0.0% 0.0% 42.16sec 23380203 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_blast 8092 5733728 12730 6.48 97217 201509 48.7 48.7 19.8% 0.0% 0.0% 0.0% 9.29sec 5733728 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay ticks -15407 5301813 11782 22.81 25530 52932 80.0 171.1 19.9% 0.0% 0.0% 0.0% 5.49sec 5301813 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_flay_mastery 124468 1660325 3686 7.13 25541 52943 53.5 53.5 20.0% 0.0% 0.0% 0.0% 8.00sec 1660325 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl mind_spike 73510 6671438 14811 9.01 81384 168652 67.6 67.6 19.8% 0.0% 0.0% 0.0% 6.47sec 6671438 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_death 32379 1980023 4396 1.99 108829 225858 15.0 15.0 20.0% 0.0% 0.0% 0.0% 4.90sec 1980023 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain ticks -589 8805792 19568 59.30 15020 31063 50.5 444.8 29.8% 0.0% 0.0% 0.0% 8.92sec 8805792 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl shadow_word_pain_mastery 124464 2763542 6135 18.50 15082 31208 139.0 138.9 29.9% 0.0% 0.0% 0.0% 3.21sec 2763542 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.80sec 0 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl shadowy_apparition 87532 2596699 5765 15.33 18785 37784 117.1 115.1 19.8% 0.0% 0.0% 0.0% 3.82sec 2596699 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch ticks -34914 7732769 17184 50.36 16882 34996 46.1 377.7 19.8% 0.0% 0.0% 0.0% 9.72sec 7732769 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl vampiric_touch_mastery 124465 2430089 5395 15.71 16973 35168 118.1 118.0 19.9% 0.0% 0.0% 0.0% 3.74sec 2430089 450.43sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend melee 0 1854924 52397 56.40 48529 98065 33.3 33.3 20.4% 0.0% 24.1% 0.0% 11.80sec 1854924 35.40sec
priest_90_tof_fdcl priest_90_tof_fdcl_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.22sec 0 35.40sec
priest_90_tof_mb priest_90_tof_mb devouring_plague 2944 2678179 5946 2.36 124437 257673 17.7 17.7 20.1% 0.0% 0.0% 0.0% 26.86sec 2678179 450.43sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_mastery 124467 1143616 2539 6.06 20713 42939 45.5 45.5 20.0% 0.0% 0.0% 0.0% 9.90sec 1143616 450.43sec
priest_90_tof_mb priest_90_tof_mb devouring_plague_tick ticks -2944 3646846 8104 19.39 20654 42771 17.7 145.4 20.0% 0.0% 0.0% 0.0% 26.86sec 3646846 450.43sec
priest_90_tof_mb priest_90_tof_mb halo 120644 0 0 1.48 0 0 11.1 11.1 19.9% 0.0% 0.0% 0.0% 41.84sec 0 450.43sec
priest_90_tof_mb priest_90_tof_mb halo_damage 120696 3275310 7272 2.95 121620 251966 11.1 22.2 20.0% 0.0% 0.0% 0.0% 41.84sec 3275310 450.43sec
priest_90_tof_mb priest_90_tof_mb halo_heal 120696 0 0 15.51 0 0 11.1 116.4 23.1% 0.0% 0.0% 0.0% 41.84sec 23577996 450.43sec
priest_90_tof_mb priest_90_tof_mb mind_blast 8092 5184276 11510 5.84 97373 201980 43.8 43.8 19.9% 0.0% 0.0% 0.0% 10.35sec 5184276 450.43sec
priest_90_tof_mb priest_90_tof_mb mind_flay ticks -15407 8135307 18078 34.93 25595 53064 116.8 262.0 19.9% 0.0% 0.0% 0.0% 3.78sec 8135307 450.43sec
priest_90_tof_mb priest_90_tof_mb mind_flay_mastery 124468 2541221 5642 10.90 25583 53064 81.9 81.9 19.9% 0.0% 0.0% 0.0% 5.33sec 2541221 450.43sec
priest_90_tof_mb priest_90_tof_mb mindbender 123040 0 0 0.92 0 0 6.9 6.9 0.0% 0.0% 0.0% 0.0% 60.79sec 0 450.43sec
priest_90_tof_mb priest_90_tof_mb shadow_word_death 32379 1985706 4408 1.99 108955 226135 15.0 15.0 20.2% 0.0% 0.0% 0.0% 4.90sec 1985706 450.43sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain ticks -589 8986990 19971 60.52 15008 31039 60.2 453.9 29.9% 0.0% 0.0% 0.0% 7.47sec 8986990 450.43sec
priest_90_tof_mb priest_90_tof_mb shadow_word_pain_mastery 124464 2819607 6260 18.89 15070 31172 141.9 141.8 29.9% 0.0% 0.0% 0.0% 3.14sec 2819607 450.43sec
priest_90_tof_mb priest_90_tof_mb shadowy_apparition 87532 2615937 5808 15.44 18786 37769 118.0 115.9 19.9% 0.0% 0.0% 0.0% 3.79sec 2615937 450.43sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch ticks -34914 7615199 16923 49.55 16899 35029 45.4 371.6 19.8% 0.0% 0.0% 0.0% 9.87sec 7615199 450.43sec
priest_90_tof_mb priest_90_tof_mb vampiric_touch_mastery 124465 2393383 5314 15.47 16986 35207 116.2 116.1 19.9% 0.0% 0.0% 0.0% 3.80sec 2393383 450.43sec
priest_90_tof_mb priest_90_tof_mb_mindbender melee 0 4726283 40449 55.18 38420 77435 107.5 107.5 20.1% 0.0% 24.0% 0.0% 4.09sec 4726283 116.85sec
priest_90_tof_mb priest_90_tof_mb_mindbender shadowcrawl 63619 0 0 12.03 0 0 23.4 23.4 0.0% 0.0% 0.0% 0.0% 19.20sec 0 116.85sec
priest_90_tof_swi priest_90_tof_swi devouring_plague 2944 2668052 5923 2.37 123650 256120 17.8 17.8 19.9% 0.0% 0.0% 0.0% 26.43sec 2668052 450.43sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_mastery 124467 1134441 2519 6.04 20624 42742 45.4 45.3 19.9% 0.0% 0.0% 0.0% 9.92sec 1134441 450.43sec
priest_90_tof_swi priest_90_tof_swi devouring_plague_tick ticks -2944 3612330 8027 19.37 20496 42450 17.8 145.2 19.9% 0.0% 0.0% 0.0% 26.43sec 3612330 450.43sec
priest_90_tof_swi priest_90_tof_swi halo 120644 0 0 1.47 0 0 11.0 11.0 20.0% 0.0% 0.0% 0.0% 42.27sec 0 450.43sec
priest_90_tof_swi priest_90_tof_swi halo_damage 120696 3253086 7222 2.93 121637 251901 11.0 22.0 20.0% 0.0% 0.0% 0.0% 42.27sec 3253086 450.43sec
priest_90_tof_swi priest_90_tof_swi halo_heal 120696 0 0 15.54 0 0 11.0 116.7 23.0% 0.0% 0.0% 0.0% 42.27sec 23597402 450.43sec
priest_90_tof_swi priest_90_tof_swi mind_blast 8092 5205452 11557 5.87 97370 201785 44.1 44.1 19.8% 0.0% 0.0% 0.0% 10.29sec 5205452 450.43sec
priest_90_tof_swi priest_90_tof_swi mind_flay ticks -15407 6876988 15282 29.42 25657 53201 98.8 220.6 20.0% 0.0% 0.0% 0.0% 4.48sec 6876988 450.43sec
priest_90_tof_swi priest_90_tof_swi mind_flay_mastery 124468 2154072 4782 9.21 25662 53205 69.2 69.1 20.0% 0.0% 0.0% 0.0% 6.31sec 2154072 450.43sec
priest_90_tof_swi priest_90_tof_swi shadow_word_death 32379 1991927 4422 2.00 108963 225893 15.0 15.0 20.2% 0.0% 0.0% 0.0% 4.89sec 1991927 450.43sec
priest_90_tof_swi priest_90_tof_swi shadow_word_insanity 129249 6382173 14169 4.24 165471 342698 31.8 31.8 19.9% 0.0% 0.0% 0.0% 13.28sec 6382173 450.43sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain ticks -589 8387756 18639 56.40 15034 31088 60.8 423.0 29.9% 0.0% 0.0% 0.0% 7.38sec 8387756 450.43sec
priest_90_tof_swi priest_90_tof_swi shadow_word_pain_mastery 124464 2627231 5833 17.59 15079 31201 132.2 132.1 29.8% 0.0% 0.0% 0.0% 3.37sec 2627231 450.43sec
priest_90_tof_swi priest_90_tof_swi shadowfiend 34433 0 0 0.27 0 0 2.0 2.0 0.0% 0.0% 0.0% 0.0% 180.89sec 0 450.43sec
priest_90_tof_swi priest_90_tof_swi shadowy_apparition 87532 2536123 5630 14.97 18785 37799 114.4 112.4 19.9% 0.0% 0.0% 0.0% 3.91sec 2536123 450.43sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch ticks -34914 7751533 17226 50.45 16885 34997 46.1 378.4 19.9% 0.0% 0.0% 0.0% 9.72sec 7751533 450.43sec
priest_90_tof_swi priest_90_tof_swi vampiric_touch_mastery 124465 2441510 5420 15.78 16979 35203 118.6 118.5 19.9% 0.0% 0.0% 0.0% 3.72sec 2441510 450.43sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend melee 0 1855220 52409 56.43 48484 98036 33.3 33.3 20.4% 0.0% 23.9% 0.0% 11.80sec 1855220 35.40sec
priest_90_tof_swi priest_90_tof_swi_shadowfiend shadowcrawl 63619 0 0 10.07 0 0 5.9 5.9 0.0% 0.0% 0.0% 0.0% 74.22sec 0 35.40sec

enemy1 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for enemy1 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://6.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy1 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy1 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 7.80% 7.80%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:7.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 8.50% 8.50%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.93% 10.93%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.93%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.04% 11.04%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.04%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.28% 11.28%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.28%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.99% 10.99%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.05% 11.05%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.05%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.24% 11.24%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 10.68% 10.68%

Buff details

  • buff initial source:enemy1
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:10.68%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy1
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 937108.37
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data enemy1 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy1 Damage Taken Per Second
Count 49992
Mean 937984.23
Distribution Chart

HPS

Sample Data enemy1 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy1 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 506289433 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy1"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

enemy2 : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 0.0 100.0% 100%
Scale Factors for enemy2 Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string
Zero hit/exp

Charts

http://2.chart.apis.google.com/chart?chs=525x200&cht=lc&chxs=0,ffffff|1,ffffff&chf=bg,s,333333&chg=20,20&chd=s:AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA&chco=FDD017&chds=0,60&chxt=x,y&chxl=0:|0|sec=551|1:|0|&chxp=1,1,-nan,100&chtt=enemy2 DPS Timeline&chts=dddddd,18

Abilities

Damage Stats DPS DPS% Count Interval DPE DPET Hit Crit Avg Crit% Avoid% G% B% Ticks T-Hit T-Crit T-Avg T-Crit% T-Avoid% Up%
enemy2 0

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 8.86% 8.86%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:8.86%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.27% 10.27%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.22% 10.22%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.22%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.27% 10.27%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.27%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.49% 10.49%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.46% 10.46%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.33% 10.33%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.58% 9.58%

Buff details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs

Resources

Resource Usage Type Count Total Average RPE APR
enemy2
Resource Gains Type Count Total Average Overflow
Resource RPS-Gain RPS-Loss
Health 0.00 235141.36
Combat End Resource Mean Min Max
Health 1206215.48 0.00 7036578.47
Resource Timeline Chart

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length

Sample Data
Count 49992
Mean 450.43
Minimum 350.95
Maximum 551.79
Spread ( max - min ) 200.84
Range [ ( max - min ) / 2 * 100% ] 22.29%
Distribution Chart

DPS

Sample Data enemy2 Damage Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

DPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Damage

Sample Data
Count 49992
Mean 0.00
Distribution Chart

DTPS

Sample Data enemy2 Damage Taken Per Second
Count 49992
Mean 235889.29
Distribution Chart

HPS

Sample Data enemy2 Healing Per Second
Count 49992
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Distribution Chart

HPS(e)

Sample Data
Count 49992
Mean 0.00
Distribution Chart

Heal

Sample Data
Count 49992
Mean 0.00
Distribution Chart

HTPS

Sample Data enemy2 Healing taken Per Second
Count 49992
Mean 0.00
Distribution Chart

#Executed Foreground Actions

Sample Data
Count 49992
Mean 0.00
Distribution Chart
Timeline DPS Error Chart DPS Error Chart

Action Priority List

actions.precombat
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 128485861 0
Spell Power 0 0 0
Spell Hit 0.00% 0.00% 0
Spell Crit -nan% -nan% 0
Spell Haste 0.00% 0.00% 0
ManaReg per Second 0 0 0
Attack Power 0 0 0
Melee Hit 0.00% 0.00% 0
Melee Crit 5.00% 5.00% 0
Melee Haste 0.00% 0.00% 0
Swing Speed 0.00% 0.00% 0
Expertise 0.00% 0.00% 0
Armor 24835 24835 0
Tank-Miss 0.00% 0.00% 0
Tank-Dodge 0.00% 0.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 5.00% 5.00% 0
Tank-Crit 0.00% 0.00% 0
Mastery 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00
Head empty
Neck empty
Shoulders empty
Shirt empty
Chest empty
Waist empty
Legs empty
Feet empty
Wrists empty
Hands empty
Finger1 empty
Finger2 empty
Trinket1 empty
Trinket2 empty
Back empty
Main Hand empty
Off Hand empty
Unknown empty
Tabard empty

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none

Profile

#!./simc

enemy="enemy2"
level=93
race=humanoid
spec=unknown
role=tank
position=front


# Gear Summary

APM

Average number of actions executed per minute.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

Dodge%

Percentage of executes that resulted in dodges.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

Effective DPS

Average damage per fight duration.

DPS%

Percentage of total DPS contributed by a particular action.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Error

Estimator for the 95.00confidence intervall.

G%

Percentage of executes that resulted in glancing blows.

B%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

M%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

Range

( dps.percentile( 0.95 ) - dps.percentile( 0.05 ) / 2

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

T-Crit

Average crit tick damage.

T-Crit%

Percentage of ticks that resulted in critical strikes.

T-Hit

Average non-crit tick damage.

T-M%

Percentage of ticks that resulted in misses, dodges or parries.

UpTime%

Percentage of total time that DoT is ticking on target.

T-Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Fight Length

Fight Length: 450.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.